FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 19860

FusionGeneSummary for LMAN2_DBN1

check button Fusion gene summary
Fusion gene informationFusion gene name: LMAN2_DBN1
Fusion gene ID: 19860
HgeneTgene
Gene symbol

LMAN2

DBN1

Gene ID

10960

1627

Gene namelectin, mannose binding 2drebrin 1
SynonymsC5orf8|GP36B|VIP36D0S117E
Cytomap

5q35.3

5q35.3

Type of geneprotein-codingprotein-coding
Descriptionvesicular integral-membrane protein VIP36glycoprotein GP36bvesicular integral protein of 36 kDavesicular integral-membrane protein 36drebrindevelopmentally-regulated brain proteindrebrin Adrebrin Edrebrin E2
Modification date2018052320180525
UniProtAcc

Q12907

Q16643

Ensembl transtripts involved in fusion geneENST00000303127, ENST00000515209, 
ENST00000506310, 
ENST00000309007, 
ENST00000292385, ENST00000393565, 
ENST00000393563, ENST00000512501, 
Fusion gene scores* DoF score7 X 3 X 7=1478 X 7 X 6=336
# samples 79
** MAII scorelog2(7/147*10)=-1.0703893278914
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(9/336*10)=-1.90046432644909
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: LMAN2 [Title/Abstract] AND DBN1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVKIRPTCGA-G7-6793-01ALMAN2chr5

176761285

-DBN1chr5

176895221

-
TCGALDKIRPTCGA-G7-6793-01ALMAN2chr5

176778174

-DBN1chr5

176887704

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000303127ENST00000309007LMAN2chr5

