FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 19878

FusionGeneSummary for LMBRD1_EYS

check button Fusion gene summary
Fusion gene informationFusion gene name: LMBRD1_EYS
Fusion gene ID: 19878
HgeneTgene
Gene symbol

LMBRD1

EYS

Gene ID

55788

346007

Gene nameLMBR1 domain containing 1eyes shut homolog (Drosophila)
SynonymsC6orf209|LMBD1|MAHCF|NESIC6orf178|C6orf179|C6orf180|EGFL10|EGFL11|RP25|SPAM|bA166P24.2|bA307F22.3|bA74E24.1|dJ1018A4.2|dJ22I17.2|dJ303F19.1
Cytomap

6q13

6q12

Type of geneprotein-codingprotein-coding
Descriptionprobable lysosomal cobalamin transporterHDAg-L-interacting protein NESIhepatitis delta antigen-L interacting proteinliver regeneration p-53 related proteinnuclear export signal-interacting proteinprotein eyes shut homologEGF-like-domain, multiple 10EGF-like-domain, multiple 11epidermal growth factor-like protein 10epidermal growth factor-like protein 11protein spacemaker homolog
Modification date2018052220180519
UniProtAcc

Q9NUN5

Q5T1H1

Ensembl transtripts involved in fusion geneENST00000370577, ENST00000370570, 
ENST00000503581, ENST00000370621, 
ENST00000370616, ENST00000393380, 
ENST00000342421, ENST00000370618, 
ENST00000486069, 
Fusion gene scores* DoF score5 X 4 X 5=10026 X 15 X 12=4680
# samples 527
** MAII scorelog2(5/100*10)=-1
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(27/4680*10)=-4.11547721741994
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: LMBRD1 [Title/Abstract] AND EYS [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBRCATCGA-C8-A1HK-01ALMBRD1chr6

70490386

-EYSchr6

65767620

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000370577ENST00000503581LMBRD1chr6

70490386

-EYSchr6

65767620

-
In-frameENST00000370577ENST00000370621LMBRD1chr6

70490386

-EYSchr6

65767620

-
In-frameENST00000370577ENST00000370616LMBRD1chr6

70490386

-EYSchr6

65767620

-
5CDS-intronENST00000370577ENST00000393380LMBRD1chr6

70490386

-EYSchr6

65767620

-
5CDS-intronENST00000370577ENST00000342421LMBRD1chr6

70490386

-EYSchr6

65767620

-
5CDS-intronENST00000370577ENST00000370618LMBRD1chr6

70490386

-EYSchr6

65767620

-
5CDS-intronENST00000370577ENST00000486069LMBRD1chr6

70490386

-EYSchr6

65767620

-
In-frameENST00000370570ENST00000503581LMBRD1chr6

70490386

-EYSchr6

65767620

-
In-frameENST00000370570ENST00000370621LMBRD1chr6

70490386

-EYSchr6

65767620

-
In-frameENST00000370570ENST00000370616LMBRD1chr6

70490386

-EYSchr6

65767620

-
5CDS-intronENST00000370570ENST00000393380LMBRD1chr6

70490386

-EYSchr6

65767620

-
5CDS-intronENST00000370570ENST00000342421LMBRD1chr6

70490386

-EYSchr6

65767620

-
5CDS-intronENST00000370570ENST00000370618LMBRD1chr6

70490386

-EYSchr6

65767620

-
5CDS-intronENST00000370570ENST00000486069LMBRD1chr6

70490386

-EYSchr6

65767620

-

Top

FusionProtFeatures for LMBRD1_EYS


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
LMBRD1

Q9NUN5

EYS

Q5T1H1

Probable lysosomal cobalamin transporter. Required toexport cobalamin from lysosomes allowing its conversion tocofactors. {ECO:0000269|PubMed:19136951}. (Microbial infection) Isoform 3: May play a role in theassembly of hepatitis delta virus (HDV).{ECO:0000269|PubMed:15956556}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneLMBRD1chr6:70490386chr6:65767620ENST00000370570-2151_1029468Topological domainExtracellular
HgeneLMBRD1chr6:70490386chr6:65767620ENST00000370577-3161_10102541Topological domainExtracellular
HgeneLMBRD1chr6:70490386chr6:65767620ENST00000370577-31632_50102541Topological domainCytoplasmic
HgeneLMBRD1chr6:70490386chr6:65767620ENST00000370577-31672_100102541Topological domainExtracellular
HgeneLMBRD1chr6:70490386chr6:65767620ENST00000370570-21511_3129468TransmembraneHelical%3B Name%3D1
HgeneLMBRD1chr6:70490386chr6:65767620ENST00000370577-31611_31102541TransmembraneHelical%3B Name%3D1
HgeneLMBRD1chr6:70490386chr6:65767620ENST00000370577-31651_71102541TransmembraneHelical%3B Name%3D2
TgeneEYSchr6:70490386chr6:65767620ENST00000342421-091004_1040-111595DomainEGF-like 16%3B calcium-binding
TgeneEYSchr6:70490386chr6:65767620ENST00000342421-091042_1077-111595DomainEGF-like 17
TgeneEYSchr6:70490386chr6:65767620ENST00000342421-091079_1115-111595DomainEGF-like 18
TgeneEYSchr6:70490386chr6:65767620ENST00000342421-091117_1159-111595DomainEGF-like 19
TgeneEYSchr6:70490386chr6:65767620ENST00000342421-091161_1197-111595DomainEGF-like 20%3B calcium-binding
TgeneEYSchr6:70490386chr6:65767620ENST00000342421-09170_212-111595DomainEGF-like 1
TgeneEYSchr6:70490386chr6:65767620ENST00000342421-091883_2063-111595DomainLaminin G-like 1
TgeneEYSchr6:70490386chr6:65767620ENST00000342421-092099_2140-111595DomainEGF-like 21
TgeneEYSchr6:70490386chr6:65767620ENST00000342421-09213_254-111595DomainEGF-like 2
TgeneEYSchr6:70490386chr6:65767620ENST00000342421-092145_2339-111595DomainLaminin G-like 2
TgeneEYSchr6:70490386chr6:65767620ENST00000342421-092335_2368-111595DomainEGF-like 22
TgeneEYSchr6:70490386chr6:65767620ENST00000342421-092371_2408-111595DomainEGF-like 23
TgeneEYSchr6:70490386chr6:65767620ENST00000342421-092419_2609-111595DomainLaminin G-like 3
TgeneEYSchr6:70490386chr6:65767620ENST00000342421-09256_292-111595DomainEGF-like 3
TgeneEYSchr6:70490386chr6:65767620ENST00000342421-092610_2646-111595DomainEGF-like 24
TgeneEYSchr6:70490386chr6:65767620ENST00000342421-092648_2689-111595DomainEGF-like 25
TgeneEYSchr6:70490386chr6:65767620ENST00000342421-092717_2895-111595DomainLaminin G-like 4
TgeneEYSchr6:70490386chr6:65767620ENST00000342421-092896_2932-111595DomainEGF-like 26
TgeneEYSchr6:70490386chr6:65767620ENST00000342421-092933_2970-111595DomainEGF-like 27
TgeneEYSchr6:70490386chr6:65767620ENST00000342421-092975_3165-111595DomainLaminin G-like 5
TgeneEYSchr6:70490386chr6:65767620ENST00000342421-09332_368-111595DomainEGF-like 4
TgeneEYSchr6:70490386chr6:65767620ENST00000342421-09370_406-111595DomainEGF-like 5
TgeneEYSchr6:70490386chr6:65767620ENST00000342421-09567_602-111595DomainEGF-like 6
TgeneEYSchr6:70490386chr6:65767620ENST00000342421-09643_679-111595DomainEGF-like 7
TgeneEYSchr6:70490386chr6:65767620ENST00000342421-09681_720-111595DomainEGF-like 8%3B calcium-binding
TgeneEYSchr6:70490386chr6:65767620ENST00000342421-09733_769-111595DomainEGF-like 9%3B calcium-binding
TgeneEYSchr6:70490386chr6:65767620ENST00000342421-09771_807-111595DomainEGF-like 10%3B calcium-binding
TgeneEYSchr6:70490386chr6:65767620ENST00000342421-09809_847-111595DomainEGF-like 11
TgeneEYSchr6:70490386chr6:65767620ENST00000342421-09849_888-111595DomainEGF-like 12
TgeneEYSchr6:70490386chr6:65767620ENST00000342421-09890_926-111595DomainEGF-like 13
TgeneEYSchr6:70490386chr6:65767620ENST00000342421-09928_964-111595DomainEGF-like 14%3B calcium-binding
TgeneEYSchr6:70490386chr6:65767620ENST00000342421-09966_1002-111595DomainEGF-like 15
TgeneEYSchr6:70490386chr6:65767620ENST00000370616-8411004_10406743166DomainEGF-like 16%3B calcium-binding
TgeneEYSchr6:70490386chr6:65767620ENST00000370616-8411042_10776743166DomainEGF-like 17
TgeneEYSchr6:70490386chr6:65767620ENST00000370616-8411079_11156743166DomainEGF-like 18
TgeneEYSchr6:70490386chr6:65767620ENST00000370616-8411117_11596743166DomainEGF-like 19
TgeneEYSchr6:70490386chr6:65767620ENST00000370616-8411161_11976743166DomainEGF-like 20%3B calcium-binding
TgeneEYSchr6:70490386chr6:65767620ENST00000370616-8411883_20636743166DomainLaminin G-like 1
TgeneEYSchr6:70490386chr6:65767620ENST00000370616-8412099_21406743166DomainEGF-like 21
TgeneEYSchr6:70490386chr6:65767620ENST00000370616-8412145_23396743166DomainLaminin G-like 2
TgeneEYSchr6:70490386chr6:65767620ENST00000370616-8412335_23686743166DomainEGF-like 22
TgeneEYSchr6:70490386chr6:65767620ENST00000370616-8412371_24086743166DomainEGF-like 23
TgeneEYSchr6:70490386chr6:65767620ENST00000370616-8412419_26096743166DomainLaminin G-like 3
TgeneEYSchr6:70490386chr6:65767620ENST00000370616-8412610_26466743166DomainEGF-like 24
TgeneEYSchr6:70490386chr6:65767620ENST00000370616-8412648_26896743166DomainEGF-like 25
TgeneEYSchr6:70490386chr6:65767620ENST00000370616-8412717_28956743166DomainLaminin G-like 4
TgeneEYSchr6:70490386chr6:65767620ENST00000370616-8412896_29326743166DomainEGF-like 26
TgeneEYSchr6:70490386chr6:65767620ENST00000370616-8412933_29706743166DomainEGF-like 27
TgeneEYSchr6:70490386chr6:65767620ENST00000370616-8412975_31656743166DomainLaminin G-like 5
TgeneEYSchr6:70490386chr6:65767620ENST00000370616-841681_7206743166DomainEGF-like 8%3B calcium-binding
TgeneEYSchr6:70490386chr6:65767620ENST00000370616-841733_7696743166DomainEGF-like 9%3B calcium-binding
TgeneEYSchr6:70490386chr6:65767620ENST00000370616-841771_8076743166DomainEGF-like 10%3B calcium-binding
TgeneEYSchr6:70490386chr6:65767620ENST00000370616-841809_8476743166DomainEGF-like 11
TgeneEYSchr6:70490386chr6:65767620ENST00000370616-841849_8886743166DomainEGF-like 12
TgeneEYSchr6:70490386chr6:65767620ENST00000370616-841890_9266743166DomainEGF-like 13
TgeneEYSchr6:70490386chr6:65767620ENST00000370616-841928_9646743166DomainEGF-like 14%3B calcium-binding
TgeneEYSchr6:70490386chr6:65767620ENST00000370616-841966_10026743166DomainEGF-like 15
TgeneEYSchr6:70490386chr6:65767620ENST00000370618-0111004_1040-176595DomainEGF-like 16%3B calcium-binding
TgeneEYSchr6:70490386chr6:65767620ENST00000370618-0111042_1077-176595DomainEGF-like 17
TgeneEYSchr6:70490386chr6:65767620ENST00000370618-0111079_1115-176595DomainEGF-like 18
TgeneEYSchr6:70490386chr6:65767620ENST00000370618-0111117_1159-176595DomainEGF-like 19
TgeneEYSchr6:70490386chr6:65767620ENST00000370618-0111161_1197-176595DomainEGF-like 20%3B calcium-binding
TgeneEYSchr6:70490386chr6:65767620ENST00000370618-011170_212-176595DomainEGF-like 1
TgeneEYSchr6:70490386chr6:65767620ENST00000370618-0111883_2063-176595DomainLaminin G-like 1
TgeneEYSchr6:70490386chr6:65767620ENST00000370618-0112099_2140-176595DomainEGF-like 21
TgeneEYSchr6:70490386chr6:65767620ENST00000370618-011213_254-176595DomainEGF-like 2
TgeneEYSchr6:70490386chr6:65767620ENST00000370618-0112145_2339-176595DomainLaminin G-like 2
TgeneEYSchr6:70490386chr6:65767620ENST00000370618-0112335_2368-176595DomainEGF-like 22
TgeneEYSchr6:70490386chr6:65767620ENST00000370618-0112371_2408-176595DomainEGF-like 23
TgeneEYSchr6:70490386chr6:65767620ENST00000370618-0112419_2609-176595DomainLaminin G-like 3
TgeneEYSchr6:70490386chr6:65767620ENST00000370618-011256_292-176595DomainEGF-like 3
TgeneEYSchr6:70490386chr6:65767620ENST00000370618-0112610_2646-176595DomainEGF-like 24
TgeneEYSchr6:70490386chr6:65767620ENST00000370618-0112648_2689-176595DomainEGF-like 25
TgeneEYSchr6:70490386chr6:65767620ENST00000370618-0112717_2895-176595DomainLaminin G-like 4
TgeneEYSchr6:70490386chr6:65767620ENST00000370618-0112896_2932-176595DomainEGF-like 26
TgeneEYSchr6:70490386chr6:65767620ENST00000370618-0112933_2970-176595DomainEGF-like 27
TgeneEYSchr6:70490386chr6:65767620ENST00000370618-0112975_3165-176595DomainLaminin G-like 5
TgeneEYSchr6:70490386chr6:65767620ENST00000370618-011332_368-176595DomainEGF-like 4
TgeneEYSchr6:70490386chr6:65767620ENST00000370618-011370_406-176595DomainEGF-like 5
TgeneEYSchr6:70490386chr6:65767620ENST00000370618-011567_602-176595DomainEGF-like 6
TgeneEYSchr6:70490386chr6:65767620ENST00000370618-011643_679-176595DomainEGF-like 7
TgeneEYSchr6:70490386chr6:65767620ENST00000370618-011681_720-176595DomainEGF-like 8%3B calcium-binding
TgeneEYSchr6:70490386chr6:65767620ENST00000370618-011733_769-176595DomainEGF-like 9%3B calcium-binding
TgeneEYSchr6:70490386chr6:65767620ENST00000370618-011771_807-176595DomainEGF-like 10%3B calcium-binding
TgeneEYSchr6:70490386chr6:65767620ENST00000370618-011809_847-176595DomainEGF-like 11
TgeneEYSchr6:70490386chr6:65767620ENST00000370618-011849_888-176595DomainEGF-like 12
TgeneEYSchr6:70490386chr6:65767620ENST00000370618-011890_926-176595DomainEGF-like 13
TgeneEYSchr6:70490386chr6:65767620ENST00000370618-011928_964-176595DomainEGF-like 14%3B calcium-binding
TgeneEYSchr6:70490386chr6:65767620ENST00000370618-011966_1002-176595DomainEGF-like 15
TgeneEYSchr6:70490386chr6:65767620ENST00000370621-11441004_10406743166DomainEGF-like 16%3B calcium-binding
TgeneEYSchr6:70490386chr6:65767620ENST00000370621-11441042_10776743166DomainEGF-like 17
TgeneEYSchr6:70490386chr6:65767620ENST00000370621-11441079_11156743166DomainEGF-like 18
TgeneEYSchr6:70490386chr6:65767620ENST00000370621-11441117_11596743166DomainEGF-like 19
TgeneEYSchr6:70490386chr6:65767620ENST00000370621-11441161_11976743166DomainEGF-like 20%3B calcium-binding
TgeneEYSchr6:70490386chr6:65767620ENST00000370621-11441883_20636743166DomainLaminin G-like 1
TgeneEYSchr6:70490386chr6:65767620ENST00000370621-11442099_21406743166DomainEGF-like 21
TgeneEYSchr6:70490386chr6:65767620ENST00000370621-11442145_23396743166DomainLaminin G-like 2
TgeneEYSchr6:70490386chr6:65767620ENST00000370621-11442335_23686743166DomainEGF-like 22
TgeneEYSchr6:70490386chr6:65767620ENST00000370621-11442371_24086743166DomainEGF-like 23
TgeneEYSchr6:70490386chr6:65767620ENST00000370621-11442419_26096743166DomainLaminin G-like 3
TgeneEYSchr6:70490386chr6:65767620ENST00000370621-11442610_26466743166DomainEGF-like 24
TgeneEYSchr6:70490386chr6:65767620ENST00000370621-11442648_26896743166DomainEGF-like 25
TgeneEYSchr6:70490386chr6:65767620ENST00000370621-11442717_28956743166DomainLaminin G-like 4
TgeneEYSchr6:70490386chr6:65767620ENST00000370621-11442896_29326743166DomainEGF-like 26
TgeneEYSchr6:70490386chr6:65767620ENST00000370621-11442933_29706743166DomainEGF-like 27
TgeneEYSchr6:70490386chr6:65767620ENST00000370621-11442975_31656743166DomainLaminin G-like 5
TgeneEYSchr6:70490386chr6:65767620ENST00000370621-1144681_7206743166DomainEGF-like 8%3B calcium-binding
TgeneEYSchr6:70490386chr6:65767620ENST00000370621-1144733_7696743166DomainEGF-like 9%3B calcium-binding
TgeneEYSchr6:70490386chr6:65767620ENST00000370621-1144771_8076743166DomainEGF-like 10%3B calcium-binding
TgeneEYSchr6:70490386chr6:65767620ENST00000370621-1144809_8476743166DomainEGF-like 11
TgeneEYSchr6:70490386chr6:65767620ENST00000370621-1144849_8886743166DomainEGF-like 12
TgeneEYSchr6:70490386chr6:65767620ENST00000370621-1144890_9266743166DomainEGF-like 13
TgeneEYSchr6:70490386chr6:65767620ENST00000370621-1144928_9646743166DomainEGF-like 14%3B calcium-binding
TgeneEYSchr6:70490386chr6:65767620ENST00000370621-1144966_10026743166DomainEGF-like 15
TgeneEYSchr6:70490386chr6:65767620ENST00000393380-0121004_1040-180620DomainEGF-like 16%3B calcium-binding
TgeneEYSchr6:70490386chr6:65767620ENST00000393380-0121042_1077-180620DomainEGF-like 17
TgeneEYSchr6:70490386chr6:65767620ENST00000393380-0121079_1115-180620DomainEGF-like 18
TgeneEYSchr6:70490386chr6:65767620ENST00000393380-0121117_1159-180620DomainEGF-like 19
TgeneEYSchr6:70490386chr6:65767620ENST00000393380-0121161_1197-180620DomainEGF-like 20%3B calcium-binding
TgeneEYSchr6:70490386chr6:65767620ENST00000393380-012170_212-180620DomainEGF-like 1
TgeneEYSchr6:70490386chr6:65767620ENST00000393380-0121883_2063-180620DomainLaminin G-like 1
TgeneEYSchr6:70490386chr6:65767620ENST00000393380-0122099_2140-180620DomainEGF-like 21
TgeneEYSchr6:70490386chr6:65767620ENST00000393380-012213_254-180620DomainEGF-like 2
TgeneEYSchr6:70490386chr6:65767620ENST00000393380-0122145_2339-180620DomainLaminin G-like 2
TgeneEYSchr6:70490386chr6:65767620ENST00000393380-0122335_2368-180620DomainEGF-like 22
TgeneEYSchr6:70490386chr6:65767620ENST00000393380-0122371_2408-180620DomainEGF-like 23
TgeneEYSchr6:70490386chr6:65767620ENST00000393380-0122419_2609-180620DomainLaminin G-like 3
TgeneEYSchr6:70490386chr6:65767620ENST00000393380-012256_292-180620DomainEGF-like 3
TgeneEYSchr6:70490386chr6:65767620ENST00000393380-0122610_2646-180620DomainEGF-like 24
TgeneEYSchr6:70490386chr6:65767620ENST00000393380-0122648_2689-180620DomainEGF-like 25
TgeneEYSchr6:70490386chr6:65767620ENST00000393380-0122717_2895-180620DomainLaminin G-like 4
TgeneEYSchr6:70490386chr6:65767620ENST00000393380-0122896_2932-180620DomainEGF-like 26
TgeneEYSchr6:70490386chr6:65767620ENST00000393380-0122933_2970-180620DomainEGF-like 27
TgeneEYSchr6:70490386chr6:65767620ENST00000393380-0122975_3165-180620DomainLaminin G-like 5
TgeneEYSchr6:70490386chr6:65767620ENST00000393380-012332_368-180620DomainEGF-like 4
TgeneEYSchr6:70490386chr6:65767620ENST00000393380-012370_406-180620DomainEGF-like 5
TgeneEYSchr6:70490386chr6:65767620ENST00000393380-012567_602-180620DomainEGF-like 6
TgeneEYSchr6:70490386chr6:65767620ENST00000393380-012643_679-180620DomainEGF-like 7
TgeneEYSchr6:70490386chr6:65767620ENST00000393380-012681_720-180620DomainEGF-like 8%3B calcium-binding
TgeneEYSchr6:70490386chr6:65767620ENST00000393380-012733_769-180620DomainEGF-like 9%3B calcium-binding
TgeneEYSchr6:70490386chr6:65767620ENST00000393380-012771_807-180620DomainEGF-like 10%3B calcium-binding
TgeneEYSchr6:70490386chr6:65767620ENST00000393380-012809_847-180620DomainEGF-like 11
TgeneEYSchr6:70490386chr6:65767620ENST00000393380-012849_888-180620DomainEGF-like 12
TgeneEYSchr6:70490386chr6:65767620ENST00000393380-012890_926-180620DomainEGF-like 13
TgeneEYSchr6:70490386chr6:65767620ENST00000393380-012928_964-180620DomainEGF-like 14%3B calcium-binding
TgeneEYSchr6:70490386chr6:65767620ENST00000393380-012966_1002-180620DomainEGF-like 15
TgeneEYSchr6:70490386chr6:65767620ENST00000503581-11431004_10406743145DomainEGF-like 16%3B calcium-binding
TgeneEYSchr6:70490386chr6:65767620ENST00000503581-11431042_10776743145DomainEGF-like 17
TgeneEYSchr6:70490386chr6:65767620ENST00000503581-11431079_11156743145DomainEGF-like 18
TgeneEYSchr6:70490386chr6:65767620ENST00000503581-11431117_11596743145DomainEGF-like 19
TgeneEYSchr6:70490386chr6:65767620ENST00000503581-11431161_11976743145DomainEGF-like 20%3B calcium-binding
TgeneEYSchr6:70490386chr6:65767620ENST00000503581-11431883_20636743145DomainLaminin G-like 1
TgeneEYSchr6:70490386chr6:65767620ENST00000503581-11432099_21406743145DomainEGF-like 21
TgeneEYSchr6:70490386chr6:65767620ENST00000503581-11432145_23396743145DomainLaminin G-like 2
TgeneEYSchr6:70490386chr6:65767620ENST00000503581-11432335_23686743145DomainEGF-like 22
TgeneEYSchr6:70490386chr6:65767620ENST00000503581-11432371_24086743145DomainEGF-like 23
TgeneEYSchr6:70490386chr6:65767620ENST00000503581-11432419_26096743145DomainLaminin G-like 3
TgeneEYSchr6:70490386chr6:65767620ENST00000503581-11432610_26466743145DomainEGF-like 24
TgeneEYSchr6:70490386chr6:65767620ENST00000503581-11432648_26896743145DomainEGF-like 25
TgeneEYSchr6:70490386chr6:65767620ENST00000503581-11432717_28956743145DomainLaminin G-like 4
TgeneEYSchr6:70490386chr6:65767620ENST00000503581-11432896_29326743145DomainEGF-like 26
TgeneEYSchr6:70490386chr6:65767620ENST00000503581-11432933_29706743145DomainEGF-like 27
TgeneEYSchr6:70490386chr6:65767620ENST00000503581-11432975_31656743145DomainLaminin G-like 5
TgeneEYSchr6:70490386chr6:65767620ENST00000503581-1143681_7206743145DomainEGF-like 8%3B calcium-binding
TgeneEYSchr6:70490386chr6:65767620ENST00000503581-1143733_7696743145DomainEGF-like 9%3B calcium-binding
TgeneEYSchr6:70490386chr6:65767620ENST00000503581-1143771_8076743145DomainEGF-like 10%3B calcium-binding
TgeneEYSchr6:70490386chr6:65767620ENST00000503581-1143809_8476743145DomainEGF-like 11
TgeneEYSchr6:70490386chr6:65767620ENST00000503581-1143849_8886743145DomainEGF-like 12
TgeneEYSchr6:70490386chr6:65767620ENST00000503581-1143890_9266743145DomainEGF-like 13
TgeneEYSchr6:70490386chr6:65767620ENST00000503581-1143928_9646743145DomainEGF-like 14%3B calcium-binding
TgeneEYSchr6:70490386chr6:65767620ENST00000503581-1143966_10026743145DomainEGF-like 15

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneLMBRD1chr6:70490386chr6:65767620ENST00000370570-215122_14429468Topological domainCytoplasmic
HgeneLMBRD1chr6:70490386chr6:65767620ENST00000370570-215166_18829468Topological domainExtracellular
HgeneLMBRD1chr6:70490386chr6:65767620ENST00000370570-215210_30529468Topological domainCytoplasmic
HgeneLMBRD1chr6:70490386chr6:65767620ENST00000370570-215327_36429468Topological domainExtracellular
HgeneLMBRD1chr6:70490386chr6:65767620ENST00000370570-21532_5029468Topological domainCytoplasmic
HgeneLMBRD1chr6:70490386chr6:65767620ENST00000370570-215386_40829468Topological domainCytoplasmic
HgeneLMBRD1chr6:70490386chr6:65767620ENST00000370570-215430_48629468Topological domainExtracellular
HgeneLMBRD1chr6:70490386chr6:65767620ENST00000370570-215508_54029468Topological domainCytoplasmic
HgeneLMBRD1chr6:70490386chr6:65767620ENST00000370570-21572_10029468Topological domainExtracellular
HgeneLMBRD1chr6:70490386chr6:65767620ENST00000370577-316122_144102541Topological domainCytoplasmic
HgeneLMBRD1chr6:70490386chr6:65767620ENST00000370577-316166_188102541Topological domainExtracellular
HgeneLMBRD1chr6:70490386chr6:65767620ENST00000370577-316210_305102541Topological domainCytoplasmic
HgeneLMBRD1chr6:70490386chr6:65767620ENST00000370577-316327_364102541Topological domainExtracellular
HgeneLMBRD1chr6:70490386chr6:65767620ENST00000370577-316386_408102541Topological domainCytoplasmic
HgeneLMBRD1chr6:70490386chr6:65767620ENST00000370577-316430_486102541Topological domainExtracellular
HgeneLMBRD1chr6:70490386chr6:65767620ENST00000370577-316508_540102541Topological domainCytoplasmic
HgeneLMBRD1chr6:70490386chr6:65767620ENST00000370570-215101_12129468TransmembraneHelical%3B Name%3D3
HgeneLMBRD1chr6:70490386chr6:65767620ENST00000370570-215145_16529468TransmembraneHelical%3B Name%3D4
HgeneLMBRD1chr6:70490386chr6:65767620ENST00000370570-215189_20929468TransmembraneHelical%3B Name%3D5
HgeneLMBRD1chr6:70490386chr6:65767620ENST00000370570-215306_32629468TransmembraneHelical%3B Name%3D6
HgeneLMBRD1chr6:70490386chr6:65767620ENST00000370570-215365_38529468TransmembraneHelical%3B Name%3D7
HgeneLMBRD1chr6:70490386chr6:65767620ENST00000370570-215409_42929468TransmembraneHelical%3B Name%3D8
HgeneLMBRD1chr6:70490386chr6:65767620ENST00000370570-215487_50729468TransmembraneHelical%3B Name%3D9
HgeneLMBRD1chr6:70490386chr6:65767620ENST00000370570-21551_7129468TransmembraneHelical%3B Name%3D2
HgeneLMBRD1chr6:70490386chr6:65767620ENST00000370577-316101_121102541TransmembraneHelical%3B Name%3D3
HgeneLMBRD1chr6:70490386chr6:65767620ENST00000370577-316145_165102541TransmembraneHelical%3B Name%3D4
HgeneLMBRD1chr6:70490386chr6:65767620ENST00000370577-316189_209102541TransmembraneHelical%3B Name%3D5
HgeneLMBRD1chr6:70490386chr6:65767620ENST00000370577-316306_326102541TransmembraneHelical%3B Name%3D6
HgeneLMBRD1chr6:70490386chr6:65767620ENST00000370577-316365_385102541TransmembraneHelical%3B Name%3D7
HgeneLMBRD1chr6:70490386chr6:65767620ENST00000370577-316409_429102541TransmembraneHelical%3B Name%3D8
HgeneLMBRD1chr6:70490386chr6:65767620ENST00000370577-316487_507102541TransmembraneHelical%3B Name%3D9
TgeneEYSchr6:70490386chr6:65767620ENST00000370616-841170_2126743166DomainEGF-like 1
TgeneEYSchr6:70490386chr6:65767620ENST00000370616-841213_2546743166DomainEGF-like 2
TgeneEYSchr6:70490386chr6:65767620ENST00000370616-841256_2926743166DomainEGF-like 3
TgeneEYSchr6:70490386chr6:65767620ENST00000370616-841332_3686743166DomainEGF-like 4
TgeneEYSchr6:70490386chr6:65767620ENST00000370616-841370_4066743166DomainEGF-like 5
TgeneEYSchr6:70490386chr6:65767620ENST00000370616-841567_6026743166DomainEGF-like 6
TgeneEYSchr6:70490386chr6:65767620ENST00000370616-841643_6796743166DomainEGF-like 7
TgeneEYSchr6:70490386chr6:65767620ENST00000370621-1144170_2126743166DomainEGF-like 1
TgeneEYSchr6:70490386chr6:65767620ENST00000370621-1144213_2546743166DomainEGF-like 2
TgeneEYSchr6:70490386chr6:65767620ENST00000370621-1144256_2926743166DomainEGF-like 3
TgeneEYSchr6:70490386chr6:65767620ENST00000370621-1144332_3686743166DomainEGF-like 4
TgeneEYSchr6:70490386chr6:65767620ENST00000370621-1144370_4066743166DomainEGF-like 5
TgeneEYSchr6:70490386chr6:65767620ENST00000370621-1144567_6026743166DomainEGF-like 6
TgeneEYSchr6:70490386chr6:65767620ENST00000370621-1144643_6796743166DomainEGF-like 7
TgeneEYSchr6:70490386chr6:65767620ENST00000503581-1143170_2126743145DomainEGF-like 1
TgeneEYSchr6:70490386chr6:65767620ENST00000503581-1143213_2546743145DomainEGF-like 2
TgeneEYSchr6:70490386chr6:65767620ENST00000503581-1143256_2926743145DomainEGF-like 3
TgeneEYSchr6:70490386chr6:65767620ENST00000503581-1143332_3686743145DomainEGF-like 4
TgeneEYSchr6:70490386chr6:65767620ENST00000503581-1143370_4066743145DomainEGF-like 5
TgeneEYSchr6:70490386chr6:65767620ENST00000503581-1143567_6026743145DomainEGF-like 6
TgeneEYSchr6:70490386chr6:65767620ENST00000503581-1143643_6796743145DomainEGF-like 7


Top

FusionGeneSequence for LMBRD1_EYS


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_LMBRD1_ENST00000370577_chr6_70490386_-_EYS_ENST00000503581_chr6_65767620_-_2573aa
MATSGAASAELVIGWCIFGLLLLAILAFCWITVRKYQSRRESEVVSTITAIFSLAIALITSALLPVDIFLVSYMKNQNGTFKDWANANVS
RQIEDTVLYGYTSTQCEIDIDECASHPCKNGATCIDQPGNYFCQCVPPFKVVDGFSCLCNPGTVGIRCEQDIDDCILNACEHNSTCKDLH
LSYQCVCLSDWEGNFCEQESNECKMNPCKNNSTCTDLYKSTRCECTSGWTGQNCSEEINECDSDPCMNGGLCHESTIPGQFVCLCPPLTT
GQFCHQRTNLCDLLHNPCRNNSTCLALVDANQHCICREEFEGKNCEIDVKDCLFLSCQDTGDCEDMVNNFRCICRPGFSGSLCEIEINEC
SSEPCKNNGTCVDLTNRFFCNCEPEYHGPFCELDVNKCKISPCLDEENCVYRTDGYNCLCAPGTTGINCEINLDECLSEPCLHDGVCIDG
INHTTCDCKSGFFGTHCETNANDCLSNPCLHGRCTELINETPCSCDADGTSTQCKIKINDCTSIPCMNEGFCQKSAHGFTCICPRGYTGA
YCEKSIDNCAEPELNSVICLNGGICVDGPGHTFDCRCLPGFSGQFCEININECSSSPCLHGADCEDHINGTVCKCQPGWSGHHCENELEC
IPNSCVHELCMENEPGSTCLCTPGFMTCSIGLLCGDEIRRITCLTPIFQRTDPISTQTTTIPPSETLVSSFPSIKATRIPAIMDTYPVDQ
GPKQTGIVKHDILPTTGLATLRISTPLESYLLQELIVTRELSAKHSLLSSADVSSSRFLNFGIRDPAQIVQDKTSVSHMPIRTSAATLGF
FFPDRRARTPFIMSSLMSDFIFPTQSLLFENCQTVALSATPTTSVIRSIPGADIELNRQSLLSRGFLLIAASISATPVVSRGAQEDIEET
SADSLISRREHWRLLSPSMSPIFPAKVIISKQVTILNSSALHRFSTKAFNPSETQAITEASSNQRLTNIKSQAADSLRELSQTCATCSMT
EIKSSREFSDQVLHSKQSHFTETFWMNSAILASWTALMGAQTITSGHSFSSATEITPSVAFTEVPSLFPSKKSAKRTILSSSLEESITLS
SNLDVNLCLDKTCLSIVPSQTISSDLMNSDLTSKMTTDELSVSENILKLLKIRQTGITMGPTEVLNQESLLDMEKSKGSHTLFKLHPSDS
SLDFELNLQITPDVTLKTTSEITHANDFKNNLPPLTGSVPDFSEVTTNVAFTTVSATPALSIQTSSSMSVIRPDWPTFTDTMTSLKKEVK
TSSEWSKWELQPSVQTQEFPTASRHLPFTRSLTLSSLESILAPQRLMISDFSCVRTTGDSTLEFQNVALNPQNNISLEFQTFSSTGLLLT
VKQDSNLVDGFFIQLFIENGTLKYHFYCPGEAKFKSINTTVRVDNGQKTTLLIRQELDPCNAELTILGRNTQICESINHVLGKPLPKSGS
VFIGGFPDLHGKIQMPVPVKNFTGCIEVIEINNWRSFIPSKAVKNTHINNCRSQGFMLSPTASFVDASDVTQGVDTMWTSVSPSVAAPSV
CQQDVCHNGGTCHAIFLSSGIVSFQCDCPLHFTGRFCEKDAGLFFPSFNGNSTLELPFLKFVLEKEHNRTVTIYLTIKTNSLNGTILYSN
GNNCGKQFLHLFLVEGRPSVKTGCGNSQNILTVSANYSINTNAFTPITIRYTTPVGSPGVVCMIEMTADGKPPVQKKDTEISHASQATFE
SMFLGHIPANVQIHKKAGPVTGFRGCILDLQVNNKEFFIIDEARHGKNIENCHVPWCAHHLCRNNGTCISDNENLFCECPRLTSGKLCQF
ASCENNPCGNGATCVPKSGTDIVCLCPTGRSGPLCTDAINITQPRFSGTDAFGYTSFLATSRISDISFHTEFHLKFQLANNHSALQNNLI
FFTGQKGHGLNGDDFLAVGLLNGSVVTSTNLGSGIASIRSEPLNLSLGVHTVHLGKFFQEGWLKVDDHKNKSIIAPGRLVGLNVFSQFTV
GGYSEYTPDLLPNGADFKNGFQGCIFTLQVRTEKDGHFRGLGNPEGHPNAGRSVGQCHASPCSLMKCGNGGTCIESGTSVYCNCTTGWKG
SFCTETVSTCDPEHDPPHHCSRGATCISLPHGYTCFCPLGTTGIYCEQALSISDPSFRSNELSWMSFASFHVRKKTHIQLQFQPLAADGI
LFTAAQHLKAQSGDFLCISLVNSSVQLRYNLGDRTIILETLQKVTINGSTWHIIKAGRVGAEGYLDLDGINVTEKASTKMSSLDTNTDFT
IGGVSSLNLVNPMAIENEPVGFQGCIRQVIINNQELQLTEFGAKGGSNVGDCDGTACGYNTCRNGGECTVNGTTFSCRCLPDWAGNTCNQ
SVSCLNNLCLHQSLCIPDQSFSYSCLCTLGWVGRTCENKTSFSTAKFMGNSYIKYIDPNTRMRNLQFTTISLNFSTTKTEGLIVWMGIAQ
NEENDFLAIGLHNQTLKIAVNLGERISVPMSTNNGTFCCNKWHHVVVIQNQTLIKAYINNSLILSEDIDPHKNFVALNTDGICTLGGFET

>In-frame_LMBRD1_ENST00000370577_chr6_70490386_-_EYS_ENST00000370621_chr6_65767620_-_2594aa
MATSGAASAELVIGWCIFGLLLLAILAFCWITVRKYQSRRESEVVSTITAIFSLAIALITSALLPVDIFLVSYMKNQNGTFKDWANANVS
RQIEDTVLYGYTSTQCEIDIDECASHPCKNGATCIDQPGNYFCQCVPPFKVVDGFSCLCNPGTVGIRCEQDIDDCILNACEHNSTCKDLH
LSYQCVCLSDWEGNFCEQESNECKMNPCKNNSTCTDLYKSTRCECTSGWTGQNCSEEINECDSDPCMNGGLCHESTIPGQFVCLCPPLTT
GQFCHQRTNLCDLLHNPCRNNSTCLALVDANQHCICREEFEGKNCEIDVKDCLFLSCQDTGDCEDMVNNFRCICRPGFSGSLCEIEINEC
SSEPCKNNGTCVDLTNRFFCNCEPEYHGPFCELDVNKCKISPCLDEENCVYRTDGYNCLCAPGTTGINCEINLDECLSEPCLHDGVCIDG
INHTTCDCKSGFFGTHCETNANDCLSNPCLHGRCTELINETPCSCDADGTSTQCKIKINDCTSIPCMNEGFCQKSAHGFTCICPRGYTGA
YCEKSIDNCAEPELNSVICLNGGICVDGPGHTFDCRCLPGFSGQFCEININECSSSPCLHGADCEDHINGTVCKCQPGWSGHHCENELEC
IPNSCVHELCMENEPGSTCLCTPGFMTCSIGLLCGDEIRRITCLTPIFQRTDPISTQTTTIPPSETLVSSFPSIKATRIPAIMDTYPVDQ
GPKQTGIVKHDILPTTGLATLRISTPLESYLLQELIVTRELSAKHSLLSSADVSSSRFLNFGIRDPAQIVQDKTSVSHMPIRTSAATLGF
FFPDRRARTPFIMSSLMSDFIFPTQSLLFENCQTVALSATPTTSVIRSIPGADIELNRQSLLSRGFLLIAASISATPVVSRGAQEDIEET
SADSLISRREHWRLLSPSMSPIFPAKVIISKQVTILNSSALHRFSTKAFNPSETQAITEASSNQRLTNIKSQAADSLRELSQTCATCSMT
EIKSSREFSDQVLHSKQSHFTETFWMNSAILASWTALMGAQTITSGHSFSSATEITPSVAFTEVPSLFPSKKSAKRTILSSSLEESITLS
SNLDVNLCLDKTCLSIVPSQTISSDLMNSDLTSKMTTDELSVSENILKLLKIRQTGITMGPTEVLNQESLLDMEKSKGSHTLFKLHPSDS
SLDFELNLQITPDVTLKTTSEITHANDFKNNLPPLTGSVPDFSEVTTNVAFTTVSATPALSIQTSSSMSVIRPDWPTFTDTMTSLKKEVK
TSSEWSKWELQPSVQTQEFPTASRHLPFTRSLTLSSLESILAPQRLMISDFSCVRTTGDSTLEFQNVALNPQNNISLEFQTFSSTGLLLT
VKQDSNLVDGFFIQLFIENGTLKYHFYCPGEAKFKSINTTVRVDNGQKTTLLIRQELDPCNAELTILGRNTQICESINHVLGKPLPKSGS
VFIGGFPDLHGKIQMPVPVKNFTGCIEVIEINNWRSFIPSKAVKNTHINNCRSQGFMLSPTASFVDASDVTQGVDTMWTSVSPSVAAPSV
CQQDVCHNGGTCHAIFLSSGIVSFQCDCPLHFTGRFCEKDAGLFFPSFNGNSTLELPFLKFVLEKEHNRTVTIYLTIKTNSLNGTILYSN
GNNCGKQFLHLFLVEGRPSVKTGCGNSQNILTVSANYSINTNAFTPITIRYTTPVGSPGVVCMIEMTADGKPPVQKKDTEISHASQATFE
SMFLGHIPANVQIHKKAGPVTGFRGCILDLQVNNKEFFIIDEARHGKNIENCHVPWCAHHLCRNNGTCISDNENLFCECPRLTSGKLCQF
ASCENNPCGNGATCVPKSGTDIVCLCPTGRSGPLCTDAINITQPRFSGTDAFGYTSFLATSRISDISFHTEFHLKFQLANNHSALQNNLI
FFTGQKGHGLNGDDFLAVGLLNGSVVTSTNLGSGIASIRSEPLNLSLGVHTVHLGKFFQEGWLKVDDHKNKSIIAPGRLVGLNVFSQFTV
GGYSEYTPDLLPNGADFKNGFQGCIFTLQVRTEKDGHFRGLGNPEGHPNAGRSVGQCHASPCSLMKCGNGGTCIESGTSVYCNCTTGWKG
SFCTETVSTCDPEHDPPHHCSRGATCISLPHGYTCFCPLGTTGIYCEQALILIVILEKPKPAERKVKKEALSISDPSFRSNELSWMSFAS
FHVRKKTHIQLQFQPLAADGILFTAAQHLKAQSGDFLCISLVNSSVQLRYNLGDRTIILETLQKVTINGSTWHIIKAGRVGAEGYLDLDG
INVTEKASTKMSSLDTNTDFTIGGVSSLNLVNPMAIENEPVGFQGCIRQVIINNQELQLTEFGAKGGSNVGDCDGTACGYNTCRNGGECT
VNGTTFSCRCLPDWAGNTCNQSVSCLNNLCLHQSLCIPDQSFSYSCLCTLGWVGRTCENKTSFSTAKFMGNSYIKYIDPNTRMRNLQFTT
ISLNFSTTKTEGLIVWMGIAQNEENDFLAIGLHNQTLKIAVNLGERISVPMSTNNGTFCCNKWHHVVVIQNQTLIKAYINNSLILSEDID

>In-frame_LMBRD1_ENST00000370577_chr6_70490386_-_EYS_ENST00000370616_chr6_65767620_-_2594aa
MATSGAASAELVIGWCIFGLLLLAILAFCWITVRKYQSRRESEVVSTITAIFSLAIALITSALLPVDIFLVSYMKNQNGTFKDWANANVS
RQIEDTVLYGYTSTQCEIDIDECASHPCKNGATCIDQPGNYFCQCVPPFKVVDGFSCLCNPGTVGIRCEQDIDDCILNACEHNSTCKDLH
LSYQCVCLSDWEGNFCEQESNECKMNPCKNNSTCTDLYKSTRCECTSGWTGQNCSEEINECDSDPCMNGGLCHESTIPGQFVCLCPPLTT
GQFCHQRTNLCDLLHNPCRNNSTCLALVDANQHCICREEFEGKNCEIDVKDCLFLSCQDTGDCEDMVNNFRCICRPGFSGSLCEIEINEC
SSEPCKNNGTCVDLTNRFFCNCEPEYHGPFCELDVNKCKISPCLDEENCVYRTDGYNCLCAPGTTGINCEINLDECLSEPCLHDGVCIDG
INHTTCDCKSGFFGTHCETNANDCLSNPCLHGRCTELINETPCSCDADGTSTQCKIKINDCTSIPCMNEGFCQKSAHGFTCICPRGYTGA
YCEKSIDNCAEPELNSVICLNGGICVDGPGHTFDCRCLPGFSGQFCEININECSSSPCLHGADCEDHINGTVCKCQPGWSGHHCENELEC
IPNSCVHELCMENEPGSTCLCTPGFMTCSIGLLCGDEIRRITCLTPIFQRTDPISTQTTTIPPSETLVSSFPSIKATRIPAIMDTYPVDQ
GPKQTGIVKHDILPTTGLATLRISTPLESYLLQELIVTRELSAKHSLLSSADVSSSRFLNFGIRDPAQIVQDKTSVSHMPIRTSAATLGF
FFPDRRARTPFIMSSLMSDFIFPTQSLLFENCQTVALSATPTTSVIRSIPGADIELNRQSLLSRGFLLIAASISATPVVSRGAQEDIEET
SADSLISRREHWRLLSPSMSPIFPAKVIISKQVTILNSSALHRFSTKAFNPSETQAITEASSNQRLTNIKSQAADSLRELSQTCATCSMT
EIKSSREFSDQVLHSKQSHFTETFWMNSAILASWTALMGAQTITSGHSFSSATEITPSVAFTEVPSLFPSKKSAKRTILSSSLEESITLS
SNLDVNLCLDKTCLSIVPSQTISSDLMNSDLTSKMTTDELSVSENILKLLKIRQTGITMGPTEVLNQESLLDMEKSKGSHTLFKLHPSDS
SLDFELNLQITPDVTLKTTSEITHANDFKNNLPPLTGSVPDFSEVTTNVAFTTVSATPALSIQTSSSMSVIRPDWPTFTDTMTSLKKEVK
TSSEWSKWELQPSVQTQEFPTASRHLPFTRSLTLSSLESILAPQRLMISDFSCVRTTGDSTLEFQNVALNPQNNISLEFQTFSSTGLLLT
VKQDSNLVDGFFIQLFIENGTLKYHFYCPGEAKFKSINTTVRVDNGQKTTLLIRQELDPCNAELTILGRNTQICESINHVLGKPLPKSGS
VFIGGFPDLHGKIQMPVPVKNFTGCIEVIEINNWRSFIPSKAVKNTHINNCRSQGFMLSPTASFVDASDVTQGVDTMWTSVSPSVAAPSV
CQQDVCHNGGTCHAIFLSSGIVSFQCDCPLHFTGRFCEKDAGLFFPSFNGNSTLELPFLKFVLEKEHNRTVTIYLTIKTNSLNGTILYSN
GNNCGKQFLHLFLVEGRPSVKTGCGNSQNILTVSANYSINTNAFTPITIRYTTPVGSPGVVCMIEMTADGKPPVQKKDTEISHASQATFE
SMFLGHIPANVQIHKKAGPVTGFRGCILDLQVNNKEFFIIDEARHGKNIENCHVPWCAHHLCRNNGTCISDNENLFCECPRLTSGKLCQF
ASCENNPCGNGATCVPKSGTDIVCLCPTGRSGPLCTDAINITQPRFSGTDAFGYTSFLATSRISDISFHTEFHLKFQLANNHSALQNNLI
FFTGQKGHGLNGDDFLAVGLLNGSVVTSTNLGSGIASIRSEPLNLSLGVHTVHLGKFFQEGWLKVDDHKNKSIIAPGRLVGLNVFSQFTV
GGYSEYTPDLLPNGADFKNGFQGCIFTLQVRTEKDGHFRGLGNPEGHPNAGRSVGQCHASPCSLMKCGNGGTCIESGTSVYCNCTTGWKG
SFCTETVSTCDPEHDPPHHCSRGATCISLPHGYTCFCPLGTTGIYCEQALILIVILEKPKPAERKVKKEALSISDPSFRSNELSWMSFAS
FHVRKKTHIQLQFQPLAADGILFTAAQHLKAQSGDFLCISLVNSSVQLRYNLGDRTIILETLQKVTINGSTWHIIKAGRVGAEGYLDLDG
INVTEKASTKMSSLDTNTDFTIGGVSSLNLVNPMAIENEPVGFQGCIRQVIINNQELQLTEFGAKGGSNVGDCDGTACGYNTCRNGGECT
VNGTTFSCRCLPDWAGNTCNQSVSCLNNLCLHQSLCIPDQSFSYSCLCTLGWVGRTCENKTSFSTAKFMGNSYIKYIDPNTRMRNLQFTT
ISLNFSTTKTEGLIVWMGIAQNEENDFLAIGLHNQTLKIAVNLGERISVPMSTNNGTFCCNKWHHVVVIQNQTLIKAYINNSLILSEDID

>In-frame_LMBRD1_ENST00000370570_chr6_70490386_-_EYS_ENST00000503581_chr6_65767620_-_2500aa
MKNQNGTFKDWANANVSRQIEDTVLYGYTSTQCEIDIDECASHPCKNGATCIDQPGNYFCQCVPPFKVVDGFSCLCNPGTVGIRCEQDID
DCILNACEHNSTCKDLHLSYQCVCLSDWEGNFCEQESNECKMNPCKNNSTCTDLYKSTRCECTSGWTGQNCSEEINECDSDPCMNGGLCH
ESTIPGQFVCLCPPLTTGQFCHQRTNLCDLLHNPCRNNSTCLALVDANQHCICREEFEGKNCEIDVKDCLFLSCQDTGDCEDMVNNFRCI
CRPGFSGSLCEIEINECSSEPCKNNGTCVDLTNRFFCNCEPEYHGPFCELDVNKCKISPCLDEENCVYRTDGYNCLCAPGTTGINCEINL
DECLSEPCLHDGVCIDGINHTTCDCKSGFFGTHCETNANDCLSNPCLHGRCTELINETPCSCDADGTSTQCKIKINDCTSIPCMNEGFCQ
KSAHGFTCICPRGYTGAYCEKSIDNCAEPELNSVICLNGGICVDGPGHTFDCRCLPGFSGQFCEININECSSSPCLHGADCEDHINGTVC
KCQPGWSGHHCENELECIPNSCVHELCMENEPGSTCLCTPGFMTCSIGLLCGDEIRRITCLTPIFQRTDPISTQTTTIPPSETLVSSFPS
IKATRIPAIMDTYPVDQGPKQTGIVKHDILPTTGLATLRISTPLESYLLQELIVTRELSAKHSLLSSADVSSSRFLNFGIRDPAQIVQDK
TSVSHMPIRTSAATLGFFFPDRRARTPFIMSSLMSDFIFPTQSLLFENCQTVALSATPTTSVIRSIPGADIELNRQSLLSRGFLLIAASI
SATPVVSRGAQEDIEETSADSLISRREHWRLLSPSMSPIFPAKVIISKQVTILNSSALHRFSTKAFNPSETQAITEASSNQRLTNIKSQA
ADSLRELSQTCATCSMTEIKSSREFSDQVLHSKQSHFTETFWMNSAILASWTALMGAQTITSGHSFSSATEITPSVAFTEVPSLFPSKKS
AKRTILSSSLEESITLSSNLDVNLCLDKTCLSIVPSQTISSDLMNSDLTSKMTTDELSVSENILKLLKIRQTGITMGPTEVLNQESLLDM
EKSKGSHTLFKLHPSDSSLDFELNLQITPDVTLKTTSEITHANDFKNNLPPLTGSVPDFSEVTTNVAFTTVSATPALSIQTSSSMSVIRP
DWPTFTDTMTSLKKEVKTSSEWSKWELQPSVQTQEFPTASRHLPFTRSLTLSSLESILAPQRLMISDFSCVRTTGDSTLEFQNVALNPQN
NISLEFQTFSSTGLLLTVKQDSNLVDGFFIQLFIENGTLKYHFYCPGEAKFKSINTTVRVDNGQKTTLLIRQELDPCNAELTILGRNTQI
CESINHVLGKPLPKSGSVFIGGFPDLHGKIQMPVPVKNFTGCIEVIEINNWRSFIPSKAVKNTHINNCRSQGFMLSPTASFVDASDVTQG
VDTMWTSVSPSVAAPSVCQQDVCHNGGTCHAIFLSSGIVSFQCDCPLHFTGRFCEKDAGLFFPSFNGNSTLELPFLKFVLEKEHNRTVTI
YLTIKTNSLNGTILYSNGNNCGKQFLHLFLVEGRPSVKTGCGNSQNILTVSANYSINTNAFTPITIRYTTPVGSPGVVCMIEMTADGKPP
VQKKDTEISHASQATFESMFLGHIPANVQIHKKAGPVTGFRGCILDLQVNNKEFFIIDEARHGKNIENCHVPWCAHHLCRNNGTCISDNE
NLFCECPRLTSGKLCQFASCENNPCGNGATCVPKSGTDIVCLCPTGRSGPLCTDAINITQPRFSGTDAFGYTSFLATSRISDISFHTEFH
LKFQLANNHSALQNNLIFFTGQKGHGLNGDDFLAVGLLNGSVVTSTNLGSGIASIRSEPLNLSLGVHTVHLGKFFQEGWLKVDDHKNKSI
IAPGRLVGLNVFSQFTVGGYSEYTPDLLPNGADFKNGFQGCIFTLQVRTEKDGHFRGLGNPEGHPNAGRSVGQCHASPCSLMKCGNGGTC
IESGTSVYCNCTTGWKGSFCTETVSTCDPEHDPPHHCSRGATCISLPHGYTCFCPLGTTGIYCEQALSISDPSFRSNELSWMSFASFHVR
KKTHIQLQFQPLAADGILFTAAQHLKAQSGDFLCISLVNSSVQLRYNLGDRTIILETLQKVTINGSTWHIIKAGRVGAEGYLDLDGINVT
EKASTKMSSLDTNTDFTIGGVSSLNLVNPMAIENEPVGFQGCIRQVIINNQELQLTEFGAKGGSNVGDCDGTACGYNTCRNGGECTVNGT
TFSCRCLPDWAGNTCNQSVSCLNNLCLHQSLCIPDQSFSYSCLCTLGWVGRTCENKTSFSTAKFMGNSYIKYIDPNTRMRNLQFTTISLN
FSTTKTEGLIVWMGIAQNEENDFLAIGLHNQTLKIAVNLGERISVPMSTNNGTFCCNKWHHVVVIQNQTLIKAYINNSLILSEDIDPHKN

>In-frame_LMBRD1_ENST00000370570_chr6_70490386_-_EYS_ENST00000370621_chr6_65767620_-_2521aa
MKNQNGTFKDWANANVSRQIEDTVLYGYTSTQCEIDIDECASHPCKNGATCIDQPGNYFCQCVPPFKVVDGFSCLCNPGTVGIRCEQDID
DCILNACEHNSTCKDLHLSYQCVCLSDWEGNFCEQESNECKMNPCKNNSTCTDLYKSTRCECTSGWTGQNCSEEINECDSDPCMNGGLCH
ESTIPGQFVCLCPPLTTGQFCHQRTNLCDLLHNPCRNNSTCLALVDANQHCICREEFEGKNCEIDVKDCLFLSCQDTGDCEDMVNNFRCI
CRPGFSGSLCEIEINECSSEPCKNNGTCVDLTNRFFCNCEPEYHGPFCELDVNKCKISPCLDEENCVYRTDGYNCLCAPGTTGINCEINL
DECLSEPCLHDGVCIDGINHTTCDCKSGFFGTHCETNANDCLSNPCLHGRCTELINETPCSCDADGTSTQCKIKINDCTSIPCMNEGFCQ
KSAHGFTCICPRGYTGAYCEKSIDNCAEPELNSVICLNGGICVDGPGHTFDCRCLPGFSGQFCEININECSSSPCLHGADCEDHINGTVC
KCQPGWSGHHCENELECIPNSCVHELCMENEPGSTCLCTPGFMTCSIGLLCGDEIRRITCLTPIFQRTDPISTQTTTIPPSETLVSSFPS
IKATRIPAIMDTYPVDQGPKQTGIVKHDILPTTGLATLRISTPLESYLLQELIVTRELSAKHSLLSSADVSSSRFLNFGIRDPAQIVQDK
TSVSHMPIRTSAATLGFFFPDRRARTPFIMSSLMSDFIFPTQSLLFENCQTVALSATPTTSVIRSIPGADIELNRQSLLSRGFLLIAASI
SATPVVSRGAQEDIEETSADSLISRREHWRLLSPSMSPIFPAKVIISKQVTILNSSALHRFSTKAFNPSETQAITEASSNQRLTNIKSQA
ADSLRELSQTCATCSMTEIKSSREFSDQVLHSKQSHFTETFWMNSAILASWTALMGAQTITSGHSFSSATEITPSVAFTEVPSLFPSKKS
AKRTILSSSLEESITLSSNLDVNLCLDKTCLSIVPSQTISSDLMNSDLTSKMTTDELSVSENILKLLKIRQTGITMGPTEVLNQESLLDM
EKSKGSHTLFKLHPSDSSLDFELNLQITPDVTLKTTSEITHANDFKNNLPPLTGSVPDFSEVTTNVAFTTVSATPALSIQTSSSMSVIRP
DWPTFTDTMTSLKKEVKTSSEWSKWELQPSVQTQEFPTASRHLPFTRSLTLSSLESILAPQRLMISDFSCVRTTGDSTLEFQNVALNPQN
NISLEFQTFSSTGLLLTVKQDSNLVDGFFIQLFIENGTLKYHFYCPGEAKFKSINTTVRVDNGQKTTLLIRQELDPCNAELTILGRNTQI
CESINHVLGKPLPKSGSVFIGGFPDLHGKIQMPVPVKNFTGCIEVIEINNWRSFIPSKAVKNTHINNCRSQGFMLSPTASFVDASDVTQG
VDTMWTSVSPSVAAPSVCQQDVCHNGGTCHAIFLSSGIVSFQCDCPLHFTGRFCEKDAGLFFPSFNGNSTLELPFLKFVLEKEHNRTVTI
YLTIKTNSLNGTILYSNGNNCGKQFLHLFLVEGRPSVKTGCGNSQNILTVSANYSINTNAFTPITIRYTTPVGSPGVVCMIEMTADGKPP
VQKKDTEISHASQATFESMFLGHIPANVQIHKKAGPVTGFRGCILDLQVNNKEFFIIDEARHGKNIENCHVPWCAHHLCRNNGTCISDNE
NLFCECPRLTSGKLCQFASCENNPCGNGATCVPKSGTDIVCLCPTGRSGPLCTDAINITQPRFSGTDAFGYTSFLATSRISDISFHTEFH
LKFQLANNHSALQNNLIFFTGQKGHGLNGDDFLAVGLLNGSVVTSTNLGSGIASIRSEPLNLSLGVHTVHLGKFFQEGWLKVDDHKNKSI
IAPGRLVGLNVFSQFTVGGYSEYTPDLLPNGADFKNGFQGCIFTLQVRTEKDGHFRGLGNPEGHPNAGRSVGQCHASPCSLMKCGNGGTC
IESGTSVYCNCTTGWKGSFCTETVSTCDPEHDPPHHCSRGATCISLPHGYTCFCPLGTTGIYCEQALILIVILEKPKPAERKVKKEALSI
SDPSFRSNELSWMSFASFHVRKKTHIQLQFQPLAADGILFTAAQHLKAQSGDFLCISLVNSSVQLRYNLGDRTIILETLQKVTINGSTWH
IIKAGRVGAEGYLDLDGINVTEKASTKMSSLDTNTDFTIGGVSSLNLVNPMAIENEPVGFQGCIRQVIINNQELQLTEFGAKGGSNVGDC
DGTACGYNTCRNGGECTVNGTTFSCRCLPDWAGNTCNQSVSCLNNLCLHQSLCIPDQSFSYSCLCTLGWVGRTCENKTSFSTAKFMGNSY
IKYIDPNTRMRNLQFTTISLNFSTTKTEGLIVWMGIAQNEENDFLAIGLHNQTLKIAVNLGERISVPMSTNNGTFCCNKWHHVVVIQNQT
LIKAYINNSLILSEDIDPHKNFVALNTDGICTLGGFETGRKVNIVTQEIFKTNFVGKIKDVVFFQEPKNIELIKLEGYNVTDGDEQNEVT

>In-frame_LMBRD1_ENST00000370570_chr6_70490386_-_EYS_ENST00000370616_chr6_65767620_-_2521aa
MKNQNGTFKDWANANVSRQIEDTVLYGYTSTQCEIDIDECASHPCKNGATCIDQPGNYFCQCVPPFKVVDGFSCLCNPGTVGIRCEQDID
DCILNACEHNSTCKDLHLSYQCVCLSDWEGNFCEQESNECKMNPCKNNSTCTDLYKSTRCECTSGWTGQNCSEEINECDSDPCMNGGLCH
ESTIPGQFVCLCPPLTTGQFCHQRTNLCDLLHNPCRNNSTCLALVDANQHCICREEFEGKNCEIDVKDCLFLSCQDTGDCEDMVNNFRCI
CRPGFSGSLCEIEINECSSEPCKNNGTCVDLTNRFFCNCEPEYHGPFCELDVNKCKISPCLDEENCVYRTDGYNCLCAPGTTGINCEINL
DECLSEPCLHDGVCIDGINHTTCDCKSGFFGTHCETNANDCLSNPCLHGRCTELINETPCSCDADGTSTQCKIKINDCTSIPCMNEGFCQ
KSAHGFTCICPRGYTGAYCEKSIDNCAEPELNSVICLNGGICVDGPGHTFDCRCLPGFSGQFCEININECSSSPCLHGADCEDHINGTVC
KCQPGWSGHHCENELECIPNSCVHELCMENEPGSTCLCTPGFMTCSIGLLCGDEIRRITCLTPIFQRTDPISTQTTTIPPSETLVSSFPS
IKATRIPAIMDTYPVDQGPKQTGIVKHDILPTTGLATLRISTPLESYLLQELIVTRELSAKHSLLSSADVSSSRFLNFGIRDPAQIVQDK
TSVSHMPIRTSAATLGFFFPDRRARTPFIMSSLMSDFIFPTQSLLFENCQTVALSATPTTSVIRSIPGADIELNRQSLLSRGFLLIAASI
SATPVVSRGAQEDIEETSADSLISRREHWRLLSPSMSPIFPAKVIISKQVTILNSSALHRFSTKAFNPSETQAITEASSNQRLTNIKSQA
ADSLRELSQTCATCSMTEIKSSREFSDQVLHSKQSHFTETFWMNSAILASWTALMGAQTITSGHSFSSATEITPSVAFTEVPSLFPSKKS
AKRTILSSSLEESITLSSNLDVNLCLDKTCLSIVPSQTISSDLMNSDLTSKMTTDELSVSENILKLLKIRQTGITMGPTEVLNQESLLDM
EKSKGSHTLFKLHPSDSSLDFELNLQITPDVTLKTTSEITHANDFKNNLPPLTGSVPDFSEVTTNVAFTTVSATPALSIQTSSSMSVIRP
DWPTFTDTMTSLKKEVKTSSEWSKWELQPSVQTQEFPTASRHLPFTRSLTLSSLESILAPQRLMISDFSCVRTTGDSTLEFQNVALNPQN
NISLEFQTFSSTGLLLTVKQDSNLVDGFFIQLFIENGTLKYHFYCPGEAKFKSINTTVRVDNGQKTTLLIRQELDPCNAELTILGRNTQI
CESINHVLGKPLPKSGSVFIGGFPDLHGKIQMPVPVKNFTGCIEVIEINNWRSFIPSKAVKNTHINNCRSQGFMLSPTASFVDASDVTQG
VDTMWTSVSPSVAAPSVCQQDVCHNGGTCHAIFLSSGIVSFQCDCPLHFTGRFCEKDAGLFFPSFNGNSTLELPFLKFVLEKEHNRTVTI
YLTIKTNSLNGTILYSNGNNCGKQFLHLFLVEGRPSVKTGCGNSQNILTVSANYSINTNAFTPITIRYTTPVGSPGVVCMIEMTADGKPP
VQKKDTEISHASQATFESMFLGHIPANVQIHKKAGPVTGFRGCILDLQVNNKEFFIIDEARHGKNIENCHVPWCAHHLCRNNGTCISDNE
NLFCECPRLTSGKLCQFASCENNPCGNGATCVPKSGTDIVCLCPTGRSGPLCTDAINITQPRFSGTDAFGYTSFLATSRISDISFHTEFH
LKFQLANNHSALQNNLIFFTGQKGHGLNGDDFLAVGLLNGSVVTSTNLGSGIASIRSEPLNLSLGVHTVHLGKFFQEGWLKVDDHKNKSI
IAPGRLVGLNVFSQFTVGGYSEYTPDLLPNGADFKNGFQGCIFTLQVRTEKDGHFRGLGNPEGHPNAGRSVGQCHASPCSLMKCGNGGTC
IESGTSVYCNCTTGWKGSFCTETVSTCDPEHDPPHHCSRGATCISLPHGYTCFCPLGTTGIYCEQALILIVILEKPKPAERKVKKEALSI
SDPSFRSNELSWMSFASFHVRKKTHIQLQFQPLAADGILFTAAQHLKAQSGDFLCISLVNSSVQLRYNLGDRTIILETLQKVTINGSTWH
IIKAGRVGAEGYLDLDGINVTEKASTKMSSLDTNTDFTIGGVSSLNLVNPMAIENEPVGFQGCIRQVIINNQELQLTEFGAKGGSNVGDC
DGTACGYNTCRNGGECTVNGTTFSCRCLPDWAGNTCNQSVSCLNNLCLHQSLCIPDQSFSYSCLCTLGWVGRTCENKTSFSTAKFMGNSY
IKYIDPNTRMRNLQFTTISLNFSTTKTEGLIVWMGIAQNEENDFLAIGLHNQTLKIAVNLGERISVPMSTNNGTFCCNKWHHVVVIQNQT
LIKAYINNSLILSEDIDPHKNFVALNTDGICTLGGFETGRKVNIVTQEIFKTNFVGKIKDVVFFQEPKNIELIKLEGYNVTDGDEQNEVT