176761285

-DBN1chr5

176895221

-
In-frameENST00000303127ENST00000292385LMAN2chr5

176761285

-DBN1chr5

176895221

-
In-frameENST00000303127ENST00000393565LMAN2chr5

176761285

-DBN1chr5

176895221

-
5CDS-intronENST00000303127ENST00000393563LMAN2chr5

176761285

-DBN1chr5

176895221

-
5CDS-intronENST00000303127ENST00000512501LMAN2chr5

176761285

-DBN1chr5

176895221

-
In-frameENST00000515209ENST00000309007LMAN2chr5

176761285

-DBN1chr5

176895221

-
In-frameENST00000515209ENST00000292385LMAN2chr5

176761285

-DBN1chr5

176895221

-
In-frameENST00000515209ENST00000393565LMAN2chr5

176761285

-DBN1chr5

176895221

-
5CDS-intronENST00000515209ENST00000393563LMAN2chr5

176761285

-DBN1chr5

176895221

-
5CDS-intronENST00000515209ENST00000512501LMAN2chr5

176761285

-DBN1chr5

176895221

-
intron-3CDSENST00000506310ENST00000309007LMAN2chr5

176761285

-DBN1chr5

176895221

-
intron-3CDSENST00000506310ENST00000292385LMAN2chr5

176761285

-DBN1chr5

176895221

-
intron-3CDSENST00000506310ENST00000393565LMAN2chr5

176761285

-DBN1chr5

176895221

-
intron-intronENST00000506310ENST00000393563LMAN2chr5

176761285

-DBN1chr5

176895221

-
intron-intronENST00000506310ENST00000512501LMAN2chr5

176761285

-DBN1chr5

176895221

-
In-frameENST00000303127ENST00000309007LMAN2chr5

176778174

-DBN1chr5

176887704

-
In-frameENST00000303127ENST00000292385LMAN2chr5

176778174

-DBN1chr5

176887704

-
In-frameENST00000303127ENST00000393565LMAN2chr5

176778174

-DBN1chr5

176887704

-
5CDS-5UTRENST00000303127ENST00000393563LMAN2chr5

176778174

-DBN1chr5

176887704

-
5CDS-5UTRENST00000303127ENST00000512501LMAN2chr5

176778174

-DBN1chr5

176887704

-
In-frameENST00000515209ENST00000309007LMAN2chr5

176778174

-DBN1chr5

176887704

-
In-frameENST00000515209ENST00000292385LMAN2chr5

176778174

-DBN1chr5

176887704

-
In-frameENST00000515209ENST00000393565LMAN2chr5

176778174

-DBN1chr5

176887704

-
5CDS-5UTRENST00000515209ENST00000393563LMAN2chr5

176778174

-DBN1chr5

176887704

-
5CDS-5UTRENST00000515209ENST00000512501LMAN2chr5

176778174

-DBN1chr5

176887704

-
5UTR-3CDSENST00000506310ENST00000309007LMAN2chr5

176778174

-DBN1chr5

176887704

-
5UTR-3CDSENST00000506310ENST00000292385LMAN2chr5

176778174

-DBN1chr5

176887704

-
5UTR-3CDSENST00000506310ENST00000393565LMAN2chr5

176778174

-DBN1chr5

176887704

-
5UTR-5UTRENST00000506310ENST00000393563LMAN2chr5

176778174

-DBN1chr5

176887704

-
5UTR-5UTRENST00000506310ENST00000512501LMAN2chr5

176778174

-DBN1chr5

176887704

-

Top

FusionProtFeatures for LMAN2_DBN1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
LMAN2

Q12907

DBN1

Q16643

Plays a role as an intracellular lectin in the earlysecretory pathway. Interacts with N-acetyl-D-galactosamine andhigh-mannose type glycans and may also bind to O-linked glycans.Involved in the transport and sorting of glycoproteins carryinghigh mannose-type glycans (By similarity). {ECO:0000250}. Drebrins might play some role in cell migration,extension of neuronal processes and plasticity of dendrites.Required for actin polymerization at immunological synapses (IS)and for CXCR4 recruitment to IS. {ECO:0000269|PubMed:20215400}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneLMAN2chr5:176761285chr5:176895221ENST00000303127-7852_276303357DomainL-type lectin-like
HgeneLMAN2chr5:176761285chr5:176895221ENST00000303127-78164_166303357RegionCarbohydrate binding
HgeneLMAN2chr5:176761285chr5:176895221ENST00000303127-78260_262303357RegionCarbohydrate binding

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneLMAN2chr5:176778174chr5:176887704ENST00000303127-2852_276105357DomainL-type lectin-like
HgeneLMAN2chr5:176778174chr5:176887704ENST00000303127-28164_166105357RegionCarbohydrate binding
HgeneLMAN2chr5:176778174chr5:176887704ENST00000303127-28260_262105357RegionCarbohydrate binding
HgeneLMAN2chr5:176761285chr5:176895221ENST00000303127-78346_356303357Topological domainCytoplasmic
HgeneLMAN2chr5:176761285chr5:176895221ENST00000303127-7845_322303357Topological domainLumenal
HgeneLMAN2chr5:176778174chr5:176887704ENST00000303127-28346_356105357Topological domainCytoplasmic
HgeneLMAN2chr5:176778174chr5:176887704ENST00000303127-2845_322105357Topological domainLumenal
HgeneLMAN2chr5:176761285chr5:176895221ENST00000303127-78323_345303357TransmembraneHelical
HgeneLMAN2chr5:176778174chr5:176887704ENST00000303127-28323_345105357TransmembraneHelical
TgeneDBN1chr5:176761285chr5:176895221ENST00000292385-2153_13449652DomainADF-H
TgeneDBN1chr5:176761285chr5:176895221ENST00000309007-1143_13447650DomainADF-H
TgeneDBN1chr5:176761285chr5:176895221ENST00000393565-1153_13447696DomainADF-H
TgeneDBN1chr5:176778174chr5:176887704ENST00000292385-8153_134259652DomainADF-H
TgeneDBN1chr5:176778174chr5:176887704ENST00000309007-7143_134257650DomainADF-H
TgeneDBN1chr5:176778174chr5:176887704ENST00000393565-7153_134257696DomainADF-H