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_LMBRD1_ENST00000370577_chr6_70490386_-_EYS_ENST00000503581_chr6_65767620_-_7719nt
ATGGCGACTTCTGGCGCGGCCTCGGCGGAGCTGGTGATCGGCTGGTGCATATTCGGCCTCTTACTACTGGCTATTTTGGCATTCTGCTGG
ATATATGTTCGTAAATACCAAAGTCGGCGGGAAAGTGAAGTTGTCTCCACCATAACAGCAATTTTTTCTCTAGCAATTGCACTTATCACA
TCAGCACTTCTACCAGTGGATATATTTTTGGTTTCTTACATGAAAAATCAAAATGGTACATTTAAGGACTGGGCTAATGCTAATGTCAGC
AGACAGATTGAGGACACTGTATTATACGGTTACTATAGTACGCAATGTGAAATTGATATAGATGAGTGTGCTTCACATCCCTGCAAAAAT
GGAGCCACCTGCATTGACCAACCTGGTAATTACTTCTGCCAGTGTGTGCCTCCATTTAAAGTGGTTGATGGCTTTTCCTGCTTATGCAAT
CCAGGCTATGTTGGGATAAGATGTGAACAGGACATTGATGACTGCATCCTGAATGCCTGTGAGCACAATTCTACCTGCAAAGACCTGCAT
CTCAGCTACCAGTGTGTGTGCCTATCTGATTGGGAAGGAAATTTTTGTGAACAAGAATCCAATGAGTGTAAAATGAATCCTTGCAAGAAC
AATTCCACCTGTACTGACCTTTACAAAAGCTATCGATGTGAGTGTACATCTGGATGGACTGGACAGAACTGTAGTGAAGAAATAAATGAA
TGCGACTCTGATCCATGCATGAATGGAGGTCTTTGTCATGAATCTACCATCCCTGGACAATTTGTATGTCTGTGCCCACCCCTTTATACT
GGACAATTTTGCCACCAACGCTATAACCTTTGTGACCTACTTCATAACCCTTGCAGAAACAACTCAACATGCTTAGCTTTGGTAGACGCA
AATCAGCATTGTATTTGTAGAGAAGAATTTGAAGGTAAAAACTGTGAAATTGATGTGAAAGACTGCCTCTTCCTTTCCTGCCAGGATTAT
GGTGACTGTGAAGATATGGTCAACAATTTCAGGTGTATTTGCAGACCTGGGTTTTCTGGATCTCTGTGTGAAATTGAAATTAATGAATGT
TCCTCTGAACCTTGCAAAAATAATGGAACATGTGTGGATCTGACAAACAGATTTTTTTGTAATTGTGAACCTGAGTACCATGGGCCCTTC
TGTGAACTTGATGTAAATAAATGTAAAATCTCACCTTGTCTAGATGAAGAAAATTGTGTCTACAGGACTGATGGATACAACTGCCTCTGT
GCCCCTGGTTATACAGGCATCAACTGTGAAATAAATCTAGATGAATGCCTATCAGAGCCCTGTCTCCATGATGGAGTTTGTATCGATGGC
ATCAATCATTATACCTGTGACTGCAAGAGTGGGTTTTTTGGAACACACTGTGAAACAAACGCCAATGATTGCCTTTCAAATCCTTGTCTA
CATGGAAGGTGCACAGAACTTATTAATGAATATCCATGTTCATGTGATGCAGATGGGACTAGCACACAATGTAAGATCAAAATTAATGAC
TGCACATCAATCCCTTGTATGAATGAAGGCTTCTGTCAGAAGTCAGCACATGGATTTACTTGCATTTGCCCACGTGGATACACTGGTGCA
TACTGTGAAAAAAGCATTGATAATTGTGCTGAGCCTGAACTTAATTCAGTCATCTGTCTTAATGGAGGGATCTGTGTTGATGGGCCTGGA
CATACTTTTGACTGCAGATGTCTTCCTGGATTTTCTGGTCAATTTTGTGAAATTAATATAAATGAATGCTCTTCATCACCATGTCTACAT
GGTGCAGACTGTGAAGATCACATCAATGGATATGTTTGCAAATGCCAACCAGGATGGTCTGGACACCACTGTGAGAATGAGCTTGAGTGC
ATTCCCAACTCATGTGTTCATGAACTCTGCATGGAGAATGAACCTGGCTCGACATGTTTATGCACACCTGGATTTATGACCTGCTCCATT
GGGCTTCTTTGTGGTGATGAAATAAGGAGAATTACCTGTTTAACTCCCATCTTTCAAAGAACAGATCCCATTTCCACACAGACATATACA
ATTCCCCCTTCTGAGACTTTGGTCAGCAGCTTTCCATCTATAAAGGCTACTAGAATACCAGCCATAATGGACACTTACCCAGTTGATCAA
GGTCCAAAACAGACAGGCATTGTCAAGCACGACATTCTCCCAACCACTGGTTTGGCAACATTAAGAATTAGCACACCCTTGGAAAGCTAC
TTACTCCAAGAACTGATTGTCACTAGAGAGCTTTCAGCAAAACACAGTCTTCTTTCTTCCGCAGATGTTTCCTCTTCTCGATTCCTGAAT
TTTGGTATTCGTGACCCAGCACAAATTGTCCAGGACAAAACATCGGTATCACATATGCCTATTCGAACTTCAGCAGCCACACTAGGTTTC
TTTTTTCCTGATAGGAGAGCAAGGACCCCATTTATCATGTCTTCCTTAATGTCAGATTTTATTTTTCCTACACAATCTTTATTATTTGAG
AACTGTCAGACTGTTGCTTTATCTGCTACCCCAACGACTTCAGTAATTAGAAGCATTCCAGGGGCTGATATTGAGCTAAACAGGCAGTCA
TTACTCTCCCGTGGATTCCTGCTTATAGCTGCCTCCATAAGTGCAACTCCAGTTGTCTCTAGGGGGGCTCAAGAGGATATTGAAGAATAT
TCAGCTGATTCTTTAATTTCAAGAAGAGAGCACTGGAGATTGCTCAGCCCCTCGATGTCTCCCATTTTTCCTGCTAAGGTAATTATATCT
AAACAGGTAACCATCTTAAACTCATCAGCTCTGCACCGGTTCAGTACAAAAGCCTTCAATCCCAGTGAATATCAGGCTATTACTGAGGCT
TCAAGCAACCAGAGACTCACAAACATCAAATCACAGGCTGCTGATTCTTTAAGAGAATTAAGCCAAACATGTGCAACATGTTCTATGACT
GAAATAAAATCCTCTCGTGAATTCTCAGATCAAGTTTTGCATAGCAAACAGTCCCACTTTTATGAGACATTCTGGATGAACTCAGCGATA
TTAGCCAGCTGGTATGCACTAATGGGAGCTCAAACTATCACTTCTGGGCATTCATTTTCTTCTGCTACTGAAATAACACCATCAGTGGCA
TTCACAGAAGTGCCATCTTTATTTCCTTCTAAAAAGAGTGCAAAAAGAACAATTTTATCCTCATCCTTGGAAGAATCCATTACCCTATCA
AGTAATTTGGATGTTAATTTATGTTTGGATAAGACTTGTTTATCCATTGTCCCTTCACAAACTATCTCTTCAGACTTGATGAATTCTGAT
TTGACTTCAAAAATGACTACTGATGAACTGTCAGTATCAGAAAACATTTTAAAACTATTGAAAATAAGACAATATGGCATAACTATGGGA
CCCACTGAGGTACTAAATCAAGAGAGCTTATTGGACATGGAAAAAAGTAAAGGATCTCATACACTGTTCAAACTTCACCCAAGTGATAGT
TCTCTGGATTTTGAGTTAAACTTACAAATTTATCCGGATGTTACTTTAAAGACATATTCAGAAATTACACATGCAAATGACTTCAAAAAT
AATCTGCCACCATTGACAGGCTCAGTGCCTGATTTTTCAGAAGTCACCACCAATGTTGCATTTTATACAGTTTCAGCAACTCCAGCACTT
TCAATACAGACGTCTTCCTCCATGTCTGTAATTAGGCCAGATTGGCCATATTTTACAGATTATATGACCTCTCTTAAAAAAGAGGTCAAG
ACTTCTTCAGAATGGTCCAAATGGGAACTTCAGCCTAGTGTGCAATATCAGGAATTTCCCACTGCAAGCCGGCATCTTCCCTTCACTAGA
TCTCTTACTTTGTCTTCACTGGAATCCATTCTGGCACCTCAACGGCTGATGATTTCTGATTTCAGTTGTGTTCGTTATTATGGAGATTCT
TATCTAGAATTTCAGAATGTGGCTTTAAATCCACAAAATAACATCTCCCTAGAATTTCAGACCTTCAGCTCCTATGGACTTCTGCTGTAT
GTCAAGCAAGACTCAAATTTAGTAGATGGATTTTTTATTCAATTGTTTATTGAAAATGGTACTTTAAAGTACCACTTTTACTGTCCTGGT
GAAGCAAAATTTAAAAGCATTAATACTACTGTTAGAGTGGACAACGGGCAAAAGTATACACTGCTTATCAGGCAAGAATTGGATCCATGT
AACGCTGAGCTGACTATTTTAGGGAGGAATACACAAATATGCGAATCTATCAATCATGTACTCGGAAAACCCCTGCCAAAATCAGGATCT
GTCTTCATTGGTGGATTTCCAGACCTTCATGGGAAAATCCAGATGCCTGTACCAGTCAAGAATTTTACTGGCTGCATAGAAGTTATAGAA
ATAAATAACTGGAGATCTTTCATTCCATCCAAGGCAGTGAAAAACTATCACATTAACAATTGCAGATCCCAGGGATTTATGCTGTCTCCA
ACAGCCTCCTTTGTTGATGCTTCTGATGTGACACAAGGGGTTGATACCATGTGGACTTCTGTCAGCCCCTCTGTTGCAGCACCCTCTGTG
TGCCAGCAGGATGTATGCCACAATGGAGGCACATGCCATGCCATCTTCCTCTCCAGTGGCATAGTGTCATTCCAATGTGACTGTCCACTA
CATTTCACTGGCCGCTTCTGTGAAAAAGATGCAGGTTTATTCTTTCCATCTTTCAATGGGAATTCCTATTTAGAACTGCCCTTTTTGAAG
TTTGTCCTGGAGAAGGAACATAACAGAACTGTTACCATCTACTTGACTATAAAAACAAACAGTTTAAATGGAACTATTCTTTACAGTAAT
GGGAATAATTGTGGAAAGCAGTTTCTTCATTTATTTCTTGTGGAAGGAAGGCCATCAGTTAAATATGGGTGTGGAAATTCTCAAAATATT
TTGACTGTTTCTGCTAATTACAGCATTAACACAAATGCATTCACCCCTATCACAATACGCTACACAACGCCTGTTGGCAGCCCTGGAGTT
GTTTGTATGATTGAAATGACTGCAGATGGAAAACCTCCAGTACAGAAGAAAGACACAGAGATTTCCCATGCCTCTCAGGCATATTTTGAA
TCAATGTTCCTTGGCCATATTCCTGCAAATGTTCAAATTCATAAGAAAGCAGGTCCTGTTTATGGGTTCAGGGGCTGCATTCTAGACCTT
CAAGTAAACAACAAAGAATTCTTCATCATCGATGAAGCACGACATGGAAAGAATATTGAGAACTGCCACGTCCCTTGGTGTGCTCATCAT
CTGTGCCGCAACAATGGCACCTGCATCAGTGATAATGAAAATCTGTTTTGTGAGTGTCCAAGGCTGTATTCAGGCAAGCTGTGCCAGTTT
GCAAGTTGTGAAAACAACCCATGTGGAAATGGTGCCACCTGTGTTCCAAAATCCGGAACAGATATTGTCTGCCTCTGCCCATATGGGAGG
TCTGGACCCCTCTGCACTGATGCTATTAATATTACTCAGCCAAGGTTCAGTGGCACAGATGCCTTTGGATACACCTCATTCCTGGCTTAT
TCACGGATCTCAGACATCAGCTTCCATTATGAATTCCACCTGAAGTTTCAGCTGGCAAACAACCACTCAGCACTGCAAAATAACTTGATA
TTTTTTACTGGACAGAAAGGCCATGGGTTGAATGGCGATGACTTCCTGGCTGTGGGCCTGCTCAATGGCAGTGTGGTTTATAGTTATAAC
CTGGGGTCTGGCATAGCAAGCATCAGGAGCGAGCCCCTCAATCTGAGCCTTGGAGTCCACACTGTTCATCTGGGCAAGTTCTTCCAAGAG
GGCTGGCTGAAGGTAGATGATCATAAAAATAAATCCATTATCGCCCCAGGAAGACTGGTTGGTCTCAATGTCTTCAGTCAGTTTTATGTA
GGTGGCTACAGTGAATACACTCCAGATCTCTTACCAAATGGAGCAGATTTTAAAAATGGTTTTCAAGGCTGTATTTTCACTCTTCAAGTT
CGCACTGAGAAGGATGGCCATTTCAGAGGACTGGGAAATCCTGAGGGCCACCCAAATGCTGGACGCAGTGTTGGCCAGTGTCATGCTTCT
CCCTGCAGTTTAATGAAATGTGGCAATGGTGGGACATGCATAGAGAGTGGAACTAGTGTTTACTGCAATTGTACCACTGGGTGGAAAGGA
TCATTCTGCACAGAGACAGTTTCTACCTGTGATCCTGAACATGACCCTCCACACCACTGTAGCAGAGGAGCAACCTGCATTTCATTACCT
CATGGATACACCTGTTTCTGTCCTCTAGGAACCACTGGAATCTACTGTGAACAAGCTTTATCCATAAGTGATCCATCTTTCAGAAGCAAT
GAGTTATCCTGGATGTCTTTTGCTTCCTTTCATGTTCGAAAAAAGACACATATTCAATTGCAGTTTCAGCCTCTCGCTGCAGATGGTATC
CTATTTTATGCTGCACAACACTTAAAAGCCCAATCAGGTGATTTTTTATGCATCTCTTTAGTAAATAGTTCCGTTCAACTTCGCTACAAC
CTTGGCGACAGAACTATCATTCTAGAAACTCTCCAAAAAGTAACTATAAACGGAAGTACTTGGCATATAATAAAAGCAGGAAGAGTTGGT
GCAGAAGGCTACCTGGATCTAGATGGGATAAATGTAACAGAAAAGGCCTCCACTAAAATGAGTTCTCTGGACACAAATACAGACTTCTAT
ATTGGAGGAGTATCTTCTTTAAATCTTGTAAATCCCATGGCAATAGAAAATGAACCTGTAGGTTTTCAAGGCTGTATCCGACAAGTTATC
ATAAATAATCAAGAATTACAATTAACTGAATTTGGAGCAAAAGGTGGCTCAAATGTAGGTGACTGTGATGGGACAGCCTGTGGGTACAAC
ACATGCAGAAATGGAGGTGAATGTACAGTAAATGGCACAACTTTTTCTTGCAGATGTTTGCCAGATTGGGCTGGAAATACATGTAACCAG
TCTGTGTCCTGTTTGAATAATCTTTGCCTCCACCAATCTTTATGTATACCTGACCAATCATTTTCTTACAGTTGCCTGTGTACTTTGGGT
TGGGTGGGAAGGTATTGTGAAAACAAAACTTCATTTTCAACTGCAAAATTTATGGGTAATTCTTACATTAAATACATTGATCCAAATTAT
AGAATGAGAAACCTCCAGTTCACTACTATATCCTTAAATTTCAGTACCACTAAAACAGAAGGTCTAATTGTATGGATGGGAATAGCTCAA
AATGAAGAAAATGATTTTCTGGCAATTGGTCTCCATAATCAGACCTTGAAAATAGCAGTTAACTTGGGAGAAAGAATCTCTGTGCCTATG
AGCTATAACAATGGCACATTCTGTTGTAATAAATGGCACCATGTAGTTGTAATTCAAAATCAGACTCTTATCAAGGCCTACATAAATAAC
AGTCTAATTCTTTCCGAGGATATTGATCCACATAAAAACTTTGTGGCTCTAAACTATGATGGCATTTGTTATCTAGGGGGCTTTGAATAT
GGTAGAAAGGTAAATATCGTTACTCAAGAGATTTTTAAAACCAATTTTGTTGGCAAAATTAAAGATGTTGTATTTTTTCAGGAACCAAAA

>In-frame_LMBRD1_ENST00000370577_chr6_70490386_-_EYS_ENST00000370621_chr6_65767620_-_7782nt
ATGGCGACTTCTGGCGCGGCCTCGGCGGAGCTGGTGATCGGCTGGTGCATATTCGGCCTCTTACTACTGGCTATTTTGGCATTCTGCTGG
ATATATGTTCGTAAATACCAAAGTCGGCGGGAAAGTGAAGTTGTCTCCACCATAACAGCAATTTTTTCTCTAGCAATTGCACTTATCACA
TCAGCACTTCTACCAGTGGATATATTTTTGGTTTCTTACATGAAAAATCAAAATGGTACATTTAAGGACTGGGCTAATGCTAATGTCAGC
AGACAGATTGAGGACACTGTATTATACGGTTACTATAGTACGCAATGTGAAATTGATATAGATGAGTGTGCTTCACATCCCTGCAAAAAT
GGAGCCACCTGCATTGACCAACCTGGTAATTACTTCTGCCAGTGTGTGCCTCCATTTAAAGTGGTTGATGGCTTTTCCTGCTTATGCAAT
CCAGGCTATGTTGGGATAAGATGTGAACAGGACATTGATGACTGCATCCTGAATGCCTGTGAGCACAATTCTACCTGCAAAGACCTGCAT
CTCAGCTACCAGTGTGTGTGCCTATCTGATTGGGAAGGAAATTTTTGTGAACAAGAATCCAATGAGTGTAAAATGAATCCTTGCAAGAAC
AATTCCACCTGTACTGACCTTTACAAAAGCTATCGATGTGAGTGTACATCTGGATGGACTGGACAGAACTGTAGTGAAGAAATAAATGAA
TGCGACTCTGATCCATGCATGAATGGAGGTCTTTGTCATGAATCTACCATCCCTGGACAATTTGTATGTCTGTGCCCACCCCTTTATACT
GGACAATTTTGCCACCAACGCTATAACCTTTGTGACCTACTTCATAACCCTTGCAGAAACAACTCAACATGCTTAGCTTTGGTAGACGCA
AATCAGCATTGTATTTGTAGAGAAGAATTTGAAGGTAAAAACTGTGAAATTGATGTGAAAGACTGCCTCTTCCTTTCCTGCCAGGATTAT
GGTGACTGTGAAGATATGGTCAACAATTTCAGGTGTATTTGCAGACCTGGGTTTTCTGGATCTCTGTGTGAAATTGAAATTAATGAATGT
TCCTCTGAACCTTGCAAAAATAATGGAACATGTGTGGATCTGACAAACAGATTTTTTTGTAATTGTGAACCTGAGTACCATGGGCCCTTC
TGTGAACTTGATGTAAATAAATGTAAAATCTCACCTTGTCTAGATGAAGAAAATTGTGTCTACAGGACTGATGGATACAACTGCCTCTGT
GCCCCTGGTTATACAGGCATCAACTGTGAAATAAATCTAGATGAATGCCTATCAGAGCCCTGTCTCCATGATGGAGTTTGTATCGATGGC
ATCAATCATTATACCTGTGACTGCAAGAGTGGGTTTTTTGGAACACACTGTGAAACAAACGCCAATGATTGCCTTTCAAATCCTTGTCTA
CATGGAAGGTGCACAGAACTTATTAATGAATATCCATGTTCATGTGATGCAGATGGGACTAGCACACAATGTAAGATCAAAATTAATGAC
TGCACATCAATCCCTTGTATGAATGAAGGCTTCTGTCAGAAGTCAGCACATGGATTTACTTGCATTTGCCCACGTGGATACACTGGTGCA
TACTGTGAAAAAAGCATTGATAATTGTGCTGAGCCTGAACTTAATTCAGTCATCTGTCTTAATGGAGGGATCTGTGTTGATGGGCCTGGA
CATACTTTTGACTGCAGATGTCTTCCTGGATTTTCTGGTCAATTTTGTGAAATTAATATAAATGAATGCTCTTCATCACCATGTCTACAT
GGTGCAGACTGTGAAGATCACATCAATGGATATGTTTGCAAATGCCAACCAGGATGGTCTGGACACCACTGTGAGAATGAGCTTGAGTGC
ATTCCCAACTCATGTGTTCATGAACTCTGCATGGAGAATGAACCTGGCTCGACATGTTTATGCACACCTGGATTTATGACCTGCTCCATT
GGGCTTCTTTGTGGTGATGAAATAAGGAGAATTACCTGTTTAACTCCCATCTTTCAAAGAACAGATCCCATTTCCACACAGACATATACA
ATTCCCCCTTCTGAGACTTTGGTCAGCAGCTTTCCATCTATAAAGGCTACTAGAATACCAGCCATAATGGACACTTACCCAGTTGATCAA
GGTCCAAAACAGACAGGCATTGTCAAGCACGACATTCTCCCAACCACTGGTTTGGCAACATTAAGAATTAGCACACCCTTGGAAAGCTAC
TTACTCCAAGAACTGATTGTCACTAGAGAGCTTTCAGCAAAACACAGTCTTCTTTCTTCCGCAGATGTTTCCTCTTCTCGATTCCTGAAT
TTTGGTATTCGTGACCCAGCACAAATTGTCCAGGACAAAACATCGGTATCACATATGCCTATTCGAACTTCAGCAGCCACACTAGGTTTC
TTTTTTCCTGATAGGAGAGCAAGGACCCCATTTATCATGTCTTCCTTAATGTCAGATTTTATTTTTCCTACACAATCTTTATTATTTGAG
AACTGTCAGACTGTTGCTTTATCTGCTACCCCAACGACTTCAGTAATTAGAAGCATTCCAGGGGCTGATATTGAGCTAAACAGGCAGTCA
TTACTCTCCCGTGGATTCCTGCTTATAGCTGCCTCCATAAGTGCAACTCCAGTTGTCTCTAGGGGGGCTCAAGAGGATATTGAAGAATAT
TCAGCTGATTCTTTAATTTCAAGAAGAGAGCACTGGAGATTGCTCAGCCCCTCGATGTCTCCCATTTTTCCTGCTAAGGTAATTATATCT
AAACAGGTAACCATCTTAAACTCATCAGCTCTGCACCGGTTCAGTACAAAAGCCTTCAATCCCAGTGAATATCAGGCTATTACTGAGGCT
TCAAGCAACCAGAGACTCACAAACATCAAATCACAGGCTGCTGATTCTTTAAGAGAATTAAGCCAAACATGTGCAACATGTTCTATGACT
GAAATAAAATCCTCTCGTGAATTCTCAGATCAAGTTTTGCATAGCAAACAGTCCCACTTTTATGAGACATTCTGGATGAACTCAGCGATA
TTAGCCAGCTGGTATGCACTAATGGGAGCTCAAACTATCACTTCTGGGCATTCATTTTCTTCTGCTACTGAAATAACACCATCAGTGGCA
TTCACAGAAGTGCCATCTTTATTTCCTTCTAAAAAGAGTGCAAAAAGAACAATTTTATCCTCATCCTTGGAAGAATCCATTACCCTATCA
AGTAATTTGGATGTTAATTTATGTTTGGATAAGACTTGTTTATCCATTGTCCCTTCACAAACTATCTCTTCAGACTTGATGAATTCTGAT
TTGACTTCAAAAATGACTACTGATGAACTGTCAGTATCAGAAAACATTTTAAAACTATTGAAAATAAGACAATATGGCATAACTATGGGA
CCCACTGAGGTACTAAATCAAGAGAGCTTATTGGACATGGAAAAAAGTAAAGGATCTCATACACTGTTCAAACTTCACCCAAGTGATAGT
TCTCTGGATTTTGAGTTAAACTTACAAATTTATCCGGATGTTACTTTAAAGACATATTCAGAAATTACACATGCAAATGACTTCAAAAAT
AATCTGCCACCATTGACAGGCTCAGTGCCTGATTTTTCAGAAGTCACCACCAATGTTGCATTTTATACAGTTTCAGCAACTCCAGCACTT
TCAATACAGACGTCTTCCTCCATGTCTGTAATTAGGCCAGATTGGCCATATTTTACAGATTATATGACCTCTCTTAAAAAAGAGGTCAAG
ACTTCTTCAGAATGGTCCAAATGGGAACTTCAGCCTAGTGTGCAATATCAGGAATTTCCCACTGCAAGCCGGCATCTTCCCTTCACTAGA
TCTCTTACTTTGTCTTCACTGGAATCCATTCTGGCACCTCAACGGCTGATGATTTCTGATTTCAGTTGTGTTCGTTATTATGGAGATTCT
TATCTAGAATTTCAGAATGTGGCTTTAAATCCACAAAATAACATCTCCCTAGAATTTCAGACCTTCAGCTCCTATGGACTTCTGCTGTAT
GTCAAGCAAGACTCAAATTTAGTAGATGGATTTTTTATTCAATTGTTTATTGAAAATGGTACTTTAAAGTACCACTTTTACTGTCCTGGT
GAAGCAAAATTTAAAAGCATTAATACTACTGTTAGAGTGGACAACGGGCAAAAGTATACACTGCTTATCAGGCAAGAATTGGATCCATGT
AACGCTGAGCTGACTATTTTAGGGAGGAATACACAAATATGCGAATCTATCAATCATGTACTCGGAAAACCCCTGCCAAAATCAGGATCT
GTCTTCATTGGTGGATTTCCAGACCTTCATGGGAAAATCCAGATGCCTGTACCAGTCAAGAATTTTACTGGCTGCATAGAAGTTATAGAA
ATAAATAACTGGAGATCTTTCATTCCATCCAAGGCAGTGAAAAACTATCACATTAACAATTGCAGATCCCAGGGATTTATGCTGTCTCCA
ACAGCCTCCTTTGTTGATGCTTCTGATGTGACACAAGGGGTTGATACCATGTGGACTTCTGTCAGCCCCTCTGTTGCAGCACCCTCTGTG
TGCCAGCAGGATGTATGCCACAATGGAGGCACATGCCATGCCATCTTCCTCTCCAGTGGCATAGTGTCATTCCAATGTGACTGTCCACTA
CATTTCACTGGCCGCTTCTGTGAAAAAGATGCAGGTTTATTCTTTCCATCTTTCAATGGGAATTCCTATTTAGAACTGCCCTTTTTGAAG
TTTGTCCTGGAGAAGGAACATAACAGAACTGTTACCATCTACTTGACTATAAAAACAAACAGTTTAAATGGAACTATTCTTTACAGTAAT
GGGAATAATTGTGGAAAGCAGTTTCTTCATTTATTTCTTGTGGAAGGAAGGCCATCAGTTAAATATGGGTGTGGAAATTCTCAAAATATT
TTGACTGTTTCTGCTAATTACAGCATTAACACAAATGCATTCACCCCTATCACAATACGCTACACAACGCCTGTTGGCAGCCCTGGAGTT
GTTTGTATGATTGAAATGACTGCAGATGGAAAACCTCCAGTACAGAAGAAAGACACAGAGATTTCCCATGCCTCTCAGGCATATTTTGAA
TCAATGTTCCTTGGCCATATTCCTGCAAATGTTCAAATTCATAAGAAAGCAGGTCCTGTTTATGGGTTCAGGGGCTGCATTCTAGACCTT
CAAGTAAACAACAAAGAATTCTTCATCATCGATGAAGCACGACATGGAAAGAATATTGAGAACTGCCACGTCCCTTGGTGTGCTCATCAT
CTGTGCCGCAACAATGGCACCTGCATCAGTGATAATGAAAATCTGTTTTGTGAGTGTCCAAGGCTGTATTCAGGCAAGCTGTGCCAGTTT
GCAAGTTGTGAAAACAACCCATGTGGAAATGGTGCCACCTGTGTTCCAAAATCCGGAACAGATATTGTCTGCCTCTGCCCATATGGGAGG
TCTGGACCCCTCTGCACTGATGCTATTAATATTACTCAGCCAAGGTTCAGTGGCACAGATGCCTTTGGATACACCTCATTCCTGGCTTAT
TCACGGATCTCAGACATCAGCTTCCATTATGAATTCCACCTGAAGTTTCAGCTGGCAAACAACCACTCAGCACTGCAAAATAACTTGATA
TTTTTTACTGGACAGAAAGGCCATGGGTTGAATGGCGATGACTTCCTGGCTGTGGGCCTGCTCAATGGCAGTGTGGTTTATAGTTATAAC
CTGGGGTCTGGCATAGCAAGCATCAGGAGCGAGCCCCTCAATCTGAGCCTTGGAGTCCACACTGTTCATCTGGGCAAGTTCTTCCAAGAG
GGCTGGCTGAAGGTAGATGATCATAAAAATAAATCCATTATCGCCCCAGGAAGACTGGTTGGTCTCAATGTCTTCAGTCAGTTTTATGTA
GGTGGCTACAGTGAATACACTCCAGATCTCTTACCAAATGGAGCAGATTTTAAAAATGGTTTTCAAGGCTGTATTTTCACTCTTCAAGTT
CGCACTGAGAAGGATGGCCATTTCAGAGGACTGGGAAATCCTGAGGGCCACCCAAATGCTGGACGCAGTGTTGGCCAGTGTCATGCTTCT
CCCTGCAGTTTAATGAAATGTGGCAATGGTGGGACATGCATAGAGAGTGGAACTAGTGTTTACTGCAATTGTACCACTGGGTGGAAAGGA
TCATTCTGCACAGAGACAGTTTCTACCTGTGATCCTGAACATGACCCTCCACACCACTGTAGCAGAGGAGCAACCTGCATTTCATTACCT
CATGGATACACCTGTTTCTGTCCTCTAGGAACCACTGGAATCTACTGTGAACAAGCACTTATCCTCATTGTGATCTTGGAAAAGCCAAAA
CCAGCAGAACGGAAAGTGAAGAAGGAGGCTTTATCCATAAGTGATCCATCTTTCAGAAGCAATGAGTTATCCTGGATGTCTTTTGCTTCC
TTTCATGTTCGAAAAAAGACACATATTCAATTGCAGTTTCAGCCTCTCGCTGCAGATGGTATCCTATTTTATGCTGCACAACACTTAAAA
GCCCAATCAGGTGATTTTTTATGCATCTCTTTAGTAAATAGTTCCGTTCAACTTCGCTACAACCTTGGCGACAGAACTATCATTCTAGAA
ACTCTCCAAAAAGTAACTATAAACGGAAGTACTTGGCATATAATAAAAGCAGGAAGAGTTGGTGCAGAAGGCTACCTGGATCTAGATGGG
ATAAATGTAACAGAAAAGGCCTCCACTAAAATGAGTTCTCTGGACACAAATACAGACTTCTATATTGGAGGAGTATCTTCTTTAAATCTT
GTAAATCCCATGGCAATAGAAAATGAACCTGTAGGTTTTCAAGGCTGTATCCGACAAGTTATCATAAATAATCAAGAATTACAATTAACT
GAATTTGGAGCAAAAGGTGGCTCAAATGTAGGTGACTGTGATGGGACAGCCTGTGGGTACAACACATGCAGAAATGGAGGTGAATGTACA
GTAAATGGCACAACTTTTTCTTGCAGATGTTTGCCAGATTGGGCTGGAAATACATGTAACCAGTCTGTGTCCTGTTTGAATAATCTTTGC
CTCCACCAATCTTTATGTATACCTGACCAATCATTTTCTTACAGTTGCCTGTGTACTTTGGGTTGGGTGGGAAGGTATTGTGAAAACAAA
ACTTCATTTTCAACTGCAAAATTTATGGGTAATTCTTACATTAAATACATTGATCCAAATTATAGAATGAGAAACCTCCAGTTCACTACT
ATATCCTTAAATTTCAGTACCACTAAAACAGAAGGTCTAATTGTATGGATGGGAATAGCTCAAAATGAAGAAAATGATTTTCTGGCAATT
GGTCTCCATAATCAGACCTTGAAAATAGCAGTTAACTTGGGAGAAAGAATCTCTGTGCCTATGAGCTATAACAATGGCACATTCTGTTGT
AATAAATGGCACCATGTAGTTGTAATTCAAAATCAGACTCTTATCAAGGCCTACATAAATAACAGTCTAATTCTTTCCGAGGATATTGAT
CCACATAAAAACTTTGTGGCTCTAAACTATGATGGCATTTGTTATCTAGGGGGCTTTGAATATGGTAGAAAGGTAAATATCGTTACTCAA
GAGATTTTTAAAACCAATTTTGTTGGCAAAATTAAAGATGTTGTATTTTTTCAGGAACCAAAAAACATTGAACTAATTAAATTAGAAGGA

>In-frame_LMBRD1_ENST00000370577_chr6_70490386_-_EYS_ENST00000370616_chr6_65767620_-_7782nt
ATGGCGACTTCTGGCGCGGCCTCGGCGGAGCTGGTGATCGGCTGGTGCATATTCGGCCTCTTACTACTGGCTATTTTGGCATTCTGCTGG
ATATATGTTCGTAAATACCAAAGTCGGCGGGAAAGTGAAGTTGTCTCCACCATAACAGCAATTTTTTCTCTAGCAATTGCACTTATCACA
TCAGCACTTCTACCAGTGGATATATTTTTGGTTTCTTACATGAAAAATCAAAATGGTACATTTAAGGACTGGGCTAATGCTAATGTCAGC
AGACAGATTGAGGACACTGTATTATACGGTTACTATAGTACGCAATGTGAAATTGATATAGATGAGTGTGCTTCACATCCCTGCAAAAAT
GGAGCCACCTGCATTGACCAACCTGGTAATTACTTCTGCCAGTGTGTGCCTCCATTTAAAGTGGTTGATGGCTTTTCCTGCTTATGCAAT
CCAGGCTATGTTGGGATAAGATGTGAACAGGACATTGATGACTGCATCCTGAATGCCTGTGAGCACAATTCTACCTGCAAAGACCTGCAT
CTCAGCTACCAGTGTGTGTGCCTATCTGATTGGGAAGGAAATTTTTGTGAACAAGAATCCAATGAGTGTAAAATGAATCCTTGCAAGAAC
AATTCCACCTGTACTGACCTTTACAAAAGCTATCGATGTGAGTGTACATCTGGATGGACTGGACAGAACTGTAGTGAAGAAATAAATGAA
TGCGACTCTGATCCATGCATGAATGGAGGTCTTTGTCATGAATCTACCATCCCTGGACAATTTGTATGTCTGTGCCCACCCCTTTATACT
GGACAATTTTGCCACCAACGCTATAACCTTTGTGACCTACTTCATAACCCTTGCAGAAACAACTCAACATGCTTAGCTTTGGTAGACGCA
AATCAGCATTGTATTTGTAGAGAAGAATTTGAAGGTAAAAACTGTGAAATTGATGTGAAAGACTGCCTCTTCCTTTCCTGCCAGGATTAT
GGTGACTGTGAAGATATGGTCAACAATTTCAGGTGTATTTGCAGACCTGGGTTTTCTGGATCTCTGTGTGAAATTGAAATTAATGAATGT
TCCTCTGAACCTTGCAAAAATAATGGAACATGTGTGGATCTGACAAACAGATTTTTTTGTAATTGTGAACCTGAGTACCATGGGCCCTTC
TGTGAACTTGATGTAAATAAATGTAAAATCTCACCTTGTCTAGATGAAGAAAATTGTGTCTACAGGACTGATGGATACAACTGCCTCTGT
GCCCCTGGTTATACAGGCATCAACTGTGAAATAAATCTAGATGAATGCCTATCAGAGCCCTGTCTCCATGATGGAGTTTGTATCGATGGC
ATCAATCATTATACCTGTGACTGCAAGAGTGGGTTTTTTGGAACACACTGTGAAACAAACGCCAATGATTGCCTTTCAAATCCTTGTCTA
CATGGAAGGTGCACAGAACTTATTAATGAATATCCATGTTCATGTGATGCAGATGGGACTAGCACACAATGTAAGATCAAAATTAATGAC
TGCACATCAATCCCTTGTATGAATGAAGGCTTCTGTCAGAAGTCAGCACATGGATTTACTTGCATTTGCCCACGTGGATACACTGGTGCA
TACTGTGAAAAAAGCATTGATAATTGTGCTGAGCCTGAACTTAATTCAGTCATCTGTCTTAATGGAGGGATCTGTGTTGATGGGCCTGGA
CATACTTTTGACTGCAGATGTCTTCCTGGATTTTCTGGTCAATTTTGTGAAATTAATATAAATGAATGCTCTTCATCACCATGTCTACAT
GGTGCAGACTGTGAAGATCACATCAATGGATATGTTTGCAAATGCCAACCAGGATGGTCTGGACACCACTGTGAGAATGAGCTTGAGTGC
ATTCCCAACTCATGTGTTCATGAACTCTGCATGGAGAATGAACCTGGCTCGACATGTTTATGCACACCTGGATTTATGACCTGCTCCATT
GGGCTTCTTTGTGGTGATGAAATAAGGAGAATTACCTGTTTAACTCCCATCTTTCAAAGAACAGATCCCATTTCCACACAGACATATACA
ATTCCCCCTTCTGAGACTTTGGTCAGCAGCTTTCCATCTATAAAGGCTACTAGAATACCAGCCATAATGGACACTTACCCAGTTGATCAA
GGTCCAAAACAGACAGGCATTGTCAAGCACGACATTCTCCCAACCACTGGTTTGGCAACATTAAGAATTAGCACACCCTTGGAAAGCTAC
TTACTCCAAGAACTGATTGTCACTAGAGAGCTTTCAGCAAAACACAGTCTTCTTTCTTCCGCAGATGTTTCCTCTTCTCGATTCCTGAAT
TTTGGTATTCGTGACCCAGCACAAATTGTCCAGGACAAAACATCGGTATCACATATGCCTATTCGAACTTCAGCAGCCACACTAGGTTTC
TTTTTTCCTGATAGGAGAGCAAGGACCCCATTTATCATGTCTTCCTTAATGTCAGATTTTATTTTTCCTACACAATCTTTATTATTTGAG
AACTGTCAGACTGTTGCTTTATCTGCTACCCCAACGACTTCAGTAATTAGAAGCATTCCAGGGGCTGATATTGAGCTAAACAGGCAGTCA
TTACTCTCCCGTGGATTCCTGCTTATAGCTGCCTCCATAAGTGCAACTCCAGTTGTCTCTAGGGGGGCTCAAGAGGATATTGAAGAATAT
TCAGCTGATTCTTTAATTTCAAGAAGAGAGCACTGGAGATTGCTCAGCCCCTCGATGTCTCCCATTTTTCCTGCTAAGGTAATTATATCT
AAACAGGTAACCATCTTAAACTCATCAGCTCTGCACCGGTTCAGTACAAAAGCCTTCAATCCCAGTGAATATCAGGCTATTACTGAGGCT
TCAAGCAACCAGAGACTCACAAACATCAAATCACAGGCTGCTGATTCTTTAAGAGAATTAAGCCAAACATGTGCAACATGTTCTATGACT
GAAATAAAATCCTCTCGTGAATTCTCAGATCAAGTTTTGCATAGCAAACAGTCCCACTTTTATGAGACATTCTGGATGAACTCAGCGATA
TTAGCCAGCTGGTATGCACTAATGGGAGCTCAAACTATCACTTCTGGGCATTCATTTTCTTCTGCTACTGAAATAACACCATCAGTGGCA
TTCACAGAAGTGCCATCTTTATTTCCTTCTAAAAAGAGTGCAAAAAGAACAATTTTATCCTCATCCTTGGAAGAATCCATTACCCTATCA
AGTAATTTGGATGTTAATTTATGTTTGGATAAGACTTGTTTATCCATTGTCCCTTCACAAACTATCTCTTCAGACTTGATGAATTCTGAT
TTGACTTCAAAAATGACTACTGATGAACTGTCAGTATCAGAAAACATTTTAAAACTATTGAAAATAAGACAATATGGCATAACTATGGGA
CCCACTGAGGTACTAAATCAAGAGAGCTTATTGGACATGGAAAAAAGTAAAGGATCTCATACACTGTTCAAACTTCACCCAAGTGATAGT
TCTCTGGATTTTGAGTTAAACTTACAAATTTATCCGGATGTTACTTTAAAGACATATTCAGAAATTACACATGCAAATGACTTCAAAAAT
AATCTGCCACCATTGACAGGCTCAGTGCCTGATTTTTCAGAAGTCACCACCAATGTTGCATTTTATACAGTTTCAGCAACTCCAGCACTT
TCAATACAGACGTCTTCCTCCATGTCTGTAATTAGGCCAGATTGGCCATATTTTACAGATTATATGACCTCTCTTAAAAAAGAGGTCAAG
ACTTCTTCAGAATGGTCCAAATGGGAACTTCAGCCTAGTGTGCAATATCAGGAATTTCCCACTGCAAGCCGGCATCTTCCCTTCACTAGA
TCTCTTACTTTGTCTTCACTGGAATCCATTCTGGCACCTCAACGGCTGATGATTTCTGATTTCAGTTGTGTTCGTTATTATGGAGATTCT
TATCTAGAATTTCAGAATGTGGCTTTAAATCCACAAAATAACATCTCCCTAGAATTTCAGACCTTCAGCTCCTATGGACTTCTGCTGTAT
GTCAAGCAAGACTCAAATTTAGTAGATGGATTTTTTATTCAATTGTTTATTGAAAATGGTACTTTAAAGTACCACTTTTACTGTCCTGGT
GAAGCAAAATTTAAAAGCATTAATACTACTGTTAGAGTGGACAACGGGCAAAAGTATACACTGCTTATCAGGCAAGAATTGGATCCATGT
AACGCTGAGCTGACTATTTTAGGGAGGAATACACAAATATGCGAATCTATCAATCATGTACTCGGAAAACCCCTGCCAAAATCAGGATCT
GTCTTCATTGGTGGATTTCCAGACCTTCATGGGAAAATCCAGATGCCTGTACCAGTCAAGAATTTTACTGGCTGCATAGAAGTTATAGAA
ATAAATAACTGGAGATCTTTCATTCCATCCAAGGCAGTGAAAAACTATCACATTAACAATTGCAGATCCCAGGGATTTATGCTGTCTCCA
ACAGCCTCCTTTGTTGATGCTTCTGATGTGACACAAGGGGTTGATACCATGTGGACTTCTGTCAGCCCCTCTGTTGCAGCACCCTCTGTG
TGCCAGCAGGATGTATGCCACAATGGAGGCACATGCCATGCCATCTTCCTCTCCAGTGGCATAGTGTCATTCCAATGTGACTGTCCACTA
CATTTCACTGGCCGCTTCTGTGAAAAAGATGCAGGTTTATTCTTTCCATCTTTCAATGGGAATTCCTATTTAGAACTGCCCTTTTTGAAG
TTTGTCCTGGAGAAGGAACATAACAGAACTGTTACCATCTACTTGACTATAAAAACAAACAGTTTAAATGGAACTATTCTTTACAGTAAT
GGGAATAATTGTGGAAAGCAGTTTCTTCATTTATTTCTTGTGGAAGGAAGGCCATCAGTTAAATATGGGTGTGGAAATTCTCAAAATATT
TTGACTGTTTCTGCTAATTACAGCATTAACACAAATGCATTCACCCCTATCACAATACGCTACACAACGCCTGTTGGCAGCCCTGGAGTT
GTTTGTATGATTGAAATGACTGCAGATGGAAAACCTCCAGTACAGAAGAAAGACACAGAGATTTCCCATGCCTCTCAGGCATATTTTGAA
TCAATGTTCCTTGGCCATATTCCTGCAAATGTTCAAATTCATAAGAAAGCAGGTCCTGTTTATGGGTTCAGGGGCTGCATTCTAGACCTT
CAAGTAAACAACAAAGAATTCTTCATCATCGATGAAGCACGACATGGAAAGAATATTGAGAACTGCCACGTCCCTTGGTGTGCTCATCAT
CTGTGCCGCAACAATGGCACCTGCATCAGTGATAATGAAAATCTGTTTTGTGAGTGTCCAAGGCTGTATTCAGGCAAGCTGTGCCAGTTT
GCAAGTTGTGAAAACAACCCATGTGGAAATGGTGCCACCTGTGTTCCAAAATCCGGAACAGATATTGTCTGCCTCTGCCCATATGGGAGG
TCTGGACCCCTCTGCACTGATGCTATTAATATTACTCAGCCAAGGTTCAGTGGCACAGATGCCTTTGGATACACCTCATTCCTGGCTTAT
TCACGGATCTCAGACATCAGCTTCCATTATGAATTCCACCTGAAGTTTCAGCTGGCAAACAACCACTCAGCACTGCAAAATAACTTGATA
TTTTTTACTGGACAGAAAGGCCATGGGTTGAATGGCGATGACTTCCTGGCTGTGGGCCTGCTCAATGGCAGTGTGGTTTATAGTTATAAC
CTGGGGTCTGGCATAGCAAGCATCAGGAGCGAGCCCCTCAATCTGAGCCTTGGAGTCCACACTGTTCATCTGGGCAAGTTCTTCCAAGAG
GGCTGGCTGAAGGTAGATGATCATAAAAATAAATCCATTATCGCCCCAGGAAGACTGGTTGGTCTCAATGTCTTCAGTCAGTTTTATGTA
GGTGGCTACAGTGAATACACTCCAGATCTCTTACCAAATGGAGCAGATTTTAAAAATGGTTTTCAAGGCTGTATTTTCACTCTTCAAGTT
CGCACTGAGAAGGATGGCCATTTCAGAGGACTGGGAAATCCTGAGGGCCACCCAAATGCTGGACGCAGTGTTGGCCAGTGTCATGCTTCT
CCCTGCAGTTTAATGAAATGTGGCAATGGTGGGACATGCATAGAGAGTGGAACTAGTGTTTACTGCAATTGTACCACTGGGTGGAAAGGA
TCATTCTGCACAGAGACAGTTTCTACCTGTGATCCTGAACATGACCCTCCACACCACTGTAGCAGAGGAGCAACCTGCATTTCATTACCT
CATGGATACACCTGTTTCTGTCCTCTAGGAACCACTGGAATCTACTGTGAACAAGCACTTATCCTCATTGTGATCTTGGAAAAGCCAAAA
CCAGCAGAACGGAAAGTGAAGAAGGAGGCTTTATCCATAAGTGATCCATCTTTCAGAAGCAATGAGTTATCCTGGATGTCTTTTGCTTCC
TTTCATGTTCGAAAAAAGACACATATTCAATTGCAGTTTCAGCCTCTCGCTGCAGATGGTATCCTATTTTATGCTGCACAACACTTAAAA
GCCCAATCAGGTGATTTTTTATGCATCTCTTTAGTAAATAGTTCCGTTCAACTTCGCTACAACCTTGGCGACAGAACTATCATTCTAGAA
ACTCTCCAAAAAGTAACTATAAACGGAAGTACTTGGCATATAATAAAAGCAGGAAGAGTTGGTGCAGAAGGCTACCTGGATCTAGATGGG
ATAAATGTAACAGAAAAGGCCTCCACTAAAATGAGTTCTCTGGACACAAATACAGACTTCTATATTGGAGGAGTATCTTCTTTAAATCTT
GTAAATCCCATGGCAATAGAAAATGAACCTGTAGGTTTTCAAGGCTGTATCCGACAAGTTATCATAAATAATCAAGAATTACAATTAACT
GAATTTGGAGCAAAAGGTGGCTCAAATGTAGGTGACTGTGATGGGACAGCCTGTGGGTACAACACATGCAGAAATGGAGGTGAATGTACA
GTAAATGGCACAACTTTTTCTTGCAGATGTTTGCCAGATTGGGCTGGAAATACATGTAACCAGTCTGTGTCCTGTTTGAATAATCTTTGC
CTCCACCAATCTTTATGTATACCTGACCAATCATTTTCTTACAGTTGCCTGTGTACTTTGGGTTGGGTGGGAAGGTATTGTGAAAACAAA
ACTTCATTTTCAACTGCAAAATTTATGGGTAATTCTTACATTAAATACATTGATCCAAATTATAGAATGAGAAACCTCCAGTTCACTACT
ATATCCTTAAATTTCAGTACCACTAAAACAGAAGGTCTAATTGTATGGATGGGAATAGCTCAAAATGAAGAAAATGATTTTCTGGCAATT
GGTCTCCATAATCAGACCTTGAAAATAGCAGTTAACTTGGGAGAAAGAATCTCTGTGCCTATGAGCTATAACAATGGCACATTCTGTTGT
AATAAATGGCACCATGTAGTTGTAATTCAAAATCAGACTCTTATCAAGGCCTACATAAATAACAGTCTAATTCTTTCCGAGGATATTGAT
CCACATAAAAACTTTGTGGCTCTAAACTATGATGGCATTTGTTATCTAGGGGGCTTTGAATATGGTAGAAAGGTAAATATCGTTACTCAA
GAGATTTTTAAAACCAATTTTGTTGGCAAAATTAAAGATGTTGTATTTTTTCAGGAACCAAAAAACATTGAACTAATTAAATTAGAAGGA

>In-frame_LMBRD1_ENST00000370570_chr6_70490386_-_EYS_ENST00000503581_chr6_65767620_-_7500nt
ATGAAAAATCAAAATGGTACATTTAAGGACTGGGCTAATGCTAATGTCAGCAGACAGATTGAGGACACTGTATTATACGGTTACTATAGT
ACGCAATGTGAAATTGATATAGATGAGTGTGCTTCACATCCCTGCAAAAATGGAGCCACCTGCATTGACCAACCTGGTAATTACTTCTGC
CAGTGTGTGCCTCCATTTAAAGTGGTTGATGGCTTTTCCTGCTTATGCAATCCAGGCTATGTTGGGATAAGATGTGAACAGGACATTGAT
GACTGCATCCTGAATGCCTGTGAGCACAATTCTACCTGCAAAGACCTGCATCTCAGCTACCAGTGTGTGTGCCTATCTGATTGGGAAGGA
AATTTTTGTGAACAAGAATCCAATGAGTGTAAAATGAATCCTTGCAAGAACAATTCCACCTGTACTGACCTTTACAAAAGCTATCGATGT
GAGTGTACATCTGGATGGACTGGACAGAACTGTAGTGAAGAAATAAATGAATGCGACTCTGATCCATGCATGAATGGAGGTCTTTGTCAT
GAATCTACCATCCCTGGACAATTTGTATGTCTGTGCCCACCCCTTTATACTGGACAATTTTGCCACCAACGCTATAACCTTTGTGACCTA
CTTCATAACCCTTGCAGAAACAACTCAACATGCTTAGCTTTGGTAGACGCAAATCAGCATTGTATTTGTAGAGAAGAATTTGAAGGTAAA
AACTGTGAAATTGATGTGAAAGACTGCCTCTTCCTTTCCTGCCAGGATTATGGTGACTGTGAAGATATGGTCAACAATTTCAGGTGTATT
TGCAGACCTGGGTTTTCTGGATCTCTGTGTGAAATTGAAATTAATGAATGTTCCTCTGAACCTTGCAAAAATAATGGAACATGTGTGGAT
CTGACAAACAGATTTTTTTGTAATTGTGAACCTGAGTACCATGGGCCCTTCTGTGAACTTGATGTAAATAAATGTAAAATCTCACCTTGT
CTAGATGAAGAAAATTGTGTCTACAGGACTGATGGATACAACTGCCTCTGTGCCCCTGGTTATACAGGCATCAACTGTGAAATAAATCTA
GATGAATGCCTATCAGAGCCCTGTCTCCATGATGGAGTTTGTATCGATGGCATCAATCATTATACCTGTGACTGCAAGAGTGGGTTTTTT
GGAACACACTGTGAAACAAACGCCAATGATTGCCTTTCAAATCCTTGTCTACATGGAAGGTGCACAGAACTTATTAATGAATATCCATGT
TCATGTGATGCAGATGGGACTAGCACACAATGTAAGATCAAAATTAATGACTGCACATCAATCCCTTGTATGAATGAAGGCTTCTGTCAG
AAGTCAGCACATGGATTTACTTGCATTTGCCCACGTGGATACACTGGTGCATACTGTGAAAAAAGCATTGATAATTGTGCTGAGCCTGAA
CTTAATTCAGTCATCTGTCTTAATGGAGGGATCTGTGTTGATGGGCCTGGACATACTTTTGACTGCAGATGTCTTCCTGGATTTTCTGGT
CAATTTTGTGAAATTAATATAAATGAATGCTCTTCATCACCATGTCTACATGGTGCAGACTGTGAAGATCACATCAATGGATATGTTTGC
AAATGCCAACCAGGATGGTCTGGACACCACTGTGAGAATGAGCTTGAGTGCATTCCCAACTCATGTGTTCATGAACTCTGCATGGAGAAT
GAACCTGGCTCGACATGTTTATGCACACCTGGATTTATGACCTGCTCCATTGGGCTTCTTTGTGGTGATGAAATAAGGAGAATTACCTGT
TTAACTCCCATCTTTCAAAGAACAGATCCCATTTCCACACAGACATATACAATTCCCCCTTCTGAGACTTTGGTCAGCAGCTTTCCATCT
ATAAAGGCTACTAGAATACCAGCCATAATGGACACTTACCCAGTTGATCAAGGTCCAAAACAGACAGGCATTGTCAAGCACGACATTCTC
CCAACCACTGGTTTGGCAACATTAAGAATTAGCACACCCTTGGAAAGCTACTTACTCCAAGAACTGATTGTCACTAGAGAGCTTTCAGCA
AAACACAGTCTTCTTTCTTCCGCAGATGTTTCCTCTTCTCGATTCCTGAATTTTGGTATTCGTGACCCAGCACAAATTGTCCAGGACAAA
ACATCGGTATCACATATGCCTATTCGAACTTCAGCAGCCACACTAGGTTTCTTTTTTCCTGATAGGAGAGCAAGGACCCCATTTATCATG
TCTTCCTTAATGTCAGATTTTATTTTTCCTACACAATCTTTATTATTTGAGAACTGTCAGACTGTTGCTTTATCTGCTACCCCAACGACT
TCAGTAATTAGAAGCATTCCAGGGGCTGATATTGAGCTAAACAGGCAGTCATTACTCTCCCGTGGATTCCTGCTTATAGCTGCCTCCATA
AGTGCAACTCCAGTTGTCTCTAGGGGGGCTCAAGAGGATATTGAAGAATATTCAGCTGATTCTTTAATTTCAAGAAGAGAGCACTGGAGA
TTGCTCAGCCCCTCGATGTCTCCCATTTTTCCTGCTAAGGTAATTATATCTAAACAGGTAACCATCTTAAACTCATCAGCTCTGCACCGG
TTCAGTACAAAAGCCTTCAATCCCAGTGAATATCAGGCTATTACTGAGGCTTCAAGCAACCAGAGACTCACAAACATCAAATCACAGGCT
GCTGATTCTTTAAGAGAATTAAGCCAAACATGTGCAACATGTTCTATGACTGAAATAAAATCCTCTCGTGAATTCTCAGATCAAGTTTTG
CATAGCAAACAGTCCCACTTTTATGAGACATTCTGGATGAACTCAGCGATATTAGCCAGCTGGTATGCACTAATGGGAGCTCAAACTATC
ACTTCTGGGCATTCATTTTCTTCTGCTACTGAAATAACACCATCAGTGGCATTCACAGAAGTGCCATCTTTATTTCCTTCTAAAAAGAGT
GCAAAAAGAACAATTTTATCCTCATCCTTGGAAGAATCCATTACCCTATCAAGTAATTTGGATGTTAATTTATGTTTGGATAAGACTTGT
TTATCCATTGTCCCTTCACAAACTATCTCTTCAGACTTGATGAATTCTGATTTGACTTCAAAAATGACTACTGATGAACTGTCAGTATCA
GAAAACATTTTAAAACTATTGAAAATAAGACAATATGGCATAACTATGGGACCCACTGAGGTACTAAATCAAGAGAGCTTATTGGACATG
GAAAAAAGTAAAGGATCTCATACACTGTTCAAACTTCACCCAAGTGATAGTTCTCTGGATTTTGAGTTAAACTTACAAATTTATCCGGAT
GTTACTTTAAAGACATATTCAGAAATTACACATGCAAATGACTTCAAAAATAATCTGCCACCATTGACAGGCTCAGTGCCTGATTTTTCA
GAAGTCACCACCAATGTTGCATTTTATACAGTTTCAGCAACTCCAGCACTTTCAATACAGACGTCTTCCTCCATGTCTGTAATTAGGCCA
GATTGGCCATATTTTACAGATTATATGACCTCTCTTAAAAAAGAGGTCAAGACTTCTTCAGAATGGTCCAAATGGGAACTTCAGCCTAGT
GTGCAATATCAGGAATTTCCCACTGCAAGCCGGCATCTTCCCTTCACTAGATCTCTTACTTTGTCTTCACTGGAATCCATTCTGGCACCT
CAACGGCTGATGATTTCTGATTTCAGTTGTGTTCGTTATTATGGAGATTCTTATCTAGAATTTCAGAATGTGGCTTTAAATCCACAAAAT
AACATCTCCCTAGAATTTCAGACCTTCAGCTCCTATGGACTTCTGCTGTATGTCAAGCAAGACTCAAATTTAGTAGATGGATTTTTTATT
CAATTGTTTATTGAAAATGGTACTTTAAAGTACCACTTTTACTGTCCTGGTGAAGCAAAATTTAAAAGCATTAATACTACTGTTAGAGTG
GACAACGGGCAAAAGTATACACTGCTTATCAGGCAAGAATTGGATCCATGTAACGCTGAGCTGACTATTTTAGGGAGGAATACACAAATA
TGCGAATCTATCAATCATGTACTCGGAAAACCCCTGCCAAAATCAGGATCTGTCTTCATTGGTGGATTTCCAGACCTTCATGGGAAAATC
CAGATGCCTGTACCAGTCAAGAATTTTACTGGCTGCATAGAAGTTATAGAAATAAATAACTGGAGATCTTTCATTCCATCCAAGGCAGTG
AAAAACTATCACATTAACAATTGCAGATCCCAGGGATTTATGCTGTCTCCAACAGCCTCCTTTGTTGATGCTTCTGATGTGACACAAGGG
GTTGATACCATGTGGACTTCTGTCAGCCCCTCTGTTGCAGCACCCTCTGTGTGCCAGCAGGATGTATGCCACAATGGAGGCACATGCCAT
GCCATCTTCCTCTCCAGTGGCATAGTGTCATTCCAATGTGACTGTCCACTACATTTCACTGGCCGCTTCTGTGAAAAAGATGCAGGTTTA
TTCTTTCCATCTTTCAATGGGAATTCCTATTTAGAACTGCCCTTTTTGAAGTTTGTCCTGGAGAAGGAACATAACAGAACTGTTACCATC
TACTTGACTATAAAAACAAACAGTTTAAATGGAACTATTCTTTACAGTAATGGGAATAATTGTGGAAAGCAGTTTCTTCATTTATTTCTT
GTGGAAGGAAGGCCATCAGTTAAATATGGGTGTGGAAATTCTCAAAATATTTTGACTGTTTCTGCTAATTACAGCATTAACACAAATGCA
TTCACCCCTATCACAATACGCTACACAACGCCTGTTGGCAGCCCTGGAGTTGTTTGTATGATTGAAATGACTGCAGATGGAAAACCTCCA
GTACAGAAGAAAGACACAGAGATTTCCCATGCCTCTCAGGCATATTTTGAATCAATGTTCCTTGGCCATATTCCTGCAAATGTTCAAATT
CATAAGAAAGCAGGTCCTGTTTATGGGTTCAGGGGCTGCATTCTAGACCTTCAAGTAAACAACAAAGAATTCTTCATCATCGATGAAGCA
CGACATGGAAAGAATATTGAGAACTGCCACGTCCCTTGGTGTGCTCATCATCTGTGCCGCAACAATGGCACCTGCATCAGTGATAATGAA
AATCTGTTTTGTGAGTGTCCAAGGCTGTATTCAGGCAAGCTGTGCCAGTTTGCAAGTTGTGAAAACAACCCATGTGGAAATGGTGCCACC
TGTGTTCCAAAATCCGGAACAGATATTGTCTGCCTCTGCCCATATGGGAGGTCTGGACCCCTCTGCACTGATGCTATTAATATTACTCAG
CCAAGGTTCAGTGGCACAGATGCCTTTGGATACACCTCATTCCTGGCTTATTCACGGATCTCAGACATCAGCTTCCATTATGAATTCCAC
CTGAAGTTTCAGCTGGCAAACAACCACTCAGCACTGCAAAATAACTTGATATTTTTTACTGGACAGAAAGGCCATGGGTTGAATGGCGAT
GACTTCCTGGCTGTGGGCCTGCTCAATGGCAGTGTGGTTTATAGTTATAACCTGGGGTCTGGCATAGCAAGCATCAGGAGCGAGCCCCTC
AATCTGAGCCTTGGAGTCCACACTGTTCATCTGGGCAAGTTCTTCCAAGAGGGCTGGCTGAAGGTAGATGATCATAAAAATAAATCCATT
ATCGCCCCAGGAAGACTGGTTGGTCTCAATGTCTTCAGTCAGTTTTATGTAGGTGGCTACAGTGAATACACTCCAGATCTCTTACCAAAT
GGAGCAGATTTTAAAAATGGTTTTCAAGGCTGTATTTTCACTCTTCAAGTTCGCACTGAGAAGGATGGCCATTTCAGAGGACTGGGAAAT
CCTGAGGGCCACCCAAATGCTGGACGCAGTGTTGGCCAGTGTCATGCTTCTCCCTGCAGTTTAATGAAATGTGGCAATGGTGGGACATGC
ATAGAGAGTGGAACTAGTGTTTACTGCAATTGTACCACTGGGTGGAAAGGATCATTCTGCACAGAGACAGTTTCTACCTGTGATCCTGAA
CATGACCCTCCACACCACTGTAGCAGAGGAGCAACCTGCATTTCATTACCTCATGGATACACCTGTTTCTGTCCTCTAGGAACCACTGGA
ATCTACTGTGAACAAGCTTTATCCATAAGTGATCCATCTTTCAGAAGCAATGAGTTATCCTGGATGTCTTTTGCTTCCTTTCATGTTCGA
AAAAAGACACATATTCAATTGCAGTTTCAGCCTCTCGCTGCAGATGGTATCCTATTTTATGCTGCACAACACTTAAAAGCCCAATCAGGT
GATTTTTTATGCATCTCTTTAGTAAATAGTTCCGTTCAACTTCGCTACAACCTTGGCGACAGAACTATCATTCTAGAAACTCTCCAAAAA
GTAACTATAAACGGAAGTACTTGGCATATAATAAAAGCAGGAAGAGTTGGTGCAGAAGGCTACCTGGATCTAGATGGGATAAATGTAACA
GAAAAGGCCTCCACTAAAATGAGTTCTCTGGACACAAATACAGACTTCTATATTGGAGGAGTATCTTCTTTAAATCTTGTAAATCCCATG
GCAATAGAAAATGAACCTGTAGGTTTTCAAGGCTGTATCCGACAAGTTATCATAAATAATCAAGAATTACAATTAACTGAATTTGGAGCA
AAAGGTGGCTCAAATGTAGGTGACTGTGATGGGACAGCCTGTGGGTACAACACATGCAGAAATGGAGGTGAATGTACAGTAAATGGCACA
ACTTTTTCTTGCAGATGTTTGCCAGATTGGGCTGGAAATACATGTAACCAGTCTGTGTCCTGTTTGAATAATCTTTGCCTCCACCAATCT
TTATGTATACCTGACCAATCATTTTCTTACAGTTGCCTGTGTACTTTGGGTTGGGTGGGAAGGTATTGTGAAAACAAAACTTCATTTTCA
ACTGCAAAATTTATGGGTAATTCTTACATTAAATACATTGATCCAAATTATAGAATGAGAAACCTCCAGTTCACTACTATATCCTTAAAT
TTCAGTACCACTAAAACAGAAGGTCTAATTGTATGGATGGGAATAGCTCAAAATGAAGAAAATGATTTTCTGGCAATTGGTCTCCATAAT
CAGACCTTGAAAATAGCAGTTAACTTGGGAGAAAGAATCTCTGTGCCTATGAGCTATAACAATGGCACATTCTGTTGTAATAAATGGCAC
CATGTAGTTGTAATTCAAAATCAGACTCTTATCAAGGCCTACATAAATAACAGTCTAATTCTTTCCGAGGATATTGATCCACATAAAAAC
TTTGTGGCTCTAAACTATGATGGCATTTGTTATCTAGGGGGCTTTGAATATGGTAGAAAGGTAAATATCGTTACTCAAGAGATTTTTAAA
ACCAATTTTGTTGGCAAAATTAAAGATGTTGTATTTTTTCAGGAACCAAAAAACATTGAACTAATTAAATTAGAAGGATACAATGTTTAT