Top

FusionGeneSequence for LMAN2_DBN1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_LMAN2_ENST00000303127_chr5_176761285_-_DBN1_ENST00000309007_chr5_176895221_-_906aa
MAAEGWIWRWGWGRRCLGRPGLLGPGPGPTTPLFLLLLLGSVTADITDGNSEHLKREHSLIKPYQGVGSSSMPLWDFQGSTMLTSQYVRL
TPDERSKEGSIWNHQPCFLKDWEMHVHFKVHGTGKKNLHGDGIALWYTRDRLVPGPVFGSKDNFHGLAIFLDTYPNDETTERVFPYISVM
VNNGSLSYDHSKDGRWTELAGCTADFRNRDHDTFLAVRYSRGRLTVMTDLEDKNEWKNCIDITGVRLPTGYYFGASAGTGDLSDNHDIIS
MKLFQLMVEHTPDEESIDWTKIEPSVNFLKSPKEGGLQELSGHFENQKVMYGFCSVKDSQAALPKYVLINWVGEDVPDARKCACASHVAK
VAEFFQGVDVIVNASSVEDIDAGAIGQRLSNGLARLSSPVLHRLRLREDENAEPVGTTYQKTDAAVEMKRINREQFWEQAKKEEELRKEE
ERKKALDERLRFEQERMEQERQEQEERERRYREREQQIEEHRRKQQTLEAEEAKRRLKEQSIFGDHRDEEEETHMKKSESEVEEAAAIIA
QRPDNPREFFKQQERVASASAGSCDVPSPFNHRPGSHLDSHRRMAPTPIPTRSPSDSSTASTPVAEQIERALDEVTSSQPPPLPPPPPPA
QETQEPSPILDSEETRAAAPQAWAGPMEEPPQAQAPPRGPGSPAEDLMFMESAEQAVLAAPVEPATADATEIHDAADTIETDTATADTTV
ANNVPPAATSLIDLWPGNGEGASTLQGEPRAPTPPSGTEVTLAEVPLLDEVAPEPLLPAGEGCATLLNFDELPEPPATFCDPEEVEGESL
AAPQTPTLPSALEELEQEQEPEPHLLTNGETTQKEGTQASEGYFSQSQEEEFAQSEELCAKAPPPVFYNKPPEIDITCWDADPVPEEEEG

>In-frame_LMAN2_ENST00000303127_chr5_176761285_-_DBN1_ENST00000292385_chr5_176895221_-_906aa
MAAEGWIWRWGWGRRCLGRPGLLGPGPGPTTPLFLLLLLGSVTADITDGNSEHLKREHSLIKPYQGVGSSSMPLWDFQGSTMLTSQYVRL
TPDERSKEGSIWNHQPCFLKDWEMHVHFKVHGTGKKNLHGDGIALWYTRDRLVPGPVFGSKDNFHGLAIFLDTYPNDETTERVFPYISVM
VNNGSLSYDHSKDGRWTELAGCTADFRNRDHDTFLAVRYSRGRLTVMTDLEDKNEWKNCIDITGVRLPTGYYFGASAGTGDLSDNHDIIS
MKLFQLMVEHTPDEESIDWTKIEPSVNFLKSPKEGGLQELSGHFENQKVMYGFCSVKDSQAALPKYVLINWVGEDVPDARKCACASHVAK
VAEFFQGVDVIVNASSVEDIDAGAIGQRLSNGLARLSSPVLHRLRLREDENAEPVGTTYQKTDAAVEMKRINREQFWEQAKKEEELRKEE
ERKKALDERLRFEQERMEQERQEQEERERRYREREQQIEEHRRKQQTLEAEEAKRRLKEQSIFGDHRDEEEETHMKKSESEVEEAAAIIA
QRPDNPREFFKQQERVASASAGSCDVPSPFNHRPGSHLDSHRRMAPTPIPTRSPSDSSTASTPVAEQIERALDEVTSSQPPPLPPPPPPA
QETQEPSPILDSEETRAAAPQAWAGPMEEPPQAQAPPRGPGSPAEDLMFMESAEQAVLAAPVEPATADATEIHDAADTIETDTATADTTV
ANNVPPAATSLIDLWPGNGEGASTLQGEPRAPTPPSGTEVTLAEVPLLDEVAPEPLLPAGEGCATLLNFDELPEPPATFCDPEEVEGESL
AAPQTPTLPSALEELEQEQEPEPHLLTNGETTQKEGTQASEGYFSQSQEEEFAQSEELCAKAPPPVFYNKPPEIDITCWDADPVPEEEEG