>In-frame_LMBRD1_ENST00000370570_chr6_70490386_-_EYS_ENST00000370621_chr6_65767620_-_7563nt
ATGAAAAATCAAAATGGTACATTTAAGGACTGGGCTAATGCTAATGTCAGCAGACAGATTGAGGACACTGTATTATACGGTTACTATAGT
ACGCAATGTGAAATTGATATAGATGAGTGTGCTTCACATCCCTGCAAAAATGGAGCCACCTGCATTGACCAACCTGGTAATTACTTCTGC
CAGTGTGTGCCTCCATTTAAAGTGGTTGATGGCTTTTCCTGCTTATGCAATCCAGGCTATGTTGGGATAAGATGTGAACAGGACATTGAT
GACTGCATCCTGAATGCCTGTGAGCACAATTCTACCTGCAAAGACCTGCATCTCAGCTACCAGTGTGTGTGCCTATCTGATTGGGAAGGA
AATTTTTGTGAACAAGAATCCAATGAGTGTAAAATGAATCCTTGCAAGAACAATTCCACCTGTACTGACCTTTACAAAAGCTATCGATGT
GAGTGTACATCTGGATGGACTGGACAGAACTGTAGTGAAGAAATAAATGAATGCGACTCTGATCCATGCATGAATGGAGGTCTTTGTCAT
GAATCTACCATCCCTGGACAATTTGTATGTCTGTGCCCACCCCTTTATACTGGACAATTTTGCCACCAACGCTATAACCTTTGTGACCTA
CTTCATAACCCTTGCAGAAACAACTCAACATGCTTAGCTTTGGTAGACGCAAATCAGCATTGTATTTGTAGAGAAGAATTTGAAGGTAAA
AACTGTGAAATTGATGTGAAAGACTGCCTCTTCCTTTCCTGCCAGGATTATGGTGACTGTGAAGATATGGTCAACAATTTCAGGTGTATT
TGCAGACCTGGGTTTTCTGGATCTCTGTGTGAAATTGAAATTAATGAATGTTCCTCTGAACCTTGCAAAAATAATGGAACATGTGTGGAT
CTGACAAACAGATTTTTTTGTAATTGTGAACCTGAGTACCATGGGCCCTTCTGTGAACTTGATGTAAATAAATGTAAAATCTCACCTTGT
CTAGATGAAGAAAATTGTGTCTACAGGACTGATGGATACAACTGCCTCTGTGCCCCTGGTTATACAGGCATCAACTGTGAAATAAATCTA
GATGAATGCCTATCAGAGCCCTGTCTCCATGATGGAGTTTGTATCGATGGCATCAATCATTATACCTGTGACTGCAAGAGTGGGTTTTTT
GGAACACACTGTGAAACAAACGCCAATGATTGCCTTTCAAATCCTTGTCTACATGGAAGGTGCACAGAACTTATTAATGAATATCCATGT
TCATGTGATGCAGATGGGACTAGCACACAATGTAAGATCAAAATTAATGACTGCACATCAATCCCTTGTATGAATGAAGGCTTCTGTCAG
AAGTCAGCACATGGATTTACTTGCATTTGCCCACGTGGATACACTGGTGCATACTGTGAAAAAAGCATTGATAATTGTGCTGAGCCTGAA
CTTAATTCAGTCATCTGTCTTAATGGAGGGATCTGTGTTGATGGGCCTGGACATACTTTTGACTGCAGATGTCTTCCTGGATTTTCTGGT
CAATTTTGTGAAATTAATATAAATGAATGCTCTTCATCACCATGTCTACATGGTGCAGACTGTGAAGATCACATCAATGGATATGTTTGC
AAATGCCAACCAGGATGGTCTGGACACCACTGTGAGAATGAGCTTGAGTGCATTCCCAACTCATGTGTTCATGAACTCTGCATGGAGAAT
GAACCTGGCTCGACATGTTTATGCACACCTGGATTTATGACCTGCTCCATTGGGCTTCTTTGTGGTGATGAAATAAGGAGAATTACCTGT
TTAACTCCCATCTTTCAAAGAACAGATCCCATTTCCACACAGACATATACAATTCCCCCTTCTGAGACTTTGGTCAGCAGCTTTCCATCT
ATAAAGGCTACTAGAATACCAGCCATAATGGACACTTACCCAGTTGATCAAGGTCCAAAACAGACAGGCATTGTCAAGCACGACATTCTC
CCAACCACTGGTTTGGCAACATTAAGAATTAGCACACCCTTGGAAAGCTACTTACTCCAAGAACTGATTGTCACTAGAGAGCTTTCAGCA
AAACACAGTCTTCTTTCTTCCGCAGATGTTTCCTCTTCTCGATTCCTGAATTTTGGTATTCGTGACCCAGCACAAATTGTCCAGGACAAA
ACATCGGTATCACATATGCCTATTCGAACTTCAGCAGCCACACTAGGTTTCTTTTTTCCTGATAGGAGAGCAAGGACCCCATTTATCATG
TCTTCCTTAATGTCAGATTTTATTTTTCCTACACAATCTTTATTATTTGAGAACTGTCAGACTGTTGCTTTATCTGCTACCCCAACGACT
TCAGTAATTAGAAGCATTCCAGGGGCTGATATTGAGCTAAACAGGCAGTCATTACTCTCCCGTGGATTCCTGCTTATAGCTGCCTCCATA
AGTGCAACTCCAGTTGTCTCTAGGGGGGCTCAAGAGGATATTGAAGAATATTCAGCTGATTCTTTAATTTCAAGAAGAGAGCACTGGAGA
TTGCTCAGCCCCTCGATGTCTCCCATTTTTCCTGCTAAGGTAATTATATCTAAACAGGTAACCATCTTAAACTCATCAGCTCTGCACCGG
TTCAGTACAAAAGCCTTCAATCCCAGTGAATATCAGGCTATTACTGAGGCTTCAAGCAACCAGAGACTCACAAACATCAAATCACAGGCT
GCTGATTCTTTAAGAGAATTAAGCCAAACATGTGCAACATGTTCTATGACTGAAATAAAATCCTCTCGTGAATTCTCAGATCAAGTTTTG
CATAGCAAACAGTCCCACTTTTATGAGACATTCTGGATGAACTCAGCGATATTAGCCAGCTGGTATGCACTAATGGGAGCTCAAACTATC
ACTTCTGGGCATTCATTTTCTTCTGCTACTGAAATAACACCATCAGTGGCATTCACAGAAGTGCCATCTTTATTTCCTTCTAAAAAGAGT
GCAAAAAGAACAATTTTATCCTCATCCTTGGAAGAATCCATTACCCTATCAAGTAATTTGGATGTTAATTTATGTTTGGATAAGACTTGT
TTATCCATTGTCCCTTCACAAACTATCTCTTCAGACTTGATGAATTCTGATTTGACTTCAAAAATGACTACTGATGAACTGTCAGTATCA
GAAAACATTTTAAAACTATTGAAAATAAGACAATATGGCATAACTATGGGACCCACTGAGGTACTAAATCAAGAGAGCTTATTGGACATG
GAAAAAAGTAAAGGATCTCATACACTGTTCAAACTTCACCCAAGTGATAGTTCTCTGGATTTTGAGTTAAACTTACAAATTTATCCGGAT
GTTACTTTAAAGACATATTCAGAAATTACACATGCAAATGACTTCAAAAATAATCTGCCACCATTGACAGGCTCAGTGCCTGATTTTTCA
GAAGTCACCACCAATGTTGCATTTTATACAGTTTCAGCAACTCCAGCACTTTCAATACAGACGTCTTCCTCCATGTCTGTAATTAGGCCA
GATTGGCCATATTTTACAGATTATATGACCTCTCTTAAAAAAGAGGTCAAGACTTCTTCAGAATGGTCCAAATGGGAACTTCAGCCTAGT
GTGCAATATCAGGAATTTCCCACTGCAAGCCGGCATCTTCCCTTCACTAGATCTCTTACTTTGTCTTCACTGGAATCCATTCTGGCACCT
CAACGGCTGATGATTTCTGATTTCAGTTGTGTTCGTTATTATGGAGATTCTTATCTAGAATTTCAGAATGTGGCTTTAAATCCACAAAAT
AACATCTCCCTAGAATTTCAGACCTTCAGCTCCTATGGACTTCTGCTGTATGTCAAGCAAGACTCAAATTTAGTAGATGGATTTTTTATT
CAATTGTTTATTGAAAATGGTACTTTAAAGTACCACTTTTACTGTCCTGGTGAAGCAAAATTTAAAAGCATTAATACTACTGTTAGAGTG
GACAACGGGCAAAAGTATACACTGCTTATCAGGCAAGAATTGGATCCATGTAACGCTGAGCTGACTATTTTAGGGAGGAATACACAAATA
TGCGAATCTATCAATCATGTACTCGGAAAACCCCTGCCAAAATCAGGATCTGTCTTCATTGGTGGATTTCCAGACCTTCATGGGAAAATC
CAGATGCCTGTACCAGTCAAGAATTTTACTGGCTGCATAGAAGTTATAGAAATAAATAACTGGAGATCTTTCATTCCATCCAAGGCAGTG
AAAAACTATCACATTAACAATTGCAGATCCCAGGGATTTATGCTGTCTCCAACAGCCTCCTTTGTTGATGCTTCTGATGTGACACAAGGG
GTTGATACCATGTGGACTTCTGTCAGCCCCTCTGTTGCAGCACCCTCTGTGTGCCAGCAGGATGTATGCCACAATGGAGGCACATGCCAT
GCCATCTTCCTCTCCAGTGGCATAGTGTCATTCCAATGTGACTGTCCACTACATTTCACTGGCCGCTTCTGTGAAAAAGATGCAGGTTTA
TTCTTTCCATCTTTCAATGGGAATTCCTATTTAGAACTGCCCTTTTTGAAGTTTGTCCTGGAGAAGGAACATAACAGAACTGTTACCATC
TACTTGACTATAAAAACAAACAGTTTAAATGGAACTATTCTTTACAGTAATGGGAATAATTGTGGAAAGCAGTTTCTTCATTTATTTCTT
GTGGAAGGAAGGCCATCAGTTAAATATGGGTGTGGAAATTCTCAAAATATTTTGACTGTTTCTGCTAATTACAGCATTAACACAAATGCA
TTCACCCCTATCACAATACGCTACACAACGCCTGTTGGCAGCCCTGGAGTTGTTTGTATGATTGAAATGACTGCAGATGGAAAACCTCCA
GTACAGAAGAAAGACACAGAGATTTCCCATGCCTCTCAGGCATATTTTGAATCAATGTTCCTTGGCCATATTCCTGCAAATGTTCAAATT
CATAAGAAAGCAGGTCCTGTTTATGGGTTCAGGGGCTGCATTCTAGACCTTCAAGTAAACAACAAAGAATTCTTCATCATCGATGAAGCA
CGACATGGAAAGAATATTGAGAACTGCCACGTCCCTTGGTGTGCTCATCATCTGTGCCGCAACAATGGCACCTGCATCAGTGATAATGAA
AATCTGTTTTGTGAGTGTCCAAGGCTGTATTCAGGCAAGCTGTGCCAGTTTGCAAGTTGTGAAAACAACCCATGTGGAAATGGTGCCACC
TGTGTTCCAAAATCCGGAACAGATATTGTCTGCCTCTGCCCATATGGGAGGTCTGGACCCCTCTGCACTGATGCTATTAATATTACTCAG
CCAAGGTTCAGTGGCACAGATGCCTTTGGATACACCTCATTCCTGGCTTATTCACGGATCTCAGACATCAGCTTCCATTATGAATTCCAC
CTGAAGTTTCAGCTGGCAAACAACCACTCAGCACTGCAAAATAACTTGATATTTTTTACTGGACAGAAAGGCCATGGGTTGAATGGCGAT
GACTTCCTGGCTGTGGGCCTGCTCAATGGCAGTGTGGTTTATAGTTATAACCTGGGGTCTGGCATAGCAAGCATCAGGAGCGAGCCCCTC
AATCTGAGCCTTGGAGTCCACACTGTTCATCTGGGCAAGTTCTTCCAAGAGGGCTGGCTGAAGGTAGATGATCATAAAAATAAATCCATT
ATCGCCCCAGGAAGACTGGTTGGTCTCAATGTCTTCAGTCAGTTTTATGTAGGTGGCTACAGTGAATACACTCCAGATCTCTTACCAAAT
GGAGCAGATTTTAAAAATGGTTTTCAAGGCTGTATTTTCACTCTTCAAGTTCGCACTGAGAAGGATGGCCATTTCAGAGGACTGGGAAAT
CCTGAGGGCCACCCAAATGCTGGACGCAGTGTTGGCCAGTGTCATGCTTCTCCCTGCAGTTTAATGAAATGTGGCAATGGTGGGACATGC
ATAGAGAGTGGAACTAGTGTTTACTGCAATTGTACCACTGGGTGGAAAGGATCATTCTGCACAGAGACAGTTTCTACCTGTGATCCTGAA
CATGACCCTCCACACCACTGTAGCAGAGGAGCAACCTGCATTTCATTACCTCATGGATACACCTGTTTCTGTCCTCTAGGAACCACTGGA
ATCTACTGTGAACAAGCACTTATCCTCATTGTGATCTTGGAAAAGCCAAAACCAGCAGAACGGAAAGTGAAGAAGGAGGCTTTATCCATA
AGTGATCCATCTTTCAGAAGCAATGAGTTATCCTGGATGTCTTTTGCTTCCTTTCATGTTCGAAAAAAGACACATATTCAATTGCAGTTT
CAGCCTCTCGCTGCAGATGGTATCCTATTTTATGCTGCACAACACTTAAAAGCCCAATCAGGTGATTTTTTATGCATCTCTTTAGTAAAT
AGTTCCGTTCAACTTCGCTACAACCTTGGCGACAGAACTATCATTCTAGAAACTCTCCAAAAAGTAACTATAAACGGAAGTACTTGGCAT
ATAATAAAAGCAGGAAGAGTTGGTGCAGAAGGCTACCTGGATCTAGATGGGATAAATGTAACAGAAAAGGCCTCCACTAAAATGAGTTCT
CTGGACACAAATACAGACTTCTATATTGGAGGAGTATCTTCTTTAAATCTTGTAAATCCCATGGCAATAGAAAATGAACCTGTAGGTTTT
CAAGGCTGTATCCGACAAGTTATCATAAATAATCAAGAATTACAATTAACTGAATTTGGAGCAAAAGGTGGCTCAAATGTAGGTGACTGT
GATGGGACAGCCTGTGGGTACAACACATGCAGAAATGGAGGTGAATGTACAGTAAATGGCACAACTTTTTCTTGCAGATGTTTGCCAGAT
TGGGCTGGAAATACATGTAACCAGTCTGTGTCCTGTTTGAATAATCTTTGCCTCCACCAATCTTTATGTATACCTGACCAATCATTTTCT
TACAGTTGCCTGTGTACTTTGGGTTGGGTGGGAAGGTATTGTGAAAACAAAACTTCATTTTCAACTGCAAAATTTATGGGTAATTCTTAC
ATTAAATACATTGATCCAAATTATAGAATGAGAAACCTCCAGTTCACTACTATATCCTTAAATTTCAGTACCACTAAAACAGAAGGTCTA
ATTGTATGGATGGGAATAGCTCAAAATGAAGAAAATGATTTTCTGGCAATTGGTCTCCATAATCAGACCTTGAAAATAGCAGTTAACTTG
GGAGAAAGAATCTCTGTGCCTATGAGCTATAACAATGGCACATTCTGTTGTAATAAATGGCACCATGTAGTTGTAATTCAAAATCAGACT
CTTATCAAGGCCTACATAAATAACAGTCTAATTCTTTCCGAGGATATTGATCCACATAAAAACTTTGTGGCTCTAAACTATGATGGCATT
TGTTATCTAGGGGGCTTTGAATATGGTAGAAAGGTAAATATCGTTACTCAAGAGATTTTTAAAACCAATTTTGTTGGCAAAATTAAAGAT
GTTGTATTTTTTCAGGAACCAAAAAACATTGAACTAATTAAATTAGAAGGATACAATGTTTATGATGGAGATGAACAAAATGAGGTTACA

>In-frame_LMBRD1_ENST00000370570_chr6_70490386_-_EYS_ENST00000370616_chr6_65767620_-_7563nt
ATGAAAAATCAAAATGGTACATTTAAGGACTGGGCTAATGCTAATGTCAGCAGACAGATTGAGGACACTGTATTATACGGTTACTATAGT
ACGCAATGTGAAATTGATATAGATGAGTGTGCTTCACATCCCTGCAAAAATGGAGCCACCTGCATTGACCAACCTGGTAATTACTTCTGC
CAGTGTGTGCCTCCATTTAAAGTGGTTGATGGCTTTTCCTGCTTATGCAATCCAGGCTATGTTGGGATAAGATGTGAACAGGACATTGAT
GACTGCATCCTGAATGCCTGTGAGCACAATTCTACCTGCAAAGACCTGCATCTCAGCTACCAGTGTGTGTGCCTATCTGATTGGGAAGGA
AATTTTTGTGAACAAGAATCCAATGAGTGTAAAATGAATCCTTGCAAGAACAATTCCACCTGTACTGACCTTTACAAAAGCTATCGATGT
GAGTGTACATCTGGATGGACTGGACAGAACTGTAGTGAAGAAATAAATGAATGCGACTCTGATCCATGCATGAATGGAGGTCTTTGTCAT
GAATCTACCATCCCTGGACAATTTGTATGTCTGTGCCCACCCCTTTATACTGGACAATTTTGCCACCAACGCTATAACCTTTGTGACCTA
CTTCATAACCCTTGCAGAAACAACTCAACATGCTTAGCTTTGGTAGACGCAAATCAGCATTGTATTTGTAGAGAAGAATTTGAAGGTAAA
AACTGTGAAATTGATGTGAAAGACTGCCTCTTCCTTTCCTGCCAGGATTATGGTGACTGTGAAGATATGGTCAACAATTTCAGGTGTATT
TGCAGACCTGGGTTTTCTGGATCTCTGTGTGAAATTGAAATTAATGAATGTTCCTCTGAACCTTGCAAAAATAATGGAACATGTGTGGAT
CTGACAAACAGATTTTTTTGTAATTGTGAACCTGAGTACCATGGGCCCTTCTGTGAACTTGATGTAAATAAATGTAAAATCTCACCTTGT
CTAGATGAAGAAAATTGTGTCTACAGGACTGATGGATACAACTGCCTCTGTGCCCCTGGTTATACAGGCATCAACTGTGAAATAAATCTA
GATGAATGCCTATCAGAGCCCTGTCTCCATGATGGAGTTTGTATCGATGGCATCAATCATTATACCTGTGACTGCAAGAGTGGGTTTTTT
GGAACACACTGTGAAACAAACGCCAATGATTGCCTTTCAAATCCTTGTCTACATGGAAGGTGCACAGAACTTATTAATGAATATCCATGT
TCATGTGATGCAGATGGGACTAGCACACAATGTAAGATCAAAATTAATGACTGCACATCAATCCCTTGTATGAATGAAGGCTTCTGTCAG
AAGTCAGCACATGGATTTACTTGCATTTGCCCACGTGGATACACTGGTGCATACTGTGAAAAAAGCATTGATAATTGTGCTGAGCCTGAA
CTTAATTCAGTCATCTGTCTTAATGGAGGGATCTGTGTTGATGGGCCTGGACATACTTTTGACTGCAGATGTCTTCCTGGATTTTCTGGT
CAATTTTGTGAAATTAATATAAATGAATGCTCTTCATCACCATGTCTACATGGTGCAGACTGTGAAGATCACATCAATGGATATGTTTGC
AAATGCCAACCAGGATGGTCTGGACACCACTGTGAGAATGAGCTTGAGTGCATTCCCAACTCATGTGTTCATGAACTCTGCATGGAGAAT
GAACCTGGCTCGACATGTTTATGCACACCTGGATTTATGACCTGCTCCATTGGGCTTCTTTGTGGTGATGAAATAAGGAGAATTACCTGT
TTAACTCCCATCTTTCAAAGAACAGATCCCATTTCCACACAGACATATACAATTCCCCCTTCTGAGACTTTGGTCAGCAGCTTTCCATCT
ATAAAGGCTACTAGAATACCAGCCATAATGGACACTTACCCAGTTGATCAAGGTCCAAAACAGACAGGCATTGTCAAGCACGACATTCTC
CCAACCACTGGTTTGGCAACATTAAGAATTAGCACACCCTTGGAAAGCTACTTACTCCAAGAACTGATTGTCACTAGAGAGCTTTCAGCA
AAACACAGTCTTCTTTCTTCCGCAGATGTTTCCTCTTCTCGATTCCTGAATTTTGGTATTCGTGACCCAGCACAAATTGTCCAGGACAAA
ACATCGGTATCACATATGCCTATTCGAACTTCAGCAGCCACACTAGGTTTCTTTTTTCCTGATAGGAGAGCAAGGACCCCATTTATCATG
TCTTCCTTAATGTCAGATTTTATTTTTCCTACACAATCTTTATTATTTGAGAACTGTCAGACTGTTGCTTTATCTGCTACCCCAACGACT
TCAGTAATTAGAAGCATTCCAGGGGCTGATATTGAGCTAAACAGGCAGTCATTACTCTCCCGTGGATTCCTGCTTATAGCTGCCTCCATA
AGTGCAACTCCAGTTGTCTCTAGGGGGGCTCAAGAGGATATTGAAGAATATTCAGCTGATTCTTTAATTTCAAGAAGAGAGCACTGGAGA
TTGCTCAGCCCCTCGATGTCTCCCATTTTTCCTGCTAAGGTAATTATATCTAAACAGGTAACCATCTTAAACTCATCAGCTCTGCACCGG
TTCAGTACAAAAGCCTTCAATCCCAGTGAATATCAGGCTATTACTGAGGCTTCAAGCAACCAGAGACTCACAAACATCAAATCACAGGCT
GCTGATTCTTTAAGAGAATTAAGCCAAACATGTGCAACATGTTCTATGACTGAAATAAAATCCTCTCGTGAATTCTCAGATCAAGTTTTG
CATAGCAAACAGTCCCACTTTTATGAGACATTCTGGATGAACTCAGCGATATTAGCCAGCTGGTATGCACTAATGGGAGCTCAAACTATC
ACTTCTGGGCATTCATTTTCTTCTGCTACTGAAATAACACCATCAGTGGCATTCACAGAAGTGCCATCTTTATTTCCTTCTAAAAAGAGT
GCAAAAAGAACAATTTTATCCTCATCCTTGGAAGAATCCATTACCCTATCAAGTAATTTGGATGTTAATTTATGTTTGGATAAGACTTGT
TTATCCATTGTCCCTTCACAAACTATCTCTTCAGACTTGATGAATTCTGATTTGACTTCAAAAATGACTACTGATGAACTGTCAGTATCA
GAAAACATTTTAAAACTATTGAAAATAAGACAATATGGCATAACTATGGGACCCACTGAGGTACTAAATCAAGAGAGCTTATTGGACATG
GAAAAAAGTAAAGGATCTCATACACTGTTCAAACTTCACCCAAGTGATAGTTCTCTGGATTTTGAGTTAAACTTACAAATTTATCCGGAT
GTTACTTTAAAGACATATTCAGAAATTACACATGCAAATGACTTCAAAAATAATCTGCCACCATTGACAGGCTCAGTGCCTGATTTTTCA
GAAGTCACCACCAATGTTGCATTTTATACAGTTTCAGCAACTCCAGCACTTTCAATACAGACGTCTTCCTCCATGTCTGTAATTAGGCCA
GATTGGCCATATTTTACAGATTATATGACCTCTCTTAAAAAAGAGGTCAAGACTTCTTCAGAATGGTCCAAATGGGAACTTCAGCCTAGT
GTGCAATATCAGGAATTTCCCACTGCAAGCCGGCATCTTCCCTTCACTAGATCTCTTACTTTGTCTTCACTGGAATCCATTCTGGCACCT
CAACGGCTGATGATTTCTGATTTCAGTTGTGTTCGTTATTATGGAGATTCTTATCTAGAATTTCAGAATGTGGCTTTAAATCCACAAAAT
AACATCTCCCTAGAATTTCAGACCTTCAGCTCCTATGGACTTCTGCTGTATGTCAAGCAAGACTCAAATTTAGTAGATGGATTTTTTATT
CAATTGTTTATTGAAAATGGTACTTTAAAGTACCACTTTTACTGTCCTGGTGAAGCAAAATTTAAAAGCATTAATACTACTGTTAGAGTG
GACAACGGGCAAAAGTATACACTGCTTATCAGGCAAGAATTGGATCCATGTAACGCTGAGCTGACTATTTTAGGGAGGAATACACAAATA
TGCGAATCTATCAATCATGTACTCGGAAAACCCCTGCCAAAATCAGGATCTGTCTTCATTGGTGGATTTCCAGACCTTCATGGGAAAATC
CAGATGCCTGTACCAGTCAAGAATTTTACTGGCTGCATAGAAGTTATAGAAATAAATAACTGGAGATCTTTCATTCCATCCAAGGCAGTG
AAAAACTATCACATTAACAATTGCAGATCCCAGGGATTTATGCTGTCTCCAACAGCCTCCTTTGTTGATGCTTCTGATGTGACACAAGGG
GTTGATACCATGTGGACTTCTGTCAGCCCCTCTGTTGCAGCACCCTCTGTGTGCCAGCAGGATGTATGCCACAATGGAGGCACATGCCAT
GCCATCTTCCTCTCCAGTGGCATAGTGTCATTCCAATGTGACTGTCCACTACATTTCACTGGCCGCTTCTGTGAAAAAGATGCAGGTTTA
TTCTTTCCATCTTTCAATGGGAATTCCTATTTAGAACTGCCCTTTTTGAAGTTTGTCCTGGAGAAGGAACATAACAGAACTGTTACCATC
TACTTGACTATAAAAACAAACAGTTTAAATGGAACTATTCTTTACAGTAATGGGAATAATTGTGGAAAGCAGTTTCTTCATTTATTTCTT
GTGGAAGGAAGGCCATCAGTTAAATATGGGTGTGGAAATTCTCAAAATATTTTGACTGTTTCTGCTAATTACAGCATTAACACAAATGCA
TTCACCCCTATCACAATACGCTACACAACGCCTGTTGGCAGCCCTGGAGTTGTTTGTATGATTGAAATGACTGCAGATGGAAAACCTCCA
GTACAGAAGAAAGACACAGAGATTTCCCATGCCTCTCAGGCATATTTTGAATCAATGTTCCTTGGCCATATTCCTGCAAATGTTCAAATT
CATAAGAAAGCAGGTCCTGTTTATGGGTTCAGGGGCTGCATTCTAGACCTTCAAGTAAACAACAAAGAATTCTTCATCATCGATGAAGCA
CGACATGGAAAGAATATTGAGAACTGCCACGTCCCTTGGTGTGCTCATCATCTGTGCCGCAACAATGGCACCTGCATCAGTGATAATGAA
AATCTGTTTTGTGAGTGTCCAAGGCTGTATTCAGGCAAGCTGTGCCAGTTTGCAAGTTGTGAAAACAACCCATGTGGAAATGGTGCCACC
TGTGTTCCAAAATCCGGAACAGATATTGTCTGCCTCTGCCCATATGGGAGGTCTGGACCCCTCTGCACTGATGCTATTAATATTACTCAG
CCAAGGTTCAGTGGCACAGATGCCTTTGGATACACCTCATTCCTGGCTTATTCACGGATCTCAGACATCAGCTTCCATTATGAATTCCAC
CTGAAGTTTCAGCTGGCAAACAACCACTCAGCACTGCAAAATAACTTGATATTTTTTACTGGACAGAAAGGCCATGGGTTGAATGGCGAT
GACTTCCTGGCTGTGGGCCTGCTCAATGGCAGTGTGGTTTATAGTTATAACCTGGGGTCTGGCATAGCAAGCATCAGGAGCGAGCCCCTC
AATCTGAGCCTTGGAGTCCACACTGTTCATCTGGGCAAGTTCTTCCAAGAGGGCTGGCTGAAGGTAGATGATCATAAAAATAAATCCATT
ATCGCCCCAGGAAGACTGGTTGGTCTCAATGTCTTCAGTCAGTTTTATGTAGGTGGCTACAGTGAATACACTCCAGATCTCTTACCAAAT
GGAGCAGATTTTAAAAATGGTTTTCAAGGCTGTATTTTCACTCTTCAAGTTCGCACTGAGAAGGATGGCCATTTCAGAGGACTGGGAAAT
CCTGAGGGCCACCCAAATGCTGGACGCAGTGTTGGCCAGTGTCATGCTTCTCCCTGCAGTTTAATGAAATGTGGCAATGGTGGGACATGC
ATAGAGAGTGGAACTAGTGTTTACTGCAATTGTACCACTGGGTGGAAAGGATCATTCTGCACAGAGACAGTTTCTACCTGTGATCCTGAA
CATGACCCTCCACACCACTGTAGCAGAGGAGCAACCTGCATTTCATTACCTCATGGATACACCTGTTTCTGTCCTCTAGGAACCACTGGA
ATCTACTGTGAACAAGCACTTATCCTCATTGTGATCTTGGAAAAGCCAAAACCAGCAGAACGGAAAGTGAAGAAGGAGGCTTTATCCATA
AGTGATCCATCTTTCAGAAGCAATGAGTTATCCTGGATGTCTTTTGCTTCCTTTCATGTTCGAAAAAAGACACATATTCAATTGCAGTTT
CAGCCTCTCGCTGCAGATGGTATCCTATTTTATGCTGCACAACACTTAAAAGCCCAATCAGGTGATTTTTTATGCATCTCTTTAGTAAAT
AGTTCCGTTCAACTTCGCTACAACCTTGGCGACAGAACTATCATTCTAGAAACTCTCCAAAAAGTAACTATAAACGGAAGTACTTGGCAT
ATAATAAAAGCAGGAAGAGTTGGTGCAGAAGGCTACCTGGATCTAGATGGGATAAATGTAACAGAAAAGGCCTCCACTAAAATGAGTTCT
CTGGACACAAATACAGACTTCTATATTGGAGGAGTATCTTCTTTAAATCTTGTAAATCCCATGGCAATAGAAAATGAACCTGTAGGTTTT
CAAGGCTGTATCCGACAAGTTATCATAAATAATCAAGAATTACAATTAACTGAATTTGGAGCAAAAGGTGGCTCAAATGTAGGTGACTGT
GATGGGACAGCCTGTGGGTACAACACATGCAGAAATGGAGGTGAATGTACAGTAAATGGCACAACTTTTTCTTGCAGATGTTTGCCAGAT
TGGGCTGGAAATACATGTAACCAGTCTGTGTCCTGTTTGAATAATCTTTGCCTCCACCAATCTTTATGTATACCTGACCAATCATTTTCT
TACAGTTGCCTGTGTACTTTGGGTTGGGTGGGAAGGTATTGTGAAAACAAAACTTCATTTTCAACTGCAAAATTTATGGGTAATTCTTAC
ATTAAATACATTGATCCAAATTATAGAATGAGAAACCTCCAGTTCACTACTATATCCTTAAATTTCAGTACCACTAAAACAGAAGGTCTA
ATTGTATGGATGGGAATAGCTCAAAATGAAGAAAATGATTTTCTGGCAATTGGTCTCCATAATCAGACCTTGAAAATAGCAGTTAACTTG
GGAGAAAGAATCTCTGTGCCTATGAGCTATAACAATGGCACATTCTGTTGTAATAAATGGCACCATGTAGTTGTAATTCAAAATCAGACT
CTTATCAAGGCCTACATAAATAACAGTCTAATTCTTTCCGAGGATATTGATCCACATAAAAACTTTGTGGCTCTAAACTATGATGGCATT
TGTTATCTAGGGGGCTTTGAATATGGTAGAAAGGTAAATATCGTTACTCAAGAGATTTTTAAAACCAATTTTGTTGGCAAAATTAAAGAT
GTTGTATTTTTTCAGGAACCAAAAAACATTGAACTAATTAAATTAGAAGGATACAATGTTTATGATGGAGATGAACAAAATGAGGTTACA


* Fusion transcript sequences (Full-length transcript).
>In-frame_LMBRD1_ENST00000370577_chr6_70490386_-_EYS_ENST00000503581_chr6_65767620_-_8565nt
ACTGCGTCCGCACGCGCCCCGCCCCTGAGCAGTCCTTGCTGCCCCGCCCCCGCTCGGCTCGCCGCCAGGGGACGCTAGTGGGTCCAGTCT
CCTTGGCAACCACTTGCTCCTCCCCCTCCGCCCCTTTAACCTTTAGGGTGCGCGGGTGCAGTATATCTCGCGCTCTCTCCCCTTTCCCCC
TCCCCTTTCCCCACCCCGGGCGCTCAGGTTGGTCTGGACCGGAAGCGAAGATGGCGACTTCTGGCGCGGCCTCGGCGGAGCTGGTGATCG
GCTGGTGCATATTCGGCCTCTTACTACTGGCTATTTTGGCATTCTGCTGGATATATGTTCGTAAATACCAAAGTCGGCGGGAAAGTGAAG
TTGTCTCCACCATAACAGCAATTTTTTCTCTAGCAATTGCACTTATCACATCAGCACTTCTACCAGTGGATATATTTTTGGTTTCTTACA
TGAAAAATCAAAATGGTACATTTAAGGACTGGGCTAATGCTAATGTCAGCAGACAGATTGAGGACACTGTATTATACGGTTACTATAGTA
CGCAATGTGAAATTGATATAGATGAGTGTGCTTCACATCCCTGCAAAAATGGAGCCACCTGCATTGACCAACCTGGTAATTACTTCTGCC
AGTGTGTGCCTCCATTTAAAGTGGTTGATGGCTTTTCCTGCTTATGCAATCCAGGCTATGTTGGGATAAGATGTGAACAGGACATTGATG
ACTGCATCCTGAATGCCTGTGAGCACAATTCTACCTGCAAAGACCTGCATCTCAGCTACCAGTGTGTGTGCCTATCTGATTGGGAAGGAA
ATTTTTGTGAACAAGAATCCAATGAGTGTAAAATGAATCCTTGCAAGAACAATTCCACCTGTACTGACCTTTACAAAAGCTATCGATGTG
AGTGTACATCTGGATGGACTGGACAGAACTGTAGTGAAGAAATAAATGAATGCGACTCTGATCCATGCATGAATGGAGGTCTTTGTCATG
AATCTACCATCCCTGGACAATTTGTATGTCTGTGCCCACCCCTTTATACTGGACAATTTTGCCACCAACGCTATAACCTTTGTGACCTAC
TTCATAACCCTTGCAGAAACAACTCAACATGCTTAGCTTTGGTAGACGCAAATCAGCATTGTATTTGTAGAGAAGAATTTGAAGGTAAAA
ACTGTGAAATTGATGTGAAAGACTGCCTCTTCCTTTCCTGCCAGGATTATGGTGACTGTGAAGATATGGTCAACAATTTCAGGTGTATTT
GCAGACCTGGGTTTTCTGGATCTCTGTGTGAAATTGAAATTAATGAATGTTCCTCTGAACCTTGCAAAAATAATGGAACATGTGTGGATC
TGACAAACAGATTTTTTTGTAATTGTGAACCTGAGTACCATGGGCCCTTCTGTGAACTTGATGTAAATAAATGTAAAATCTCACCTTGTC
TAGATGAAGAAAATTGTGTCTACAGGACTGATGGATACAACTGCCTCTGTGCCCCTGGTTATACAGGCATCAACTGTGAAATAAATCTAG
ATGAATGCCTATCAGAGCCCTGTCTCCATGATGGAGTTTGTATCGATGGCATCAATCATTATACCTGTGACTGCAAGAGTGGGTTTTTTG
GAACACACTGTGAAACAAACGCCAATGATTGCCTTTCAAATCCTTGTCTACATGGAAGGTGCACAGAACTTATTAATGAATATCCATGTT
CATGTGATGCAGATGGGACTAGCACACAATGTAAGATCAAAATTAATGACTGCACATCAATCCCTTGTATGAATGAAGGCTTCTGTCAGA
AGTCAGCACATGGATTTACTTGCATTTGCCCACGTGGATACACTGGTGCATACTGTGAAAAAAGCATTGATAATTGTGCTGAGCCTGAAC
TTAATTCAGTCATCTGTCTTAATGGAGGGATCTGTGTTGATGGGCCTGGACATACTTTTGACTGCAGATGTCTTCCTGGATTTTCTGGTC
AATTTTGTGAAATTAATATAAATGAATGCTCTTCATCACCATGTCTACATGGTGCAGACTGTGAAGATCACATCAATGGATATGTTTGCA
AATGCCAACCAGGATGGTCTGGACACCACTGTGAGAATGAGCTTGAGTGCATTCCCAACTCATGTGTTCATGAACTCTGCATGGAGAATG
AACCTGGCTCGACATGTTTATGCACACCTGGATTTATGACCTGCTCCATTGGGCTTCTTTGTGGTGATGAAATAAGGAGAATTACCTGTT
TAACTCCCATCTTTCAAAGAACAGATCCCATTTCCACACAGACATATACAATTCCCCCTTCTGAGACTTTGGTCAGCAGCTTTCCATCTA
TAAAGGCTACTAGAATACCAGCCATAATGGACACTTACCCAGTTGATCAAGGTCCAAAACAGACAGGCATTGTCAAGCACGACATTCTCC
CAACCACTGGTTTGGCAACATTAAGAATTAGCACACCCTTGGAAAGCTACTTACTCCAAGAACTGATTGTCACTAGAGAGCTTTCAGCAA
AACACAGTCTTCTTTCTTCCGCAGATGTTTCCTCTTCTCGATTCCTGAATTTTGGTATTCGTGACCCAGCACAAATTGTCCAGGACAAAA
CATCGGTATCACATATGCCTATTCGAACTTCAGCAGCCACACTAGGTTTCTTTTTTCCTGATAGGAGAGCAAGGACCCCATTTATCATGT
CTTCCTTAATGTCAGATTTTATTTTTCCTACACAATCTTTATTATTTGAGAACTGTCAGACTGTTGCTTTATCTGCTACCCCAACGACTT
CAGTAATTAGAAGCATTCCAGGGGCTGATATTGAGCTAAACAGGCAGTCATTACTCTCCCGTGGATTCCTGCTTATAGCTGCCTCCATAA
GTGCAACTCCAGTTGTCTCTAGGGGGGCTCAAGAGGATATTGAAGAATATTCAGCTGATTCTTTAATTTCAAGAAGAGAGCACTGGAGAT
TGCTCAGCCCCTCGATGTCTCCCATTTTTCCTGCTAAGGTAATTATATCTAAACAGGTAACCATCTTAAACTCATCAGCTCTGCACCGGT
TCAGTACAAAAGCCTTCAATCCCAGTGAATATCAGGCTATTACTGAGGCTTCAAGCAACCAGAGACTCACAAACATCAAATCACAGGCTG
CTGATTCTTTAAGAGAATTAAGCCAAACATGTGCAACATGTTCTATGACTGAAATAAAATCCTCTCGTGAATTCTCAGATCAAGTTTTGC
ATAGCAAACAGTCCCACTTTTATGAGACATTCTGGATGAACTCAGCGATATTAGCCAGCTGGTATGCACTAATGGGAGCTCAAACTATCA
CTTCTGGGCATTCATTTTCTTCTGCTACTGAAATAACACCATCAGTGGCATTCACAGAAGTGCCATCTTTATTTCCTTCTAAAAAGAGTG
CAAAAAGAACAATTTTATCCTCATCCTTGGAAGAATCCATTACCCTATCAAGTAATTTGGATGTTAATTTATGTTTGGATAAGACTTGTT
TATCCATTGTCCCTTCACAAACTATCTCTTCAGACTTGATGAATTCTGATTTGACTTCAAAAATGACTACTGATGAACTGTCAGTATCAG
AAAACATTTTAAAACTATTGAAAATAAGACAATATGGCATAACTATGGGACCCACTGAGGTACTAAATCAAGAGAGCTTATTGGACATGG
AAAAAAGTAAAGGATCTCATACACTGTTCAAACTTCACCCAAGTGATAGTTCTCTGGATTTTGAGTTAAACTTACAAATTTATCCGGATG
TTACTTTAAAGACATATTCAGAAATTACACATGCAAATGACTTCAAAAATAATCTGCCACCATTGACAGGCTCAGTGCCTGATTTTTCAG
AAGTCACCACCAATGTTGCATTTTATACAGTTTCAGCAACTCCAGCACTTTCAATACAGACGTCTTCCTCCATGTCTGTAATTAGGCCAG
ATTGGCCATATTTTACAGATTATATGACCTCTCTTAAAAAAGAGGTCAAGACTTCTTCAGAATGGTCCAAATGGGAACTTCAGCCTAGTG
TGCAATATCAGGAATTTCCCACTGCAAGCCGGCATCTTCCCTTCACTAGATCTCTTACTTTGTCTTCACTGGAATCCATTCTGGCACCTC
AACGGCTGATGATTTCTGATTTCAGTTGTGTTCGTTATTATGGAGATTCTTATCTAGAATTTCAGAATGTGGCTTTAAATCCACAAAATA
ACATCTCCCTAGAATTTCAGACCTTCAGCTCCTATGGACTTCTGCTGTATGTCAAGCAAGACTCAAATTTAGTAGATGGATTTTTTATTC
AATTGTTTATTGAAAATGGTACTTTAAAGTACCACTTTTACTGTCCTGGTGAAGCAAAATTTAAAAGCATTAATACTACTGTTAGAGTGG
ACAACGGGCAAAAGTATACACTGCTTATCAGGCAAGAATTGGATCCATGTAACGCTGAGCTGACTATTTTAGGGAGGAATACACAAATAT
GCGAATCTATCAATCATGTACTCGGAAAACCCCTGCCAAAATCAGGATCTGTCTTCATTGGTGGATTTCCAGACCTTCATGGGAAAATCC
AGATGCCTGTACCAGTCAAGAATTTTACTGGCTGCATAGAAGTTATAGAAATAAATAACTGGAGATCTTTCATTCCATCCAAGGCAGTGA
AAAACTATCACATTAACAATTGCAGATCCCAGGGATTTATGCTGTCTCCAACAGCCTCCTTTGTTGATGCTTCTGATGTGACACAAGGGG
TTGATACCATGTGGACTTCTGTCAGCCCCTCTGTTGCAGCACCCTCTGTGTGCCAGCAGGATGTATGCCACAATGGAGGCACATGCCATG
CCATCTTCCTCTCCAGTGGCATAGTGTCATTCCAATGTGACTGTCCACTACATTTCACTGGCCGCTTCTGTGAAAAAGATGCAGGTTTAT
TCTTTCCATCTTTCAATGGGAATTCCTATTTAGAACTGCCCTTTTTGAAGTTTGTCCTGGAGAAGGAACATAACAGAACTGTTACCATCT
ACTTGACTATAAAAACAAACAGTTTAAATGGAACTATTCTTTACAGTAATGGGAATAATTGTGGAAAGCAGTTTCTTCATTTATTTCTTG
TGGAAGGAAGGCCATCAGTTAAATATGGGTGTGGAAATTCTCAAAATATTTTGACTGTTTCTGCTAATTACAGCATTAACACAAATGCAT
TCACCCCTATCACAATACGCTACACAACGCCTGTTGGCAGCCCTGGAGTTGTTTGTATGATTGAAATGACTGCAGATGGAAAACCTCCAG
TACAGAAGAAAGACACAGAGATTTCCCATGCCTCTCAGGCATATTTTGAATCAATGTTCCTTGGCCATATTCCTGCAAATGTTCAAATTC
ATAAGAAAGCAGGTCCTGTTTATGGGTTCAGGGGCTGCATTCTAGACCTTCAAGTAAACAACAAAGAATTCTTCATCATCGATGAAGCAC
GACATGGAAAGAATATTGAGAACTGCCACGTCCCTTGGTGTGCTCATCATCTGTGCCGCAACAATGGCACCTGCATCAGTGATAATGAAA
ATCTGTTTTGTGAGTGTCCAAGGCTGTATTCAGGCAAGCTGTGCCAGTTTGCAAGTTGTGAAAACAACCCATGTGGAAATGGTGCCACCT
GTGTTCCAAAATCCGGAACAGATATTGTCTGCCTCTGCCCATATGGGAGGTCTGGACCCCTCTGCACTGATGCTATTAATATTACTCAGC
CAAGGTTCAGTGGCACAGATGCCTTTGGATACACCTCATTCCTGGCTTATTCACGGATCTCAGACATCAGCTTCCATTATGAATTCCACC
TGAAGTTTCAGCTGGCAAACAACCACTCAGCACTGCAAAATAACTTGATATTTTTTACTGGACAGAAAGGCCATGGGTTGAATGGCGATG
ACTTCCTGGCTGTGGGCCTGCTCAATGGCAGTGTGGTTTATAGTTATAACCTGGGGTCTGGCATAGCAAGCATCAGGAGCGAGCCCCTCA
ATCTGAGCCTTGGAGTCCACACTGTTCATCTGGGCAAGTTCTTCCAAGAGGGCTGGCTGAAGGTAGATGATCATAAAAATAAATCCATTA
TCGCCCCAGGAAGACTGGTTGGTCTCAATGTCTTCAGTCAGTTTTATGTAGGTGGCTACAGTGAATACACTCCAGATCTCTTACCAAATG
GAGCAGATTTTAAAAATGGTTTTCAAGGCTGTATTTTCACTCTTCAAGTTCGCACTGAGAAGGATGGCCATTTCAGAGGACTGGGAAATC
CTGAGGGCCACCCAAATGCTGGACGCAGTGTTGGCCAGTGTCATGCTTCTCCCTGCAGTTTAATGAAATGTGGCAATGGTGGGACATGCA
TAGAGAGTGGAACTAGTGTTTACTGCAATTGTACCACTGGGTGGAAAGGATCATTCTGCACAGAGACAGTTTCTACCTGTGATCCTGAAC
ATGACCCTCCACACCACTGTAGCAGAGGAGCAACCTGCATTTCATTACCTCATGGATACACCTGTTTCTGTCCTCTAGGAACCACTGGAA
TCTACTGTGAACAAGCTTTATCCATAAGTGATCCATCTTTCAGAAGCAATGAGTTATCCTGGATGTCTTTTGCTTCCTTTCATGTTCGAA
AAAAGACACATATTCAATTGCAGTTTCAGCCTCTCGCTGCAGATGGTATCCTATTTTATGCTGCACAACACTTAAAAGCCCAATCAGGTG
ATTTTTTATGCATCTCTTTAGTAAATAGTTCCGTTCAACTTCGCTACAACCTTGGCGACAGAACTATCATTCTAGAAACTCTCCAAAAAG
TAACTATAAACGGAAGTACTTGGCATATAATAAAAGCAGGAAGAGTTGGTGCAGAAGGCTACCTGGATCTAGATGGGATAAATGTAACAG
AAAAGGCCTCCACTAAAATGAGTTCTCTGGACACAAATACAGACTTCTATATTGGAGGAGTATCTTCTTTAAATCTTGTAAATCCCATGG
CAATAGAAAATGAACCTGTAGGTTTTCAAGGCTGTATCCGACAAGTTATCATAAATAATCAAGAATTACAATTAACTGAATTTGGAGCAA
AAGGTGGCTCAAATGTAGGTGACTGTGATGGGACAGCCTGTGGGTACAACACATGCAGAAATGGAGGTGAATGTACAGTAAATGGCACAA
CTTTTTCTTGCAGATGTTTGCCAGATTGGGCTGGAAATACATGTAACCAGTCTGTGTCCTGTTTGAATAATCTTTGCCTCCACCAATCTT
TATGTATACCTGACCAATCATTTTCTTACAGTTGCCTGTGTACTTTGGGTTGGGTGGGAAGGTATTGTGAAAACAAAACTTCATTTTCAA
CTGCAAAATTTATGGGTAATTCTTACATTAAATACATTGATCCAAATTATAGAATGAGAAACCTCCAGTTCACTACTATATCCTTAAATT
TCAGTACCACTAAAACAGAAGGTCTAATTGTATGGATGGGAATAGCTCAAAATGAAGAAAATGATTTTCTGGCAATTGGTCTCCATAATC
AGACCTTGAAAATAGCAGTTAACTTGGGAGAAAGAATCTCTGTGCCTATGAGCTATAACAATGGCACATTCTGTTGTAATAAATGGCACC
ATGTAGTTGTAATTCAAAATCAGACTCTTATCAAGGCCTACATAAATAACAGTCTAATTCTTTCCGAGGATATTGATCCACATAAAAACT
TTGTGGCTCTAAACTATGATGGCATTTGTTATCTAGGGGGCTTTGAATATGGTAGAAAGGTAAATATCGTTACTCAAGAGATTTTTAAAA
CCAATTTTGTTGGCAAAATTAAAGATGTTGTATTTTTTCAGGAACCAAAAAACATTGAACTAATTAAATTAGAAGGATACAATGTTTATG
ATGGAGATGAACAAAATGAGGTTACATAAGTTAACACTAGAGATTTTAGTACACACTATACATAAATGCAGTTATTTTGATAGTTATTTC
TTTGATACATTGCTTACGGGGAATCAACTGTTTACTATATTACCTGAAATAGTCTAAATGCTAACATATCTTTTTGATAAGATTGTAAAA
TGTCACTGAAGGTTCTGATTGTTTTTCCTACATCTAATTTATCTGTATATATTTTGATTCATGTTTTAACTCCATTAGTTCAGTGCTTAT
TCACAGAATGTGCTTATTCACTTTGCTTATTCACTTTTTACCTATCCCTAATGCTTACATTTTAAAATCAACGTGTAAACACAATTTTAA
AAATCAATGTGTAAGCTGAACTTTAAAATGTTTAAAATTCAGTTGGGAATGAATTAGGGATAGGTACAAATAAGAAAAAAATCAAGTTAT
TAATCAAAGGAAAAATAAAAATTATACAAAGCAATGTAACCATATTGTATTACATGGCTTAGCTACAACTTATTTATATGATTCAACAAT
GTAAAACTTGAACATAGATTTAAACCAAAAATTATTGCATGAATGTAGAAAGAGAAGGTGAGAGGAGAGGAGAACAGGCTGGTAAGAGCT

>In-frame_LMBRD1_ENST00000370577_chr6_70490386_-_EYS_ENST00000370621_chr6_65767620_-_8472nt
ACTGCGTCCGCACGCGCCCCGCCCCTGAGCAGTCCTTGCTGCCCCGCCCCCGCTCGGCTCGCCGCCAGGGGACGCTAGTGGGTCCAGTCT
CCTTGGCAACCACTTGCTCCTCCCCCTCCGCCCCTTTAACCTTTAGGGTGCGCGGGTGCAGTATATCTCGCGCTCTCTCCCCTTTCCCCC
TCCCCTTTCCCCACCCCGGGCGCTCAGGTTGGTCTGGACCGGAAGCGAAGATGGCGACTTCTGGCGCGGCCTCGGCGGAGCTGGTGATCG
GCTGGTGCATATTCGGCCTCTTACTACTGGCTATTTTGGCATTCTGCTGGATATATGTTCGTAAATACCAAAGTCGGCGGGAAAGTGAAG
TTGTCTCCACCATAACAGCAATTTTTTCTCTAGCAATTGCACTTATCACATCAGCACTTCTACCAGTGGATATATTTTTGGTTTCTTACA
TGAAAAATCAAAATGGTACATTTAAGGACTGGGCTAATGCTAATGTCAGCAGACAGATTGAGGACACTGTATTATACGGTTACTATAGTA
CGCAATGTGAAATTGATATAGATGAGTGTGCTTCACATCCCTGCAAAAATGGAGCCACCTGCATTGACCAACCTGGTAATTACTTCTGCC
AGTGTGTGCCTCCATTTAAAGTGGTTGATGGCTTTTCCTGCTTATGCAATCCAGGCTATGTTGGGATAAGATGTGAACAGGACATTGATG
ACTGCATCCTGAATGCCTGTGAGCACAATTCTACCTGCAAAGACCTGCATCTCAGCTACCAGTGTGTGTGCCTATCTGATTGGGAAGGAA
ATTTTTGTGAACAAGAATCCAATGAGTGTAAAATGAATCCTTGCAAGAACAATTCCACCTGTACTGACCTTTACAAAAGCTATCGATGTG
AGTGTACATCTGGATGGACTGGACAGAACTGTAGTGAAGAAATAAATGAATGCGACTCTGATCCATGCATGAATGGAGGTCTTTGTCATG
AATCTACCATCCCTGGACAATTTGTATGTCTGTGCCCACCCCTTTATACTGGACAATTTTGCCACCAACGCTATAACCTTTGTGACCTAC
TTCATAACCCTTGCAGAAACAACTCAACATGCTTAGCTTTGGTAGACGCAAATCAGCATTGTATTTGTAGAGAAGAATTTGAAGGTAAAA
ACTGTGAAATTGATGTGAAAGACTGCCTCTTCCTTTCCTGCCAGGATTATGGTGACTGTGAAGATATGGTCAACAATTTCAGGTGTATTT
GCAGACCTGGGTTTTCTGGATCTCTGTGTGAAATTGAAATTAATGAATGTTCCTCTGAACCTTGCAAAAATAATGGAACATGTGTGGATC
TGACAAACAGATTTTTTTGTAATTGTGAACCTGAGTACCATGGGCCCTTCTGTGAACTTGATGTAAATAAATGTAAAATCTCACCTTGTC
TAGATGAAGAAAATTGTGTCTACAGGACTGATGGATACAACTGCCTCTGTGCCCCTGGTTATACAGGCATCAACTGTGAAATAAATCTAG
ATGAATGCCTATCAGAGCCCTGTCTCCATGATGGAGTTTGTATCGATGGCATCAATCATTATACCTGTGACTGCAAGAGTGGGTTTTTTG
GAACACACTGTGAAACAAACGCCAATGATTGCCTTTCAAATCCTTGTCTACATGGAAGGTGCACAGAACTTATTAATGAATATCCATGTT
CATGTGATGCAGATGGGACTAGCACACAATGTAAGATCAAAATTAATGACTGCACATCAATCCCTTGTATGAATGAAGGCTTCTGTCAGA
AGTCAGCACATGGATTTACTTGCATTTGCCCACGTGGATACACTGGTGCATACTGTGAAAAAAGCATTGATAATTGTGCTGAGCCTGAAC
TTAATTCAGTCATCTGTCTTAATGGAGGGATCTGTGTTGATGGGCCTGGACATACTTTTGACTGCAGATGTCTTCCTGGATTTTCTGGTC
AATTTTGTGAAATTAATATAAATGAATGCTCTTCATCACCATGTCTACATGGTGCAGACTGTGAAGATCACATCAATGGATATGTTTGCA
AATGCCAACCAGGATGGTCTGGACACCACTGTGAGAATGAGCTTGAGTGCATTCCCAACTCATGTGTTCATGAACTCTGCATGGAGAATG
AACCTGGCTCGACATGTTTATGCACACCTGGATTTATGACCTGCTCCATTGGGCTTCTTTGTGGTGATGAAATAAGGAGAATTACCTGTT
TAACTCCCATCTTTCAAAGAACAGATCCCATTTCCACACAGACATATACAATTCCCCCTTCTGAGACTTTGGTCAGCAGCTTTCCATCTA
TAAAGGCTACTAGAATACCAGCCATAATGGACACTTACCCAGTTGATCAAGGTCCAAAACAGACAGGCATTGTCAAGCACGACATTCTCC
CAACCACTGGTTTGGCAACATTAAGAATTAGCACACCCTTGGAAAGCTACTTACTCCAAGAACTGATTGTCACTAGAGAGCTTTCAGCAA
AACACAGTCTTCTTTCTTCCGCAGATGTTTCCTCTTCTCGATTCCTGAATTTTGGTATTCGTGACCCAGCACAAATTGTCCAGGACAAAA
CATCGGTATCACATATGCCTATTCGAACTTCAGCAGCCACACTAGGTTTCTTTTTTCCTGATAGGAGAGCAAGGACCCCATTTATCATGT
CTTCCTTAATGTCAGATTTTATTTTTCCTACACAATCTTTATTATTTGAGAACTGTCAGACTGTTGCTTTATCTGCTACCCCAACGACTT
CAGTAATTAGAAGCATTCCAGGGGCTGATATTGAGCTAAACAGGCAGTCATTACTCTCCCGTGGATTCCTGCTTATAGCTGCCTCCATAA
GTGCAACTCCAGTTGTCTCTAGGGGGGCTCAAGAGGATATTGAAGAATATTCAGCTGATTCTTTAATTTCAAGAAGAGAGCACTGGAGAT
TGCTCAGCCCCTCGATGTCTCCCATTTTTCCTGCTAAGGTAATTATATCTAAACAGGTAACCATCTTAAACTCATCAGCTCTGCACCGGT
TCAGTACAAAAGCCTTCAATCCCAGTGAATATCAGGCTATTACTGAGGCTTCAAGCAACCAGAGACTCACAAACATCAAATCACAGGCTG
CTGATTCTTTAAGAGAATTAAGCCAAACATGTGCAACATGTTCTATGACTGAAATAAAATCCTCTCGTGAATTCTCAGATCAAGTTTTGC
ATAGCAAACAGTCCCACTTTTATGAGACATTCTGGATGAACTCAGCGATATTAGCCAGCTGGTATGCACTAATGGGAGCTCAAACTATCA
CTTCTGGGCATTCATTTTCTTCTGCTACTGAAATAACACCATCAGTGGCATTCACAGAAGTGCCATCTTTATTTCCTTCTAAAAAGAGTG
CAAAAAGAACAATTTTATCCTCATCCTTGGAAGAATCCATTACCCTATCAAGTAATTTGGATGTTAATTTATGTTTGGATAAGACTTGTT
TATCCATTGTCCCTTCACAAACTATCTCTTCAGACTTGATGAATTCTGATTTGACTTCAAAAATGACTACTGATGAACTGTCAGTATCAG
AAAACATTTTAAAACTATTGAAAATAAGACAATATGGCATAACTATGGGACCCACTGAGGTACTAAATCAAGAGAGCTTATTGGACATGG
AAAAAAGTAAAGGATCTCATACACTGTTCAAACTTCACCCAAGTGATAGTTCTCTGGATTTTGAGTTAAACTTACAAATTTATCCGGATG
TTACTTTAAAGACATATTCAGAAATTACACATGCAAATGACTTCAAAAATAATCTGCCACCATTGACAGGCTCAGTGCCTGATTTTTCAG
AAGTCACCACCAATGTTGCATTTTATACAGTTTCAGCAACTCCAGCACTTTCAATACAGACGTCTTCCTCCATGTCTGTAATTAGGCCAG
ATTGGCCATATTTTACAGATTATATGACCTCTCTTAAAAAAGAGGTCAAGACTTCTTCAGAATGGTCCAAATGGGAACTTCAGCCTAGTG
TGCAATATCAGGAATTTCCCACTGCAAGCCGGCATCTTCCCTTCACTAGATCTCTTACTTTGTCTTCACTGGAATCCATTCTGGCACCTC
AACGGCTGATGATTTCTGATTTCAGTTGTGTTCGTTATTATGGAGATTCTTATCTAGAATTTCAGAATGTGGCTTTAAATCCACAAAATA
ACATCTCCCTAGAATTTCAGACCTTCAGCTCCTATGGACTTCTGCTGTATGTCAAGCAAGACTCAAATTTAGTAGATGGATTTTTTATTC
AATTGTTTATTGAAAATGGTACTTTAAAGTACCACTTTTACTGTCCTGGTGAAGCAAAATTTAAAAGCATTAATACTACTGTTAGAGTGG
ACAACGGGCAAAAGTATACACTGCTTATCAGGCAAGAATTGGATCCATGTAACGCTGAGCTGACTATTTTAGGGAGGAATACACAAATAT
GCGAATCTATCAATCATGTACTCGGAAAACCCCTGCCAAAATCAGGATCTGTCTTCATTGGTGGATTTCCAGACCTTCATGGGAAAATCC
AGATGCCTGTACCAGTCAAGAATTTTACTGGCTGCATAGAAGTTATAGAAATAAATAACTGGAGATCTTTCATTCCATCCAAGGCAGTGA
AAAACTATCACATTAACAATTGCAGATCCCAGGGATTTATGCTGTCTCCAACAGCCTCCTTTGTTGATGCTTCTGATGTGACACAAGGGG
TTGATACCATGTGGACTTCTGTCAGCCCCTCTGTTGCAGCACCCTCTGTGTGCCAGCAGGATGTATGCCACAATGGAGGCACATGCCATG
CCATCTTCCTCTCCAGTGGCATAGTGTCATTCCAATGTGACTGTCCACTACATTTCACTGGCCGCTTCTGTGAAAAAGATGCAGGTTTAT
TCTTTCCATCTTTCAATGGGAATTCCTATTTAGAACTGCCCTTTTTGAAGTTTGTCCTGGAGAAGGAACATAACAGAACTGTTACCATCT
ACTTGACTATAAAAACAAACAGTTTAAATGGAACTATTCTTTACAGTAATGGGAATAATTGTGGAAAGCAGTTTCTTCATTTATTTCTTG
TGGAAGGAAGGCCATCAGTTAAATATGGGTGTGGAAATTCTCAAAATATTTTGACTGTTTCTGCTAATTACAGCATTAACACAAATGCAT
TCACCCCTATCACAATACGCTACACAACGCCTGTTGGCAGCCCTGGAGTTGTTTGTATGATTGAAATGACTGCAGATGGAAAACCTCCAG
TACAGAAGAAAGACACAGAGATTTCCCATGCCTCTCAGGCATATTTTGAATCAATGTTCCTTGGCCATATTCCTGCAAATGTTCAAATTC
ATAAGAAAGCAGGTCCTGTTTATGGGTTCAGGGGCTGCATTCTAGACCTTCAAGTAAACAACAAAGAATTCTTCATCATCGATGAAGCAC
GACATGGAAAGAATATTGAGAACTGCCACGTCCCTTGGTGTGCTCATCATCTGTGCCGCAACAATGGCACCTGCATCAGTGATAATGAAA
ATCTGTTTTGTGAGTGTCCAAGGCTGTATTCAGGCAAGCTGTGCCAGTTTGCAAGTTGTGAAAACAACCCATGTGGAAATGGTGCCACCT
GTGTTCCAAAATCCGGAACAGATATTGTCTGCCTCTGCCCATATGGGAGGTCTGGACCCCTCTGCACTGATGCTATTAATATTACTCAGC
CAAGGTTCAGTGGCACAGATGCCTTTGGATACACCTCATTCCTGGCTTATTCACGGATCTCAGACATCAGCTTCCATTATGAATTCCACC
TGAAGTTTCAGCTGGCAAACAACCACTCAGCACTGCAAAATAACTTGATATTTTTTACTGGACAGAAAGGCCATGGGTTGAATGGCGATG
ACTTCCTGGCTGTGGGCCTGCTCAATGGCAGTGTGGTTTATAGTTATAACCTGGGGTCTGGCATAGCAAGCATCAGGAGCGAGCCCCTCA
ATCTGAGCCTTGGAGTCCACACTGTTCATCTGGGCAAGTTCTTCCAAGAGGGCTGGCTGAAGGTAGATGATCATAAAAATAAATCCATTA
TCGCCCCAGGAAGACTGGTTGGTCTCAATGTCTTCAGTCAGTTTTATGTAGGTGGCTACAGTGAATACACTCCAGATCTCTTACCAAATG
GAGCAGATTTTAAAAATGGTTTTCAAGGCTGTATTTTCACTCTTCAAGTTCGCACTGAGAAGGATGGCCATTTCAGAGGACTGGGAAATC
CTGAGGGCCACCCAAATGCTGGACGCAGTGTTGGCCAGTGTCATGCTTCTCCCTGCAGTTTAATGAAATGTGGCAATGGTGGGACATGCA
TAGAGAGTGGAACTAGTGTTTACTGCAATTGTACCACTGGGTGGAAAGGATCATTCTGCACAGAGACAGTTTCTACCTGTGATCCTGAAC
ATGACCCTCCACACCACTGTAGCAGAGGAGCAACCTGCATTTCATTACCTCATGGATACACCTGTTTCTGTCCTCTAGGAACCACTGGAA
TCTACTGTGAACAAGCACTTATCCTCATTGTGATCTTGGAAAAGCCAAAACCAGCAGAACGGAAAGTGAAGAAGGAGGCTTTATCCATAA
GTGATCCATCTTTCAGAAGCAATGAGTTATCCTGGATGTCTTTTGCTTCCTTTCATGTTCGAAAAAAGACACATATTCAATTGCAGTTTC
AGCCTCTCGCTGCAGATGGTATCCTATTTTATGCTGCACAACACTTAAAAGCCCAATCAGGTGATTTTTTATGCATCTCTTTAGTAAATA
GTTCCGTTCAACTTCGCTACAACCTTGGCGACAGAACTATCATTCTAGAAACTCTCCAAAAAGTAACTATAAACGGAAGTACTTGGCATA
TAATAAAAGCAGGAAGAGTTGGTGCAGAAGGCTACCTGGATCTAGATGGGATAAATGTAACAGAAAAGGCCTCCACTAAAATGAGTTCTC
TGGACACAAATACAGACTTCTATATTGGAGGAGTATCTTCTTTAAATCTTGTAAATCCCATGGCAATAGAAAATGAACCTGTAGGTTTTC
AAGGCTGTATCCGACAAGTTATCATAAATAATCAAGAATTACAATTAACTGAATTTGGAGCAAAAGGTGGCTCAAATGTAGGTGACTGTG
ATGGGACAGCCTGTGGGTACAACACATGCAGAAATGGAGGTGAATGTACAGTAAATGGCACAACTTTTTCTTGCAGATGTTTGCCAGATT
GGGCTGGAAATACATGTAACCAGTCTGTGTCCTGTTTGAATAATCTTTGCCTCCACCAATCTTTATGTATACCTGACCAATCATTTTCTT
ACAGTTGCCTGTGTACTTTGGGTTGGGTGGGAAGGTATTGTGAAAACAAAACTTCATTTTCAACTGCAAAATTTATGGGTAATTCTTACA
TTAAATACATTGATCCAAATTATAGAATGAGAAACCTCCAGTTCACTACTATATCCTTAAATTTCAGTACCACTAAAACAGAAGGTCTAA
TTGTATGGATGGGAATAGCTCAAAATGAAGAAAATGATTTTCTGGCAATTGGTCTCCATAATCAGACCTTGAAAATAGCAGTTAACTTGG
GAGAAAGAATCTCTGTGCCTATGAGCTATAACAATGGCACATTCTGTTGTAATAAATGGCACCATGTAGTTGTAATTCAAAATCAGACTC
TTATCAAGGCCTACATAAATAACAGTCTAATTCTTTCCGAGGATATTGATCCACATAAAAACTTTGTGGCTCTAAACTATGATGGCATTT
GTTATCTAGGGGGCTTTGAATATGGTAGAAAGGTAAATATCGTTACTCAAGAGATTTTTAAAACCAATTTTGTTGGCAAAATTAAAGATG
TTGTATTTTTTCAGGAACCAAAAAACATTGAACTAATTAAATTAGAAGGATACAATGTTTATGATGGAGATGAACAAAATGAGGTTACAT
AAGTTAACACTAGAGATTTTAGTACACACTATACATAAATGCAGTTATTTTGATAGTTATTTCTTTGATACATTGCTTACGGGGAATCAA
CTGTTTACTATATTACCTGAAATAGTCTAAATGCTAACATATCTTTTTGATAAGATTGTAAAATGTCACTGAAGGTTCTGATTGTTTTTC
CTACATCTAATTTATCTGTATATATTTTGATTCATGTTTTAACTCCATTAGTTCAGTGCTTATTCACAGAATGTGCTTATTCACTTTGCT
TATTCACTTTTTACCTATCCCTAATGCTTACATTTTAAAATCAACGTGTAAACACAATTTTAAAAATCAATGTGTAAGCTGAACTTTAAA
ATGTTTAAAATTCAGTTGGGAATGAATTAGGGATAGGTACAAATAAGAAAAAAATCAAGTTATTAATCAAAGGAAAAATAAAAATTATAC