>In-frame_LMAN2_ENST00000303127_chr5_176761285_-_DBN1_ENST00000393565_chr5_176895221_-_952aa
MAAEGWIWRWGWGRRCLGRPGLLGPGPGPTTPLFLLLLLGSVTADITDGNSEHLKREHSLIKPYQGVGSSSMPLWDFQGSTMLTSQYVRL
TPDERSKEGSIWNHQPCFLKDWEMHVHFKVHGTGKKNLHGDGIALWYTRDRLVPGPVFGSKDNFHGLAIFLDTYPNDETTERVFPYISVM
VNNGSLSYDHSKDGRWTELAGCTADFRNRDHDTFLAVRYSRGRLTVMTDLEDKNEWKNCIDITGVRLPTGYYFGASAGTGDLSDNHDIIS
MKLFQLMVEHTPDEESIDWTKIEPSVNFLKSPKEGGLQELSGHFENQKVMYGFCSVKDSQAALPKYVLINWVGEDVPDARKCACASHVAK
VAEFFQGVDVIVNASSVEDIDAGAIGQRLSNGLARLSSPVLHRLRLREDENAEPVGTTYQKTDAAVEMKRINREQFWEQAKKEEELRKEE
ERKKALDERLRFEQERMEQERQEQEERERRYREREQQIEEHRRKQQTLEAEEAKRRLKEQSIFGDHRDEEEETHMKKSESEVEEAAAIIA
QRPDNPREFFKQQERVASASAGSCDVPSPFNHRPGRPYCPFIKASDSGPSSSSSSSSSPPRTPFPTITCHRTPNLSSSLPCSHLDSHRRM
APTPIPTRSPSDSSTASTPVAEQIERALDEVTSSQPPPLPPPPPPAQETQEPSPILDSEETRAAAPQAWAGPMEEPPQAQAPPRGPGSPA
EDLMFMESAEQAVLAAPVEPATADATEIHDAADTIETDTATADTTVANNVPPAATSLIDLWPGNGEGASTLQGEPRAPTPPSGTEVTLAE
VPLLDEVAPEPLLPAGEGCATLLNFDELPEPPATFCDPEEVEGESLAAPQTPTLPSALEELEQEQEPEPHLLTNGETTQKEGTQASEGYF

>In-frame_LMAN2_ENST00000515209_chr5_176761285_-_DBN1_ENST00000309007_chr5_176895221_-_906aa
MAAEGWIWRWGWGRRCLGRPGLLGPGPGPTTPLFLLLLLGSVTADITDGNSEHLKREHSLIKPYQGVGSSSMPLWDFQGSTMLTSQYVRL
TPDERSKEGSIWNHQPCFLKDWEMHVHFKVHGTGKKNLHGDGIALWYTRDRLVPGPVFGSKDNFHGLAIFLDTYPNDETTERVFPYISVM
VNNGSLSYDHSKDGRWTELAGCTADFRNRDHDTFLAVRYSRGRLTVMTDLEDKNEWKNCIDITGVRLPTGYYFGASAGTGDLSDNHDIIS
MKLFQLMVEHTPDEESIDWTKIEPSVNFLKSPKEGGLQELSGHFENQKVMYGFCSVKDSQAALPKYVLINWVGEDVPDARKCACASHVAK
VAEFFQGVDVIVNASSVEDIDAGAIGQRLSNGLARLSSPVLHRLRLREDENAEPVGTTYQKTDAAVEMKRINREQFWEQAKKEEELRKEE
ERKKALDERLRFEQERMEQERQEQEERERRYREREQQIEEHRRKQQTLEAEEAKRRLKEQSIFGDHRDEEEETHMKKSESEVEEAAAIIA
QRPDNPREFFKQQERVASASAGSCDVPSPFNHRPGSHLDSHRRMAPTPIPTRSPSDSSTASTPVAEQIERALDEVTSSQPPPLPPPPPPA
QETQEPSPILDSEETRAAAPQAWAGPMEEPPQAQAPPRGPGSPAEDLMFMESAEQAVLAAPVEPATADATEIHDAADTIETDTATADTTV
ANNVPPAATSLIDLWPGNGEGASTLQGEPRAPTPPSGTEVTLAEVPLLDEVAPEPLLPAGEGCATLLNFDELPEPPATFCDPEEVEGESL
AAPQTPTLPSALEELEQEQEPEPHLLTNGETTQKEGTQASEGYFSQSQEEEFAQSEELCAKAPPPVFYNKPPEIDITCWDADPVPEEEEG