>In-frame_LMBRD1_ENST00000370577_chr6_70490386_-_EYS_ENST00000370616_chr6_65767620_-_8012nt
ACTGCGTCCGCACGCGCCCCGCCCCTGAGCAGTCCTTGCTGCCCCGCCCCCGCTCGGCTCGCCGCCAGGGGACGCTAGTGGGTCCAGTCT
CCTTGGCAACCACTTGCTCCTCCCCCTCCGCCCCTTTAACCTTTAGGGTGCGCGGGTGCAGTATATCTCGCGCTCTCTCCCCTTTCCCCC
TCCCCTTTCCCCACCCCGGGCGCTCAGGTTGGTCTGGACCGGAAGCGAAGATGGCGACTTCTGGCGCGGCCTCGGCGGAGCTGGTGATCG
GCTGGTGCATATTCGGCCTCTTACTACTGGCTATTTTGGCATTCTGCTGGATATATGTTCGTAAATACCAAAGTCGGCGGGAAAGTGAAG
TTGTCTCCACCATAACAGCAATTTTTTCTCTAGCAATTGCACTTATCACATCAGCACTTCTACCAGTGGATATATTTTTGGTTTCTTACA
TGAAAAATCAAAATGGTACATTTAAGGACTGGGCTAATGCTAATGTCAGCAGACAGATTGAGGACACTGTATTATACGGTTACTATAGTA
CGCAATGTGAAATTGATATAGATGAGTGTGCTTCACATCCCTGCAAAAATGGAGCCACCTGCATTGACCAACCTGGTAATTACTTCTGCC
AGTGTGTGCCTCCATTTAAAGTGGTTGATGGCTTTTCCTGCTTATGCAATCCAGGCTATGTTGGGATAAGATGTGAACAGGACATTGATG
ACTGCATCCTGAATGCCTGTGAGCACAATTCTACCTGCAAAGACCTGCATCTCAGCTACCAGTGTGTGTGCCTATCTGATTGGGAAGGAA
ATTTTTGTGAACAAGAATCCAATGAGTGTAAAATGAATCCTTGCAAGAACAATTCCACCTGTACTGACCTTTACAAAAGCTATCGATGTG
AGTGTACATCTGGATGGACTGGACAGAACTGTAGTGAAGAAATAAATGAATGCGACTCTGATCCATGCATGAATGGAGGTCTTTGTCATG
AATCTACCATCCCTGGACAATTTGTATGTCTGTGCCCACCCCTTTATACTGGACAATTTTGCCACCAACGCTATAACCTTTGTGACCTAC
TTCATAACCCTTGCAGAAACAACTCAACATGCTTAGCTTTGGTAGACGCAAATCAGCATTGTATTTGTAGAGAAGAATTTGAAGGTAAAA
ACTGTGAAATTGATGTGAAAGACTGCCTCTTCCTTTCCTGCCAGGATTATGGTGACTGTGAAGATATGGTCAACAATTTCAGGTGTATTT
GCAGACCTGGGTTTTCTGGATCTCTGTGTGAAATTGAAATTAATGAATGTTCCTCTGAACCTTGCAAAAATAATGGAACATGTGTGGATC
TGACAAACAGATTTTTTTGTAATTGTGAACCTGAGTACCATGGGCCCTTCTGTGAACTTGATGTAAATAAATGTAAAATCTCACCTTGTC
TAGATGAAGAAAATTGTGTCTACAGGACTGATGGATACAACTGCCTCTGTGCCCCTGGTTATACAGGCATCAACTGTGAAATAAATCTAG
ATGAATGCCTATCAGAGCCCTGTCTCCATGATGGAGTTTGTATCGATGGCATCAATCATTATACCTGTGACTGCAAGAGTGGGTTTTTTG
GAACACACTGTGAAACAAACGCCAATGATTGCCTTTCAAATCCTTGTCTACATGGAAGGTGCACAGAACTTATTAATGAATATCCATGTT
CATGTGATGCAGATGGGACTAGCACACAATGTAAGATCAAAATTAATGACTGCACATCAATCCCTTGTATGAATGAAGGCTTCTGTCAGA
AGTCAGCACATGGATTTACTTGCATTTGCCCACGTGGATACACTGGTGCATACTGTGAAAAAAGCATTGATAATTGTGCTGAGCCTGAAC
TTAATTCAGTCATCTGTCTTAATGGAGGGATCTGTGTTGATGGGCCTGGACATACTTTTGACTGCAGATGTCTTCCTGGATTTTCTGGTC
AATTTTGTGAAATTAATATAAATGAATGCTCTTCATCACCATGTCTACATGGTGCAGACTGTGAAGATCACATCAATGGATATGTTTGCA
AATGCCAACCAGGATGGTCTGGACACCACTGTGAGAATGAGCTTGAGTGCATTCCCAACTCATGTGTTCATGAACTCTGCATGGAGAATG
AACCTGGCTCGACATGTTTATGCACACCTGGATTTATGACCTGCTCCATTGGGCTTCTTTGTGGTGATGAAATAAGGAGAATTACCTGTT
TAACTCCCATCTTTCAAAGAACAGATCCCATTTCCACACAGACATATACAATTCCCCCTTCTGAGACTTTGGTCAGCAGCTTTCCATCTA
TAAAGGCTACTAGAATACCAGCCATAATGGACACTTACCCAGTTGATCAAGGTCCAAAACAGACAGGCATTGTCAAGCACGACATTCTCC
CAACCACTGGTTTGGCAACATTAAGAATTAGCACACCCTTGGAAAGCTACTTACTCCAAGAACTGATTGTCACTAGAGAGCTTTCAGCAA
AACACAGTCTTCTTTCTTCCGCAGATGTTTCCTCTTCTCGATTCCTGAATTTTGGTATTCGTGACCCAGCACAAATTGTCCAGGACAAAA
CATCGGTATCACATATGCCTATTCGAACTTCAGCAGCCACACTAGGTTTCTTTTTTCCTGATAGGAGAGCAAGGACCCCATTTATCATGT
CTTCCTTAATGTCAGATTTTATTTTTCCTACACAATCTTTATTATTTGAGAACTGTCAGACTGTTGCTTTATCTGCTACCCCAACGACTT
CAGTAATTAGAAGCATTCCAGGGGCTGATATTGAGCTAAACAGGCAGTCATTACTCTCCCGTGGATTCCTGCTTATAGCTGCCTCCATAA
GTGCAACTCCAGTTGTCTCTAGGGGGGCTCAAGAGGATATTGAAGAATATTCAGCTGATTCTTTAATTTCAAGAAGAGAGCACTGGAGAT
TGCTCAGCCCCTCGATGTCTCCCATTTTTCCTGCTAAGGTAATTATATCTAAACAGGTAACCATCTTAAACTCATCAGCTCTGCACCGGT
TCAGTACAAAAGCCTTCAATCCCAGTGAATATCAGGCTATTACTGAGGCTTCAAGCAACCAGAGACTCACAAACATCAAATCACAGGCTG
CTGATTCTTTAAGAGAATTAAGCCAAACATGTGCAACATGTTCTATGACTGAAATAAAATCCTCTCGTGAATTCTCAGATCAAGTTTTGC
ATAGCAAACAGTCCCACTTTTATGAGACATTCTGGATGAACTCAGCGATATTAGCCAGCTGGTATGCACTAATGGGAGCTCAAACTATCA
CTTCTGGGCATTCATTTTCTTCTGCTACTGAAATAACACCATCAGTGGCATTCACAGAAGTGCCATCTTTATTTCCTTCTAAAAAGAGTG
CAAAAAGAACAATTTTATCCTCATCCTTGGAAGAATCCATTACCCTATCAAGTAATTTGGATGTTAATTTATGTTTGGATAAGACTTGTT
TATCCATTGTCCCTTCACAAACTATCTCTTCAGACTTGATGAATTCTGATTTGACTTCAAAAATGACTACTGATGAACTGTCAGTATCAG
AAAACATTTTAAAACTATTGAAAATAAGACAATATGGCATAACTATGGGACCCACTGAGGTACTAAATCAAGAGAGCTTATTGGACATGG
AAAAAAGTAAAGGATCTCATACACTGTTCAAACTTCACCCAAGTGATAGTTCTCTGGATTTTGAGTTAAACTTACAAATTTATCCGGATG
TTACTTTAAAGACATATTCAGAAATTACACATGCAAATGACTTCAAAAATAATCTGCCACCATTGACAGGCTCAGTGCCTGATTTTTCAG
AAGTCACCACCAATGTTGCATTTTATACAGTTTCAGCAACTCCAGCACTTTCAATACAGACGTCTTCCTCCATGTCTGTAATTAGGCCAG
ATTGGCCATATTTTACAGATTATATGACCTCTCTTAAAAAAGAGGTCAAGACTTCTTCAGAATGGTCCAAATGGGAACTTCAGCCTAGTG
TGCAATATCAGGAATTTCCCACTGCAAGCCGGCATCTTCCCTTCACTAGATCTCTTACTTTGTCTTCACTGGAATCCATTCTGGCACCTC
AACGGCTGATGATTTCTGATTTCAGTTGTGTTCGTTATTATGGAGATTCTTATCTAGAATTTCAGAATGTGGCTTTAAATCCACAAAATA
ACATCTCCCTAGAATTTCAGACCTTCAGCTCCTATGGACTTCTGCTGTATGTCAAGCAAGACTCAAATTTAGTAGATGGATTTTTTATTC
AATTGTTTATTGAAAATGGTACTTTAAAGTACCACTTTTACTGTCCTGGTGAAGCAAAATTTAAAAGCATTAATACTACTGTTAGAGTGG
ACAACGGGCAAAAGTATACACTGCTTATCAGGCAAGAATTGGATCCATGTAACGCTGAGCTGACTATTTTAGGGAGGAATACACAAATAT
GCGAATCTATCAATCATGTACTCGGAAAACCCCTGCCAAAATCAGGATCTGTCTTCATTGGTGGATTTCCAGACCTTCATGGGAAAATCC
AGATGCCTGTACCAGTCAAGAATTTTACTGGCTGCATAGAAGTTATAGAAATAAATAACTGGAGATCTTTCATTCCATCCAAGGCAGTGA
AAAACTATCACATTAACAATTGCAGATCCCAGGGATTTATGCTGTCTCCAACAGCCTCCTTTGTTGATGCTTCTGATGTGACACAAGGGG
TTGATACCATGTGGACTTCTGTCAGCCCCTCTGTTGCAGCACCCTCTGTGTGCCAGCAGGATGTATGCCACAATGGAGGCACATGCCATG
CCATCTTCCTCTCCAGTGGCATAGTGTCATTCCAATGTGACTGTCCACTACATTTCACTGGCCGCTTCTGTGAAAAAGATGCAGGTTTAT
TCTTTCCATCTTTCAATGGGAATTCCTATTTAGAACTGCCCTTTTTGAAGTTTGTCCTGGAGAAGGAACATAACAGAACTGTTACCATCT
ACTTGACTATAAAAACAAACAGTTTAAATGGAACTATTCTTTACAGTAATGGGAATAATTGTGGAAAGCAGTTTCTTCATTTATTTCTTG
TGGAAGGAAGGCCATCAGTTAAATATGGGTGTGGAAATTCTCAAAATATTTTGACTGTTTCTGCTAATTACAGCATTAACACAAATGCAT
TCACCCCTATCACAATACGCTACACAACGCCTGTTGGCAGCCCTGGAGTTGTTTGTATGATTGAAATGACTGCAGATGGAAAACCTCCAG
TACAGAAGAAAGACACAGAGATTTCCCATGCCTCTCAGGCATATTTTGAATCAATGTTCCTTGGCCATATTCCTGCAAATGTTCAAATTC
ATAAGAAAGCAGGTCCTGTTTATGGGTTCAGGGGCTGCATTCTAGACCTTCAAGTAAACAACAAAGAATTCTTCATCATCGATGAAGCAC
GACATGGAAAGAATATTGAGAACTGCCACGTCCCTTGGTGTGCTCATCATCTGTGCCGCAACAATGGCACCTGCATCAGTGATAATGAAA
ATCTGTTTTGTGAGTGTCCAAGGCTGTATTCAGGCAAGCTGTGCCAGTTTGCAAGTTGTGAAAACAACCCATGTGGAAATGGTGCCACCT
GTGTTCCAAAATCCGGAACAGATATTGTCTGCCTCTGCCCATATGGGAGGTCTGGACCCCTCTGCACTGATGCTATTAATATTACTCAGC
CAAGGTTCAGTGGCACAGATGCCTTTGGATACACCTCATTCCTGGCTTATTCACGGATCTCAGACATCAGCTTCCATTATGAATTCCACC
TGAAGTTTCAGCTGGCAAACAACCACTCAGCACTGCAAAATAACTTGATATTTTTTACTGGACAGAAAGGCCATGGGTTGAATGGCGATG
ACTTCCTGGCTGTGGGCCTGCTCAATGGCAGTGTGGTTTATAGTTATAACCTGGGGTCTGGCATAGCAAGCATCAGGAGCGAGCCCCTCA
ATCTGAGCCTTGGAGTCCACACTGTTCATCTGGGCAAGTTCTTCCAAGAGGGCTGGCTGAAGGTAGATGATCATAAAAATAAATCCATTA
TCGCCCCAGGAAGACTGGTTGGTCTCAATGTCTTCAGTCAGTTTTATGTAGGTGGCTACAGTGAATACACTCCAGATCTCTTACCAAATG
GAGCAGATTTTAAAAATGGTTTTCAAGGCTGTATTTTCACTCTTCAAGTTCGCACTGAGAAGGATGGCCATTTCAGAGGACTGGGAAATC
CTGAGGGCCACCCAAATGCTGGACGCAGTGTTGGCCAGTGTCATGCTTCTCCCTGCAGTTTAATGAAATGTGGCAATGGTGGGACATGCA
TAGAGAGTGGAACTAGTGTTTACTGCAATTGTACCACTGGGTGGAAAGGATCATTCTGCACAGAGACAGTTTCTACCTGTGATCCTGAAC
ATGACCCTCCACACCACTGTAGCAGAGGAGCAACCTGCATTTCATTACCTCATGGATACACCTGTTTCTGTCCTCTAGGAACCACTGGAA
TCTACTGTGAACAAGCACTTATCCTCATTGTGATCTTGGAAAAGCCAAAACCAGCAGAACGGAAAGTGAAGAAGGAGGCTTTATCCATAA
GTGATCCATCTTTCAGAAGCAATGAGTTATCCTGGATGTCTTTTGCTTCCTTTCATGTTCGAAAAAAGACACATATTCAATTGCAGTTTC
AGCCTCTCGCTGCAGATGGTATCCTATTTTATGCTGCACAACACTTAAAAGCCCAATCAGGTGATTTTTTATGCATCTCTTTAGTAAATA
GTTCCGTTCAACTTCGCTACAACCTTGGCGACAGAACTATCATTCTAGAAACTCTCCAAAAAGTAACTATAAACGGAAGTACTTGGCATA
TAATAAAAGCAGGAAGAGTTGGTGCAGAAGGCTACCTGGATCTAGATGGGATAAATGTAACAGAAAAGGCCTCCACTAAAATGAGTTCTC
TGGACACAAATACAGACTTCTATATTGGAGGAGTATCTTCTTTAAATCTTGTAAATCCCATGGCAATAGAAAATGAACCTGTAGGTTTTC
AAGGCTGTATCCGACAAGTTATCATAAATAATCAAGAATTACAATTAACTGAATTTGGAGCAAAAGGTGGCTCAAATGTAGGTGACTGTG
ATGGGACAGCCTGTGGGTACAACACATGCAGAAATGGAGGTGAATGTACAGTAAATGGCACAACTTTTTCTTGCAGATGTTTGCCAGATT
GGGCTGGAAATACATGTAACCAGTCTGTGTCCTGTTTGAATAATCTTTGCCTCCACCAATCTTTATGTATACCTGACCAATCATTTTCTT
ACAGTTGCCTGTGTACTTTGGGTTGGGTGGGAAGGTATTGTGAAAACAAAACTTCATTTTCAACTGCAAAATTTATGGGTAATTCTTACA
TTAAATACATTGATCCAAATTATAGAATGAGAAACCTCCAGTTCACTACTATATCCTTAAATTTCAGTACCACTAAAACAGAAGGTCTAA
TTGTATGGATGGGAATAGCTCAAAATGAAGAAAATGATTTTCTGGCAATTGGTCTCCATAATCAGACCTTGAAAATAGCAGTTAACTTGG
GAGAAAGAATCTCTGTGCCTATGAGCTATAACAATGGCACATTCTGTTGTAATAAATGGCACCATGTAGTTGTAATTCAAAATCAGACTC
TTATCAAGGCCTACATAAATAACAGTCTAATTCTTTCCGAGGATATTGATCCACATAAAAACTTTGTGGCTCTAAACTATGATGGCATTT
GTTATCTAGGGGGCTTTGAATATGGTAGAAAGGTAAATATCGTTACTCAAGAGATTTTTAAAACCAATTTTGTTGGCAAAATTAAAGATG
TTGTATTTTTTCAGGAACCAAAAAACATTGAACTAATTAAATTAGAAGGATACAATGTTTATGATGGAGATGAACAAAATGAGGTTACAT

>In-frame_LMBRD1_ENST00000370570_chr6_70490386_-_EYS_ENST00000503581_chr6_65767620_-_8459nt
GTACTGCATTCATGAAGTAGGCTTTGAAAATTATACATCTTGGACAAGTTTTTAAGGGATAGTGGGCTTTCCTTACACAACTAAAATAAC
CTTTACTTCACATAAGGTTTCCTGCTAGAAACTTTCAAACACATACAAAAATCAGAGAAAATACACTGGGTAGTAACAAACATCTCTTTT
TGTTCTATTTCAGGCTATTTTGGCATTCTGCTGGATATATGTTCGTAAATACCAAAGTCGGCGGGAAAGTGAAGTTGTCTCCACCATAAC
AGCAATTTTTTCTCTAGCAATTGCACTTATCACATCAGCACTTCTACCAGTGGATATATTTTTGGTTTCTTACATGAAAAATCAAAATGG
TACATTTAAGGACTGGGCTAATGCTAATGTCAGCAGACAGATTGAGGACACTGTATTATACGGTTACTATAGTACGCAATGTGAAATTGA
TATAGATGAGTGTGCTTCACATCCCTGCAAAAATGGAGCCACCTGCATTGACCAACCTGGTAATTACTTCTGCCAGTGTGTGCCTCCATT
TAAAGTGGTTGATGGCTTTTCCTGCTTATGCAATCCAGGCTATGTTGGGATAAGATGTGAACAGGACATTGATGACTGCATCCTGAATGC
CTGTGAGCACAATTCTACCTGCAAAGACCTGCATCTCAGCTACCAGTGTGTGTGCCTATCTGATTGGGAAGGAAATTTTTGTGAACAAGA
ATCCAATGAGTGTAAAATGAATCCTTGCAAGAACAATTCCACCTGTACTGACCTTTACAAAAGCTATCGATGTGAGTGTACATCTGGATG
GACTGGACAGAACTGTAGTGAAGAAATAAATGAATGCGACTCTGATCCATGCATGAATGGAGGTCTTTGTCATGAATCTACCATCCCTGG
ACAATTTGTATGTCTGTGCCCACCCCTTTATACTGGACAATTTTGCCACCAACGCTATAACCTTTGTGACCTACTTCATAACCCTTGCAG
AAACAACTCAACATGCTTAGCTTTGGTAGACGCAAATCAGCATTGTATTTGTAGAGAAGAATTTGAAGGTAAAAACTGTGAAATTGATGT
GAAAGACTGCCTCTTCCTTTCCTGCCAGGATTATGGTGACTGTGAAGATATGGTCAACAATTTCAGGTGTATTTGCAGACCTGGGTTTTC
TGGATCTCTGTGTGAAATTGAAATTAATGAATGTTCCTCTGAACCTTGCAAAAATAATGGAACATGTGTGGATCTGACAAACAGATTTTT
TTGTAATTGTGAACCTGAGTACCATGGGCCCTTCTGTGAACTTGATGTAAATAAATGTAAAATCTCACCTTGTCTAGATGAAGAAAATTG
TGTCTACAGGACTGATGGATACAACTGCCTCTGTGCCCCTGGTTATACAGGCATCAACTGTGAAATAAATCTAGATGAATGCCTATCAGA
GCCCTGTCTCCATGATGGAGTTTGTATCGATGGCATCAATCATTATACCTGTGACTGCAAGAGTGGGTTTTTTGGAACACACTGTGAAAC
AAACGCCAATGATTGCCTTTCAAATCCTTGTCTACATGGAAGGTGCACAGAACTTATTAATGAATATCCATGTTCATGTGATGCAGATGG
GACTAGCACACAATGTAAGATCAAAATTAATGACTGCACATCAATCCCTTGTATGAATGAAGGCTTCTGTCAGAAGTCAGCACATGGATT
TACTTGCATTTGCCCACGTGGATACACTGGTGCATACTGTGAAAAAAGCATTGATAATTGTGCTGAGCCTGAACTTAATTCAGTCATCTG
TCTTAATGGAGGGATCTGTGTTGATGGGCCTGGACATACTTTTGACTGCAGATGTCTTCCTGGATTTTCTGGTCAATTTTGTGAAATTAA
TATAAATGAATGCTCTTCATCACCATGTCTACATGGTGCAGACTGTGAAGATCACATCAATGGATATGTTTGCAAATGCCAACCAGGATG
GTCTGGACACCACTGTGAGAATGAGCTTGAGTGCATTCCCAACTCATGTGTTCATGAACTCTGCATGGAGAATGAACCTGGCTCGACATG
TTTATGCACACCTGGATTTATGACCTGCTCCATTGGGCTTCTTTGTGGTGATGAAATAAGGAGAATTACCTGTTTAACTCCCATCTTTCA
AAGAACAGATCCCATTTCCACACAGACATATACAATTCCCCCTTCTGAGACTTTGGTCAGCAGCTTTCCATCTATAAAGGCTACTAGAAT
ACCAGCCATAATGGACACTTACCCAGTTGATCAAGGTCCAAAACAGACAGGCATTGTCAAGCACGACATTCTCCCAACCACTGGTTTGGC
AACATTAAGAATTAGCACACCCTTGGAAAGCTACTTACTCCAAGAACTGATTGTCACTAGAGAGCTTTCAGCAAAACACAGTCTTCTTTC
TTCCGCAGATGTTTCCTCTTCTCGATTCCTGAATTTTGGTATTCGTGACCCAGCACAAATTGTCCAGGACAAAACATCGGTATCACATAT
GCCTATTCGAACTTCAGCAGCCACACTAGGTTTCTTTTTTCCTGATAGGAGAGCAAGGACCCCATTTATCATGTCTTCCTTAATGTCAGA
TTTTATTTTTCCTACACAATCTTTATTATTTGAGAACTGTCAGACTGTTGCTTTATCTGCTACCCCAACGACTTCAGTAATTAGAAGCAT
TCCAGGGGCTGATATTGAGCTAAACAGGCAGTCATTACTCTCCCGTGGATTCCTGCTTATAGCTGCCTCCATAAGTGCAACTCCAGTTGT
CTCTAGGGGGGCTCAAGAGGATATTGAAGAATATTCAGCTGATTCTTTAATTTCAAGAAGAGAGCACTGGAGATTGCTCAGCCCCTCGAT
GTCTCCCATTTTTCCTGCTAAGGTAATTATATCTAAACAGGTAACCATCTTAAACTCATCAGCTCTGCACCGGTTCAGTACAAAAGCCTT
CAATCCCAGTGAATATCAGGCTATTACTGAGGCTTCAAGCAACCAGAGACTCACAAACATCAAATCACAGGCTGCTGATTCTTTAAGAGA
ATTAAGCCAAACATGTGCAACATGTTCTATGACTGAAATAAAATCCTCTCGTGAATTCTCAGATCAAGTTTTGCATAGCAAACAGTCCCA
CTTTTATGAGACATTCTGGATGAACTCAGCGATATTAGCCAGCTGGTATGCACTAATGGGAGCTCAAACTATCACTTCTGGGCATTCATT
TTCTTCTGCTACTGAAATAACACCATCAGTGGCATTCACAGAAGTGCCATCTTTATTTCCTTCTAAAAAGAGTGCAAAAAGAACAATTTT
ATCCTCATCCTTGGAAGAATCCATTACCCTATCAAGTAATTTGGATGTTAATTTATGTTTGGATAAGACTTGTTTATCCATTGTCCCTTC
ACAAACTATCTCTTCAGACTTGATGAATTCTGATTTGACTTCAAAAATGACTACTGATGAACTGTCAGTATCAGAAAACATTTTAAAACT
ATTGAAAATAAGACAATATGGCATAACTATGGGACCCACTGAGGTACTAAATCAAGAGAGCTTATTGGACATGGAAAAAAGTAAAGGATC
TCATACACTGTTCAAACTTCACCCAAGTGATAGTTCTCTGGATTTTGAGTTAAACTTACAAATTTATCCGGATGTTACTTTAAAGACATA
TTCAGAAATTACACATGCAAATGACTTCAAAAATAATCTGCCACCATTGACAGGCTCAGTGCCTGATTTTTCAGAAGTCACCACCAATGT
TGCATTTTATACAGTTTCAGCAACTCCAGCACTTTCAATACAGACGTCTTCCTCCATGTCTGTAATTAGGCCAGATTGGCCATATTTTAC
AGATTATATGACCTCTCTTAAAAAAGAGGTCAAGACTTCTTCAGAATGGTCCAAATGGGAACTTCAGCCTAGTGTGCAATATCAGGAATT
TCCCACTGCAAGCCGGCATCTTCCCTTCACTAGATCTCTTACTTTGTCTTCACTGGAATCCATTCTGGCACCTCAACGGCTGATGATTTC
TGATTTCAGTTGTGTTCGTTATTATGGAGATTCTTATCTAGAATTTCAGAATGTGGCTTTAAATCCACAAAATAACATCTCCCTAGAATT
TCAGACCTTCAGCTCCTATGGACTTCTGCTGTATGTCAAGCAAGACTCAAATTTAGTAGATGGATTTTTTATTCAATTGTTTATTGAAAA
TGGTACTTTAAAGTACCACTTTTACTGTCCTGGTGAAGCAAAATTTAAAAGCATTAATACTACTGTTAGAGTGGACAACGGGCAAAAGTA
TACACTGCTTATCAGGCAAGAATTGGATCCATGTAACGCTGAGCTGACTATTTTAGGGAGGAATACACAAATATGCGAATCTATCAATCA
TGTACTCGGAAAACCCCTGCCAAAATCAGGATCTGTCTTCATTGGTGGATTTCCAGACCTTCATGGGAAAATCCAGATGCCTGTACCAGT
CAAGAATTTTACTGGCTGCATAGAAGTTATAGAAATAAATAACTGGAGATCTTTCATTCCATCCAAGGCAGTGAAAAACTATCACATTAA
CAATTGCAGATCCCAGGGATTTATGCTGTCTCCAACAGCCTCCTTTGTTGATGCTTCTGATGTGACACAAGGGGTTGATACCATGTGGAC
TTCTGTCAGCCCCTCTGTTGCAGCACCCTCTGTGTGCCAGCAGGATGTATGCCACAATGGAGGCACATGCCATGCCATCTTCCTCTCCAG
TGGCATAGTGTCATTCCAATGTGACTGTCCACTACATTTCACTGGCCGCTTCTGTGAAAAAGATGCAGGTTTATTCTTTCCATCTTTCAA
TGGGAATTCCTATTTAGAACTGCCCTTTTTGAAGTTTGTCCTGGAGAAGGAACATAACAGAACTGTTACCATCTACTTGACTATAAAAAC
AAACAGTTTAAATGGAACTATTCTTTACAGTAATGGGAATAATTGTGGAAAGCAGTTTCTTCATTTATTTCTTGTGGAAGGAAGGCCATC
AGTTAAATATGGGTGTGGAAATTCTCAAAATATTTTGACTGTTTCTGCTAATTACAGCATTAACACAAATGCATTCACCCCTATCACAAT
ACGCTACACAACGCCTGTTGGCAGCCCTGGAGTTGTTTGTATGATTGAAATGACTGCAGATGGAAAACCTCCAGTACAGAAGAAAGACAC
AGAGATTTCCCATGCCTCTCAGGCATATTTTGAATCAATGTTCCTTGGCCATATTCCTGCAAATGTTCAAATTCATAAGAAAGCAGGTCC
TGTTTATGGGTTCAGGGGCTGCATTCTAGACCTTCAAGTAAACAACAAAGAATTCTTCATCATCGATGAAGCACGACATGGAAAGAATAT
TGAGAACTGCCACGTCCCTTGGTGTGCTCATCATCTGTGCCGCAACAATGGCACCTGCATCAGTGATAATGAAAATCTGTTTTGTGAGTG
TCCAAGGCTGTATTCAGGCAAGCTGTGCCAGTTTGCAAGTTGTGAAAACAACCCATGTGGAAATGGTGCCACCTGTGTTCCAAAATCCGG
AACAGATATTGTCTGCCTCTGCCCATATGGGAGGTCTGGACCCCTCTGCACTGATGCTATTAATATTACTCAGCCAAGGTTCAGTGGCAC
AGATGCCTTTGGATACACCTCATTCCTGGCTTATTCACGGATCTCAGACATCAGCTTCCATTATGAATTCCACCTGAAGTTTCAGCTGGC
AAACAACCACTCAGCACTGCAAAATAACTTGATATTTTTTACTGGACAGAAAGGCCATGGGTTGAATGGCGATGACTTCCTGGCTGTGGG
CCTGCTCAATGGCAGTGTGGTTTATAGTTATAACCTGGGGTCTGGCATAGCAAGCATCAGGAGCGAGCCCCTCAATCTGAGCCTTGGAGT
CCACACTGTTCATCTGGGCAAGTTCTTCCAAGAGGGCTGGCTGAAGGTAGATGATCATAAAAATAAATCCATTATCGCCCCAGGAAGACT
GGTTGGTCTCAATGTCTTCAGTCAGTTTTATGTAGGTGGCTACAGTGAATACACTCCAGATCTCTTACCAAATGGAGCAGATTTTAAAAA
TGGTTTTCAAGGCTGTATTTTCACTCTTCAAGTTCGCACTGAGAAGGATGGCCATTTCAGAGGACTGGGAAATCCTGAGGGCCACCCAAA
TGCTGGACGCAGTGTTGGCCAGTGTCATGCTTCTCCCTGCAGTTTAATGAAATGTGGCAATGGTGGGACATGCATAGAGAGTGGAACTAG
TGTTTACTGCAATTGTACCACTGGGTGGAAAGGATCATTCTGCACAGAGACAGTTTCTACCTGTGATCCTGAACATGACCCTCCACACCA
CTGTAGCAGAGGAGCAACCTGCATTTCATTACCTCATGGATACACCTGTTTCTGTCCTCTAGGAACCACTGGAATCTACTGTGAACAAGC
TTTATCCATAAGTGATCCATCTTTCAGAAGCAATGAGTTATCCTGGATGTCTTTTGCTTCCTTTCATGTTCGAAAAAAGACACATATTCA
ATTGCAGTTTCAGCCTCTCGCTGCAGATGGTATCCTATTTTATGCTGCACAACACTTAAAAGCCCAATCAGGTGATTTTTTATGCATCTC
TTTAGTAAATAGTTCCGTTCAACTTCGCTACAACCTTGGCGACAGAACTATCATTCTAGAAACTCTCCAAAAAGTAACTATAAACGGAAG
TACTTGGCATATAATAAAAGCAGGAAGAGTTGGTGCAGAAGGCTACCTGGATCTAGATGGGATAAATGTAACAGAAAAGGCCTCCACTAA
AATGAGTTCTCTGGACACAAATACAGACTTCTATATTGGAGGAGTATCTTCTTTAAATCTTGTAAATCCCATGGCAATAGAAAATGAACC
TGTAGGTTTTCAAGGCTGTATCCGACAAGTTATCATAAATAATCAAGAATTACAATTAACTGAATTTGGAGCAAAAGGTGGCTCAAATGT
AGGTGACTGTGATGGGACAGCCTGTGGGTACAACACATGCAGAAATGGAGGTGAATGTACAGTAAATGGCACAACTTTTTCTTGCAGATG
TTTGCCAGATTGGGCTGGAAATACATGTAACCAGTCTGTGTCCTGTTTGAATAATCTTTGCCTCCACCAATCTTTATGTATACCTGACCA
ATCATTTTCTTACAGTTGCCTGTGTACTTTGGGTTGGGTGGGAAGGTATTGTGAAAACAAAACTTCATTTTCAACTGCAAAATTTATGGG
TAATTCTTACATTAAATACATTGATCCAAATTATAGAATGAGAAACCTCCAGTTCACTACTATATCCTTAAATTTCAGTACCACTAAAAC
AGAAGGTCTAATTGTATGGATGGGAATAGCTCAAAATGAAGAAAATGATTTTCTGGCAATTGGTCTCCATAATCAGACCTTGAAAATAGC
AGTTAACTTGGGAGAAAGAATCTCTGTGCCTATGAGCTATAACAATGGCACATTCTGTTGTAATAAATGGCACCATGTAGTTGTAATTCA
AAATCAGACTCTTATCAAGGCCTACATAAATAACAGTCTAATTCTTTCCGAGGATATTGATCCACATAAAAACTTTGTGGCTCTAAACTA
TGATGGCATTTGTTATCTAGGGGGCTTTGAATATGGTAGAAAGGTAAATATCGTTACTCAAGAGATTTTTAAAACCAATTTTGTTGGCAA
AATTAAAGATGTTGTATTTTTTCAGGAACCAAAAAACATTGAACTAATTAAATTAGAAGGATACAATGTTTATGATGGAGATGAACAAAA
TGAGGTTACATAAGTTAACACTAGAGATTTTAGTACACACTATACATAAATGCAGTTATTTTGATAGTTATTTCTTTGATACATTGCTTA
CGGGGAATCAACTGTTTACTATATTACCTGAAATAGTCTAAATGCTAACATATCTTTTTGATAAGATTGTAAAATGTCACTGAAGGTTCT
GATTGTTTTTCCTACATCTAATTTATCTGTATATATTTTGATTCATGTTTTAACTCCATTAGTTCAGTGCTTATTCACAGAATGTGCTTA
TTCACTTTGCTTATTCACTTTTTACCTATCCCTAATGCTTACATTTTAAAATCAACGTGTAAACACAATTTTAAAAATCAATGTGTAAGC
TGAACTTTAAAATGTTTAAAATTCAGTTGGGAATGAATTAGGGATAGGTACAAATAAGAAAAAAATCAAGTTATTAATCAAAGGAAAAAT
AAAAATTATACAAAGCAATGTAACCATATTGTATTACATGGCTTAGCTACAACTTATTTATATGATTCAACAATGTAAAACTTGAACATA

>In-frame_LMBRD1_ENST00000370570_chr6_70490386_-_EYS_ENST00000370621_chr6_65767620_-_8366nt
GTACTGCATTCATGAAGTAGGCTTTGAAAATTATACATCTTGGACAAGTTTTTAAGGGATAGTGGGCTTTCCTTACACAACTAAAATAAC
CTTTACTTCACATAAGGTTTCCTGCTAGAAACTTTCAAACACATACAAAAATCAGAGAAAATACACTGGGTAGTAACAAACATCTCTTTT
TGTTCTATTTCAGGCTATTTTGGCATTCTGCTGGATATATGTTCGTAAATACCAAAGTCGGCGGGAAAGTGAAGTTGTCTCCACCATAAC
AGCAATTTTTTCTCTAGCAATTGCACTTATCACATCAGCACTTCTACCAGTGGATATATTTTTGGTTTCTTACATGAAAAATCAAAATGG
TACATTTAAGGACTGGGCTAATGCTAATGTCAGCAGACAGATTGAGGACACTGTATTATACGGTTACTATAGTACGCAATGTGAAATTGA
TATAGATGAGTGTGCTTCACATCCCTGCAAAAATGGAGCCACCTGCATTGACCAACCTGGTAATTACTTCTGCCAGTGTGTGCCTCCATT
TAAAGTGGTTGATGGCTTTTCCTGCTTATGCAATCCAGGCTATGTTGGGATAAGATGTGAACAGGACATTGATGACTGCATCCTGAATGC
CTGTGAGCACAATTCTACCTGCAAAGACCTGCATCTCAGCTACCAGTGTGTGTGCCTATCTGATTGGGAAGGAAATTTTTGTGAACAAGA
ATCCAATGAGTGTAAAATGAATCCTTGCAAGAACAATTCCACCTGTACTGACCTTTACAAAAGCTATCGATGTGAGTGTACATCTGGATG
GACTGGACAGAACTGTAGTGAAGAAATAAATGAATGCGACTCTGATCCATGCATGAATGGAGGTCTTTGTCATGAATCTACCATCCCTGG
ACAATTTGTATGTCTGTGCCCACCCCTTTATACTGGACAATTTTGCCACCAACGCTATAACCTTTGTGACCTACTTCATAACCCTTGCAG
AAACAACTCAACATGCTTAGCTTTGGTAGACGCAAATCAGCATTGTATTTGTAGAGAAGAATTTGAAGGTAAAAACTGTGAAATTGATGT
GAAAGACTGCCTCTTCCTTTCCTGCCAGGATTATGGTGACTGTGAAGATATGGTCAACAATTTCAGGTGTATTTGCAGACCTGGGTTTTC
TGGATCTCTGTGTGAAATTGAAATTAATGAATGTTCCTCTGAACCTTGCAAAAATAATGGAACATGTGTGGATCTGACAAACAGATTTTT
TTGTAATTGTGAACCTGAGTACCATGGGCCCTTCTGTGAACTTGATGTAAATAAATGTAAAATCTCACCTTGTCTAGATGAAGAAAATTG
TGTCTACAGGACTGATGGATACAACTGCCTCTGTGCCCCTGGTTATACAGGCATCAACTGTGAAATAAATCTAGATGAATGCCTATCAGA
GCCCTGTCTCCATGATGGAGTTTGTATCGATGGCATCAATCATTATACCTGTGACTGCAAGAGTGGGTTTTTTGGAACACACTGTGAAAC
AAACGCCAATGATTGCCTTTCAAATCCTTGTCTACATGGAAGGTGCACAGAACTTATTAATGAATATCCATGTTCATGTGATGCAGATGG
GACTAGCACACAATGTAAGATCAAAATTAATGACTGCACATCAATCCCTTGTATGAATGAAGGCTTCTGTCAGAAGTCAGCACATGGATT
TACTTGCATTTGCCCACGTGGATACACTGGTGCATACTGTGAAAAAAGCATTGATAATTGTGCTGAGCCTGAACTTAATTCAGTCATCTG
TCTTAATGGAGGGATCTGTGTTGATGGGCCTGGACATACTTTTGACTGCAGATGTCTTCCTGGATTTTCTGGTCAATTTTGTGAAATTAA
TATAAATGAATGCTCTTCATCACCATGTCTACATGGTGCAGACTGTGAAGATCACATCAATGGATATGTTTGCAAATGCCAACCAGGATG
GTCTGGACACCACTGTGAGAATGAGCTTGAGTGCATTCCCAACTCATGTGTTCATGAACTCTGCATGGAGAATGAACCTGGCTCGACATG
TTTATGCACACCTGGATTTATGACCTGCTCCATTGGGCTTCTTTGTGGTGATGAAATAAGGAGAATTACCTGTTTAACTCCCATCTTTCA
AAGAACAGATCCCATTTCCACACAGACATATACAATTCCCCCTTCTGAGACTTTGGTCAGCAGCTTTCCATCTATAAAGGCTACTAGAAT
ACCAGCCATAATGGACACTTACCCAGTTGATCAAGGTCCAAAACAGACAGGCATTGTCAAGCACGACATTCTCCCAACCACTGGTTTGGC
AACATTAAGAATTAGCACACCCTTGGAAAGCTACTTACTCCAAGAACTGATTGTCACTAGAGAGCTTTCAGCAAAACACAGTCTTCTTTC
TTCCGCAGATGTTTCCTCTTCTCGATTCCTGAATTTTGGTATTCGTGACCCAGCACAAATTGTCCAGGACAAAACATCGGTATCACATAT
GCCTATTCGAACTTCAGCAGCCACACTAGGTTTCTTTTTTCCTGATAGGAGAGCAAGGACCCCATTTATCATGTCTTCCTTAATGTCAGA
TTTTATTTTTCCTACACAATCTTTATTATTTGAGAACTGTCAGACTGTTGCTTTATCTGCTACCCCAACGACTTCAGTAATTAGAAGCAT
TCCAGGGGCTGATATTGAGCTAAACAGGCAGTCATTACTCTCCCGTGGATTCCTGCTTATAGCTGCCTCCATAAGTGCAACTCCAGTTGT
CTCTAGGGGGGCTCAAGAGGATATTGAAGAATATTCAGCTGATTCTTTAATTTCAAGAAGAGAGCACTGGAGATTGCTCAGCCCCTCGAT
GTCTCCCATTTTTCCTGCTAAGGTAATTATATCTAAACAGGTAACCATCTTAAACTCATCAGCTCTGCACCGGTTCAGTACAAAAGCCTT
CAATCCCAGTGAATATCAGGCTATTACTGAGGCTTCAAGCAACCAGAGACTCACAAACATCAAATCACAGGCTGCTGATTCTTTAAGAGA
ATTAAGCCAAACATGTGCAACATGTTCTATGACTGAAATAAAATCCTCTCGTGAATTCTCAGATCAAGTTTTGCATAGCAAACAGTCCCA
CTTTTATGAGACATTCTGGATGAACTCAGCGATATTAGCCAGCTGGTATGCACTAATGGGAGCTCAAACTATCACTTCTGGGCATTCATT
TTCTTCTGCTACTGAAATAACACCATCAGTGGCATTCACAGAAGTGCCATCTTTATTTCCTTCTAAAAAGAGTGCAAAAAGAACAATTTT
ATCCTCATCCTTGGAAGAATCCATTACCCTATCAAGTAATTTGGATGTTAATTTATGTTTGGATAAGACTTGTTTATCCATTGTCCCTTC
ACAAACTATCTCTTCAGACTTGATGAATTCTGATTTGACTTCAAAAATGACTACTGATGAACTGTCAGTATCAGAAAACATTTTAAAACT
ATTGAAAATAAGACAATATGGCATAACTATGGGACCCACTGAGGTACTAAATCAAGAGAGCTTATTGGACATGGAAAAAAGTAAAGGATC
TCATACACTGTTCAAACTTCACCCAAGTGATAGTTCTCTGGATTTTGAGTTAAACTTACAAATTTATCCGGATGTTACTTTAAAGACATA
TTCAGAAATTACACATGCAAATGACTTCAAAAATAATCTGCCACCATTGACAGGCTCAGTGCCTGATTTTTCAGAAGTCACCACCAATGT
TGCATTTTATACAGTTTCAGCAACTCCAGCACTTTCAATACAGACGTCTTCCTCCATGTCTGTAATTAGGCCAGATTGGCCATATTTTAC
AGATTATATGACCTCTCTTAAAAAAGAGGTCAAGACTTCTTCAGAATGGTCCAAATGGGAACTTCAGCCTAGTGTGCAATATCAGGAATT
TCCCACTGCAAGCCGGCATCTTCCCTTCACTAGATCTCTTACTTTGTCTTCACTGGAATCCATTCTGGCACCTCAACGGCTGATGATTTC
TGATTTCAGTTGTGTTCGTTATTATGGAGATTCTTATCTAGAATTTCAGAATGTGGCTTTAAATCCACAAAATAACATCTCCCTAGAATT
TCAGACCTTCAGCTCCTATGGACTTCTGCTGTATGTCAAGCAAGACTCAAATTTAGTAGATGGATTTTTTATTCAATTGTTTATTGAAAA
TGGTACTTTAAAGTACCACTTTTACTGTCCTGGTGAAGCAAAATTTAAAAGCATTAATACTACTGTTAGAGTGGACAACGGGCAAAAGTA
TACACTGCTTATCAGGCAAGAATTGGATCCATGTAACGCTGAGCTGACTATTTTAGGGAGGAATACACAAATATGCGAATCTATCAATCA
TGTACTCGGAAAACCCCTGCCAAAATCAGGATCTGTCTTCATTGGTGGATTTCCAGACCTTCATGGGAAAATCCAGATGCCTGTACCAGT
CAAGAATTTTACTGGCTGCATAGAAGTTATAGAAATAAATAACTGGAGATCTTTCATTCCATCCAAGGCAGTGAAAAACTATCACATTAA
CAATTGCAGATCCCAGGGATTTATGCTGTCTCCAACAGCCTCCTTTGTTGATGCTTCTGATGTGACACAAGGGGTTGATACCATGTGGAC
TTCTGTCAGCCCCTCTGTTGCAGCACCCTCTGTGTGCCAGCAGGATGTATGCCACAATGGAGGCACATGCCATGCCATCTTCCTCTCCAG
TGGCATAGTGTCATTCCAATGTGACTGTCCACTACATTTCACTGGCCGCTTCTGTGAAAAAGATGCAGGTTTATTCTTTCCATCTTTCAA
TGGGAATTCCTATTTAGAACTGCCCTTTTTGAAGTTTGTCCTGGAGAAGGAACATAACAGAACTGTTACCATCTACTTGACTATAAAAAC
AAACAGTTTAAATGGAACTATTCTTTACAGTAATGGGAATAATTGTGGAAAGCAGTTTCTTCATTTATTTCTTGTGGAAGGAAGGCCATC
AGTTAAATATGGGTGTGGAAATTCTCAAAATATTTTGACTGTTTCTGCTAATTACAGCATTAACACAAATGCATTCACCCCTATCACAAT
ACGCTACACAACGCCTGTTGGCAGCCCTGGAGTTGTTTGTATGATTGAAATGACTGCAGATGGAAAACCTCCAGTACAGAAGAAAGACAC
AGAGATTTCCCATGCCTCTCAGGCATATTTTGAATCAATGTTCCTTGGCCATATTCCTGCAAATGTTCAAATTCATAAGAAAGCAGGTCC
TGTTTATGGGTTCAGGGGCTGCATTCTAGACCTTCAAGTAAACAACAAAGAATTCTTCATCATCGATGAAGCACGACATGGAAAGAATAT
TGAGAACTGCCACGTCCCTTGGTGTGCTCATCATCTGTGCCGCAACAATGGCACCTGCATCAGTGATAATGAAAATCTGTTTTGTGAGTG
TCCAAGGCTGTATTCAGGCAAGCTGTGCCAGTTTGCAAGTTGTGAAAACAACCCATGTGGAAATGGTGCCACCTGTGTTCCAAAATCCGG
AACAGATATTGTCTGCCTCTGCCCATATGGGAGGTCTGGACCCCTCTGCACTGATGCTATTAATATTACTCAGCCAAGGTTCAGTGGCAC
AGATGCCTTTGGATACACCTCATTCCTGGCTTATTCACGGATCTCAGACATCAGCTTCCATTATGAATTCCACCTGAAGTTTCAGCTGGC
AAACAACCACTCAGCACTGCAAAATAACTTGATATTTTTTACTGGACAGAAAGGCCATGGGTTGAATGGCGATGACTTCCTGGCTGTGGG
CCTGCTCAATGGCAGTGTGGTTTATAGTTATAACCTGGGGTCTGGCATAGCAAGCATCAGGAGCGAGCCCCTCAATCTGAGCCTTGGAGT
CCACACTGTTCATCTGGGCAAGTTCTTCCAAGAGGGCTGGCTGAAGGTAGATGATCATAAAAATAAATCCATTATCGCCCCAGGAAGACT
GGTTGGTCTCAATGTCTTCAGTCAGTTTTATGTAGGTGGCTACAGTGAATACACTCCAGATCTCTTACCAAATGGAGCAGATTTTAAAAA
TGGTTTTCAAGGCTGTATTTTCACTCTTCAAGTTCGCACTGAGAAGGATGGCCATTTCAGAGGACTGGGAAATCCTGAGGGCCACCCAAA
TGCTGGACGCAGTGTTGGCCAGTGTCATGCTTCTCCCTGCAGTTTAATGAAATGTGGCAATGGTGGGACATGCATAGAGAGTGGAACTAG
TGTTTACTGCAATTGTACCACTGGGTGGAAAGGATCATTCTGCACAGAGACAGTTTCTACCTGTGATCCTGAACATGACCCTCCACACCA
CTGTAGCAGAGGAGCAACCTGCATTTCATTACCTCATGGATACACCTGTTTCTGTCCTCTAGGAACCACTGGAATCTACTGTGAACAAGC
ACTTATCCTCATTGTGATCTTGGAAAAGCCAAAACCAGCAGAACGGAAAGTGAAGAAGGAGGCTTTATCCATAAGTGATCCATCTTTCAG
AAGCAATGAGTTATCCTGGATGTCTTTTGCTTCCTTTCATGTTCGAAAAAAGACACATATTCAATTGCAGTTTCAGCCTCTCGCTGCAGA
TGGTATCCTATTTTATGCTGCACAACACTTAAAAGCCCAATCAGGTGATTTTTTATGCATCTCTTTAGTAAATAGTTCCGTTCAACTTCG
CTACAACCTTGGCGACAGAACTATCATTCTAGAAACTCTCCAAAAAGTAACTATAAACGGAAGTACTTGGCATATAATAAAAGCAGGAAG
AGTTGGTGCAGAAGGCTACCTGGATCTAGATGGGATAAATGTAACAGAAAAGGCCTCCACTAAAATGAGTTCTCTGGACACAAATACAGA
CTTCTATATTGGAGGAGTATCTTCTTTAAATCTTGTAAATCCCATGGCAATAGAAAATGAACCTGTAGGTTTTCAAGGCTGTATCCGACA
AGTTATCATAAATAATCAAGAATTACAATTAACTGAATTTGGAGCAAAAGGTGGCTCAAATGTAGGTGACTGTGATGGGACAGCCTGTGG
GTACAACACATGCAGAAATGGAGGTGAATGTACAGTAAATGGCACAACTTTTTCTTGCAGATGTTTGCCAGATTGGGCTGGAAATACATG
TAACCAGTCTGTGTCCTGTTTGAATAATCTTTGCCTCCACCAATCTTTATGTATACCTGACCAATCATTTTCTTACAGTTGCCTGTGTAC
TTTGGGTTGGGTGGGAAGGTATTGTGAAAACAAAACTTCATTTTCAACTGCAAAATTTATGGGTAATTCTTACATTAAATACATTGATCC
AAATTATAGAATGAGAAACCTCCAGTTCACTACTATATCCTTAAATTTCAGTACCACTAAAACAGAAGGTCTAATTGTATGGATGGGAAT
AGCTCAAAATGAAGAAAATGATTTTCTGGCAATTGGTCTCCATAATCAGACCTTGAAAATAGCAGTTAACTTGGGAGAAAGAATCTCTGT
GCCTATGAGCTATAACAATGGCACATTCTGTTGTAATAAATGGCACCATGTAGTTGTAATTCAAAATCAGACTCTTATCAAGGCCTACAT
AAATAACAGTCTAATTCTTTCCGAGGATATTGATCCACATAAAAACTTTGTGGCTCTAAACTATGATGGCATTTGTTATCTAGGGGGCTT
TGAATATGGTAGAAAGGTAAATATCGTTACTCAAGAGATTTTTAAAACCAATTTTGTTGGCAAAATTAAAGATGTTGTATTTTTTCAGGA
ACCAAAAAACATTGAACTAATTAAATTAGAAGGATACAATGTTTATGATGGAGATGAACAAAATGAGGTTACATAAGTTAACACTAGAGA
TTTTAGTACACACTATACATAAATGCAGTTATTTTGATAGTTATTTCTTTGATACATTGCTTACGGGGAATCAACTGTTTACTATATTAC
CTGAAATAGTCTAAATGCTAACATATCTTTTTGATAAGATTGTAAAATGTCACTGAAGGTTCTGATTGTTTTTCCTACATCTAATTTATC
TGTATATATTTTGATTCATGTTTTAACTCCATTAGTTCAGTGCTTATTCACAGAATGTGCTTATTCACTTTGCTTATTCACTTTTTACCT
ATCCCTAATGCTTACATTTTAAAATCAACGTGTAAACACAATTTTAAAAATCAATGTGTAAGCTGAACTTTAAAATGTTTAAAATTCAGT

>In-frame_LMBRD1_ENST00000370570_chr6_70490386_-_EYS_ENST00000370616_chr6_65767620_-_7906nt
GTACTGCATTCATGAAGTAGGCTTTGAAAATTATACATCTTGGACAAGTTTTTAAGGGATAGTGGGCTTTCCTTACACAACTAAAATAAC
CTTTACTTCACATAAGGTTTCCTGCTAGAAACTTTCAAACACATACAAAAATCAGAGAAAATACACTGGGTAGTAACAAACATCTCTTTT
TGTTCTATTTCAGGCTATTTTGGCATTCTGCTGGATATATGTTCGTAAATACCAAAGTCGGCGGGAAAGTGAAGTTGTCTCCACCATAAC
AGCAATTTTTTCTCTAGCAATTGCACTTATCACATCAGCACTTCTACCAGTGGATATATTTTTGGTTTCTTACATGAAAAATCAAAATGG
TACATTTAAGGACTGGGCTAATGCTAATGTCAGCAGACAGATTGAGGACACTGTATTATACGGTTACTATAGTACGCAATGTGAAATTGA
TATAGATGAGTGTGCTTCACATCCCTGCAAAAATGGAGCCACCTGCATTGACCAACCTGGTAATTACTTCTGCCAGTGTGTGCCTCCATT
TAAAGTGGTTGATGGCTTTTCCTGCTTATGCAATCCAGGCTATGTTGGGATAAGATGTGAACAGGACATTGATGACTGCATCCTGAATGC
CTGTGAGCACAATTCTACCTGCAAAGACCTGCATCTCAGCTACCAGTGTGTGTGCCTATCTGATTGGGAAGGAAATTTTTGTGAACAAGA
ATCCAATGAGTGTAAAATGAATCCTTGCAAGAACAATTCCACCTGTACTGACCTTTACAAAAGCTATCGATGTGAGTGTACATCTGGATG
GACTGGACAGAACTGTAGTGAAGAAATAAATGAATGCGACTCTGATCCATGCATGAATGGAGGTCTTTGTCATGAATCTACCATCCCTGG
ACAATTTGTATGTCTGTGCCCACCCCTTTATACTGGACAATTTTGCCACCAACGCTATAACCTTTGTGACCTACTTCATAACCCTTGCAG
AAACAACTCAACATGCTTAGCTTTGGTAGACGCAAATCAGCATTGTATTTGTAGAGAAGAATTTGAAGGTAAAAACTGTGAAATTGATGT
GAAAGACTGCCTCTTCCTTTCCTGCCAGGATTATGGTGACTGTGAAGATATGGTCAACAATTTCAGGTGTATTTGCAGACCTGGGTTTTC
TGGATCTCTGTGTGAAATTGAAATTAATGAATGTTCCTCTGAACCTTGCAAAAATAATGGAACATGTGTGGATCTGACAAACAGATTTTT
TTGTAATTGTGAACCTGAGTACCATGGGCCCTTCTGTGAACTTGATGTAAATAAATGTAAAATCTCACCTTGTCTAGATGAAGAAAATTG
TGTCTACAGGACTGATGGATACAACTGCCTCTGTGCCCCTGGTTATACAGGCATCAACTGTGAAATAAATCTAGATGAATGCCTATCAGA
GCCCTGTCTCCATGATGGAGTTTGTATCGATGGCATCAATCATTATACCTGTGACTGCAAGAGTGGGTTTTTTGGAACACACTGTGAAAC
AAACGCCAATGATTGCCTTTCAAATCCTTGTCTACATGGAAGGTGCACAGAACTTATTAATGAATATCCATGTTCATGTGATGCAGATGG
GACTAGCACACAATGTAAGATCAAAATTAATGACTGCACATCAATCCCTTGTATGAATGAAGGCTTCTGTCAGAAGTCAGCACATGGATT
TACTTGCATTTGCCCACGTGGATACACTGGTGCATACTGTGAAAAAAGCATTGATAATTGTGCTGAGCCTGAACTTAATTCAGTCATCTG
TCTTAATGGAGGGATCTGTGTTGATGGGCCTGGACATACTTTTGACTGCAGATGTCTTCCTGGATTTTCTGGTCAATTTTGTGAAATTAA
TATAAATGAATGCTCTTCATCACCATGTCTACATGGTGCAGACTGTGAAGATCACATCAATGGATATGTTTGCAAATGCCAACCAGGATG
GTCTGGACACCACTGTGAGAATGAGCTTGAGTGCATTCCCAACTCATGTGTTCATGAACTCTGCATGGAGAATGAACCTGGCTCGACATG
TTTATGCACACCTGGATTTATGACCTGCTCCATTGGGCTTCTTTGTGGTGATGAAATAAGGAGAATTACCTGTTTAACTCCCATCTTTCA
AAGAACAGATCCCATTTCCACACAGACATATACAATTCCCCCTTCTGAGACTTTGGTCAGCAGCTTTCCATCTATAAAGGCTACTAGAAT
ACCAGCCATAATGGACACTTACCCAGTTGATCAAGGTCCAAAACAGACAGGCATTGTCAAGCACGACATTCTCCCAACCACTGGTTTGGC
AACATTAAGAATTAGCACACCCTTGGAAAGCTACTTACTCCAAGAACTGATTGTCACTAGAGAGCTTTCAGCAAAACACAGTCTTCTTTC
TTCCGCAGATGTTTCCTCTTCTCGATTCCTGAATTTTGGTATTCGTGACCCAGCACAAATTGTCCAGGACAAAACATCGGTATCACATAT
GCCTATTCGAACTTCAGCAGCCACACTAGGTTTCTTTTTTCCTGATAGGAGAGCAAGGACCCCATTTATCATGTCTTCCTTAATGTCAGA
TTTTATTTTTCCTACACAATCTTTATTATTTGAGAACTGTCAGACTGTTGCTTTATCTGCTACCCCAACGACTTCAGTAATTAGAAGCAT
TCCAGGGGCTGATATTGAGCTAAACAGGCAGTCATTACTCTCCCGTGGATTCCTGCTTATAGCTGCCTCCATAAGTGCAACTCCAGTTGT
CTCTAGGGGGGCTCAAGAGGATATTGAAGAATATTCAGCTGATTCTTTAATTTCAAGAAGAGAGCACTGGAGATTGCTCAGCCCCTCGAT
GTCTCCCATTTTTCCTGCTAAGGTAATTATATCTAAACAGGTAACCATCTTAAACTCATCAGCTCTGCACCGGTTCAGTACAAAAGCCTT
CAATCCCAGTGAATATCAGGCTATTACTGAGGCTTCAAGCAACCAGAGACTCACAAACATCAAATCACAGGCTGCTGATTCTTTAAGAGA
ATTAAGCCAAACATGTGCAACATGTTCTATGACTGAAATAAAATCCTCTCGTGAATTCTCAGATCAAGTTTTGCATAGCAAACAGTCCCA
CTTTTATGAGACATTCTGGATGAACTCAGCGATATTAGCCAGCTGGTATGCACTAATGGGAGCTCAAACTATCACTTCTGGGCATTCATT
TTCTTCTGCTACTGAAATAACACCATCAGTGGCATTCACAGAAGTGCCATCTTTATTTCCTTCTAAAAAGAGTGCAAAAAGAACAATTTT
ATCCTCATCCTTGGAAGAATCCATTACCCTATCAAGTAATTTGGATGTTAATTTATGTTTGGATAAGACTTGTTTATCCATTGTCCCTTC
ACAAACTATCTCTTCAGACTTGATGAATTCTGATTTGACTTCAAAAATGACTACTGATGAACTGTCAGTATCAGAAAACATTTTAAAACT
ATTGAAAATAAGACAATATGGCATAACTATGGGACCCACTGAGGTACTAAATCAAGAGAGCTTATTGGACATGGAAAAAAGTAAAGGATC
TCATACACTGTTCAAACTTCACCCAAGTGATAGTTCTCTGGATTTTGAGTTAAACTTACAAATTTATCCGGATGTTACTTTAAAGACATA
TTCAGAAATTACACATGCAAATGACTTCAAAAATAATCTGCCACCATTGACAGGCTCAGTGCCTGATTTTTCAGAAGTCACCACCAATGT
TGCATTTTATACAGTTTCAGCAACTCCAGCACTTTCAATACAGACGTCTTCCTCCATGTCTGTAATTAGGCCAGATTGGCCATATTTTAC
AGATTATATGACCTCTCTTAAAAAAGAGGTCAAGACTTCTTCAGAATGGTCCAAATGGGAACTTCAGCCTAGTGTGCAATATCAGGAATT
TCCCACTGCAAGCCGGCATCTTCCCTTCACTAGATCTCTTACTTTGTCTTCACTGGAATCCATTCTGGCACCTCAACGGCTGATGATTTC
TGATTTCAGTTGTGTTCGTTATTATGGAGATTCTTATCTAGAATTTCAGAATGTGGCTTTAAATCCACAAAATAACATCTCCCTAGAATT
TCAGACCTTCAGCTCCTATGGACTTCTGCTGTATGTCAAGCAAGACTCAAATTTAGTAGATGGATTTTTTATTCAATTGTTTATTGAAAA
TGGTACTTTAAAGTACCACTTTTACTGTCCTGGTGAAGCAAAATTTAAAAGCATTAATACTACTGTTAGAGTGGACAACGGGCAAAAGTA
TACACTGCTTATCAGGCAAGAATTGGATCCATGTAACGCTGAGCTGACTATTTTAGGGAGGAATACACAAATATGCGAATCTATCAATCA
TGTACTCGGAAAACCCCTGCCAAAATCAGGATCTGTCTTCATTGGTGGATTTCCAGACCTTCATGGGAAAATCCAGATGCCTGTACCAGT
CAAGAATTTTACTGGCTGCATAGAAGTTATAGAAATAAATAACTGGAGATCTTTCATTCCATCCAAGGCAGTGAAAAACTATCACATTAA
CAATTGCAGATCCCAGGGATTTATGCTGTCTCCAACAGCCTCCTTTGTTGATGCTTCTGATGTGACACAAGGGGTTGATACCATGTGGAC
TTCTGTCAGCCCCTCTGTTGCAGCACCCTCTGTGTGCCAGCAGGATGTATGCCACAATGGAGGCACATGCCATGCCATCTTCCTCTCCAG
TGGCATAGTGTCATTCCAATGTGACTGTCCACTACATTTCACTGGCCGCTTCTGTGAAAAAGATGCAGGTTTATTCTTTCCATCTTTCAA
TGGGAATTCCTATTTAGAACTGCCCTTTTTGAAGTTTGTCCTGGAGAAGGAACATAACAGAACTGTTACCATCTACTTGACTATAAAAAC
AAACAGTTTAAATGGAACTATTCTTTACAGTAATGGGAATAATTGTGGAAAGCAGTTTCTTCATTTATTTCTTGTGGAAGGAAGGCCATC
AGTTAAATATGGGTGTGGAAATTCTCAAAATATTTTGACTGTTTCTGCTAATTACAGCATTAACACAAATGCATTCACCCCTATCACAAT
ACGCTACACAACGCCTGTTGGCAGCCCTGGAGTTGTTTGTATGATTGAAATGACTGCAGATGGAAAACCTCCAGTACAGAAGAAAGACAC
AGAGATTTCCCATGCCTCTCAGGCATATTTTGAATCAATGTTCCTTGGCCATATTCCTGCAAATGTTCAAATTCATAAGAAAGCAGGTCC
TGTTTATGGGTTCAGGGGCTGCATTCTAGACCTTCAAGTAAACAACAAAGAATTCTTCATCATCGATGAAGCACGACATGGAAAGAATAT
TGAGAACTGCCACGTCCCTTGGTGTGCTCATCATCTGTGCCGCAACAATGGCACCTGCATCAGTGATAATGAAAATCTGTTTTGTGAGTG
TCCAAGGCTGTATTCAGGCAAGCTGTGCCAGTTTGCAAGTTGTGAAAACAACCCATGTGGAAATGGTGCCACCTGTGTTCCAAAATCCGG
AACAGATATTGTCTGCCTCTGCCCATATGGGAGGTCTGGACCCCTCTGCACTGATGCTATTAATATTACTCAGCCAAGGTTCAGTGGCAC
AGATGCCTTTGGATACACCTCATTCCTGGCTTATTCACGGATCTCAGACATCAGCTTCCATTATGAATTCCACCTGAAGTTTCAGCTGGC
AAACAACCACTCAGCACTGCAAAATAACTTGATATTTTTTACTGGACAGAAAGGCCATGGGTTGAATGGCGATGACTTCCTGGCTGTGGG
CCTGCTCAATGGCAGTGTGGTTTATAGTTATAACCTGGGGTCTGGCATAGCAAGCATCAGGAGCGAGCCCCTCAATCTGAGCCTTGGAGT
CCACACTGTTCATCTGGGCAAGTTCTTCCAAGAGGGCTGGCTGAAGGTAGATGATCATAAAAATAAATCCATTATCGCCCCAGGAAGACT
GGTTGGTCTCAATGTCTTCAGTCAGTTTTATGTAGGTGGCTACAGTGAATACACTCCAGATCTCTTACCAAATGGAGCAGATTTTAAAAA
TGGTTTTCAAGGCTGTATTTTCACTCTTCAAGTTCGCACTGAGAAGGATGGCCATTTCAGAGGACTGGGAAATCCTGAGGGCCACCCAAA
TGCTGGACGCAGTGTTGGCCAGTGTCATGCTTCTCCCTGCAGTTTAATGAAATGTGGCAATGGTGGGACATGCATAGAGAGTGGAACTAG
TGTTTACTGCAATTGTACCACTGGGTGGAAAGGATCATTCTGCACAGAGACAGTTTCTACCTGTGATCCTGAACATGACCCTCCACACCA
CTGTAGCAGAGGAGCAACCTGCATTTCATTACCTCATGGATACACCTGTTTCTGTCCTCTAGGAACCACTGGAATCTACTGTGAACAAGC
ACTTATCCTCATTGTGATCTTGGAAAAGCCAAAACCAGCAGAACGGAAAGTGAAGAAGGAGGCTTTATCCATAAGTGATCCATCTTTCAG
AAGCAATGAGTTATCCTGGATGTCTTTTGCTTCCTTTCATGTTCGAAAAAAGACACATATTCAATTGCAGTTTCAGCCTCTCGCTGCAGA
TGGTATCCTATTTTATGCTGCACAACACTTAAAAGCCCAATCAGGTGATTTTTTATGCATCTCTTTAGTAAATAGTTCCGTTCAACTTCG
CTACAACCTTGGCGACAGAACTATCATTCTAGAAACTCTCCAAAAAGTAACTATAAACGGAAGTACTTGGCATATAATAAAAGCAGGAAG
AGTTGGTGCAGAAGGCTACCTGGATCTAGATGGGATAAATGTAACAGAAAAGGCCTCCACTAAAATGAGTTCTCTGGACACAAATACAGA
CTTCTATATTGGAGGAGTATCTTCTTTAAATCTTGTAAATCCCATGGCAATAGAAAATGAACCTGTAGGTTTTCAAGGCTGTATCCGACA
AGTTATCATAAATAATCAAGAATTACAATTAACTGAATTTGGAGCAAAAGGTGGCTCAAATGTAGGTGACTGTGATGGGACAGCCTGTGG
GTACAACACATGCAGAAATGGAGGTGAATGTACAGTAAATGGCACAACTTTTTCTTGCAGATGTTTGCCAGATTGGGCTGGAAATACATG
TAACCAGTCTGTGTCCTGTTTGAATAATCTTTGCCTCCACCAATCTTTATGTATACCTGACCAATCATTTTCTTACAGTTGCCTGTGTAC
TTTGGGTTGGGTGGGAAGGTATTGTGAAAACAAAACTTCATTTTCAACTGCAAAATTTATGGGTAATTCTTACATTAAATACATTGATCC
AAATTATAGAATGAGAAACCTCCAGTTCACTACTATATCCTTAAATTTCAGTACCACTAAAACAGAAGGTCTAATTGTATGGATGGGAAT
AGCTCAAAATGAAGAAAATGATTTTCTGGCAATTGGTCTCCATAATCAGACCTTGAAAATAGCAGTTAACTTGGGAGAAAGAATCTCTGT
GCCTATGAGCTATAACAATGGCACATTCTGTTGTAATAAATGGCACCATGTAGTTGTAATTCAAAATCAGACTCTTATCAAGGCCTACAT
AAATAACAGTCTAATTCTTTCCGAGGATATTGATCCACATAAAAACTTTGTGGCTCTAAACTATGATGGCATTTGTTATCTAGGGGGCTT
TGAATATGGTAGAAAGGTAAATATCGTTACTCAAGAGATTTTTAAAACCAATTTTGTTGGCAAAATTAAAGATGTTGTATTTTTTCAGGA


Top

FusionGenePPI for LMBRD1_EYS


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
LMBRD1HNRNPC, CSGALNACT2, MBOAT7EYSEGFR


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for LMBRD1_EYS


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for LMBRD1_EYS


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneEYSC1864446Retinitis Pigmentosa 252CTD_human;UNIPROT
TgeneEYSC0035334Retinitis Pigmentosa1CTD_human;ORPHANET