>In-frame_LMAN2_ENST00000515209_chr5_176761285_-_DBN1_ENST00000292385_chr5_176895221_-_906aa
MAAEGWIWRWGWGRRCLGRPGLLGPGPGPTTPLFLLLLLGSVTADITDGNSEHLKREHSLIKPYQGVGSSSMPLWDFQGSTMLTSQYVRL
TPDERSKEGSIWNHQPCFLKDWEMHVHFKVHGTGKKNLHGDGIALWYTRDRLVPGPVFGSKDNFHGLAIFLDTYPNDETTERVFPYISVM
VNNGSLSYDHSKDGRWTELAGCTADFRNRDHDTFLAVRYSRGRLTVMTDLEDKNEWKNCIDITGVRLPTGYYFGASAGTGDLSDNHDIIS
MKLFQLMVEHTPDEESIDWTKIEPSVNFLKSPKEGGLQELSGHFENQKVMYGFCSVKDSQAALPKYVLINWVGEDVPDARKCACASHVAK
VAEFFQGVDVIVNASSVEDIDAGAIGQRLSNGLARLSSPVLHRLRLREDENAEPVGTTYQKTDAAVEMKRINREQFWEQAKKEEELRKEE
ERKKALDERLRFEQERMEQERQEQEERERRYREREQQIEEHRRKQQTLEAEEAKRRLKEQSIFGDHRDEEEETHMKKSESEVEEAAAIIA
QRPDNPREFFKQQERVASASAGSCDVPSPFNHRPGSHLDSHRRMAPTPIPTRSPSDSSTASTPVAEQIERALDEVTSSQPPPLPPPPPPA
QETQEPSPILDSEETRAAAPQAWAGPMEEPPQAQAPPRGPGSPAEDLMFMESAEQAVLAAPVEPATADATEIHDAADTIETDTATADTTV
ANNVPPAATSLIDLWPGNGEGASTLQGEPRAPTPPSGTEVTLAEVPLLDEVAPEPLLPAGEGCATLLNFDELPEPPATFCDPEEVEGESL
AAPQTPTLPSALEELEQEQEPEPHLLTNGETTQKEGTQASEGYFSQSQEEEFAQSEELCAKAPPPVFYNKPPEIDITCWDADPVPEEEEG

>In-frame_LMAN2_ENST00000515209_chr5_176761285_-_DBN1_ENST00000393565_chr5_176895221_-_952aa
MAAEGWIWRWGWGRRCLGRPGLLGPGPGPTTPLFLLLLLGSVTADITDGNSEHLKREHSLIKPYQGVGSSSMPLWDFQGSTMLTSQYVRL
TPDERSKEGSIWNHQPCFLKDWEMHVHFKVHGTGKKNLHGDGIALWYTRDRLVPGPVFGSKDNFHGLAIFLDTYPNDETTERVFPYISVM
VNNGSLSYDHSKDGRWTELAGCTADFRNRDHDTFLAVRYSRGRLTVMTDLEDKNEWKNCIDITGVRLPTGYYFGASAGTGDLSDNHDIIS
MKLFQLMVEHTPDEESIDWTKIEPSVNFLKSPKEGGLQELSGHFENQKVMYGFCSVKDSQAALPKYVLINWVGEDVPDARKCACASHVAK
VAEFFQGVDVIVNASSVEDIDAGAIGQRLSNGLARLSSPVLHRLRLREDENAEPVGTTYQKTDAAVEMKRINREQFWEQAKKEEELRKEE
ERKKALDERLRFEQERMEQERQEQEERERRYREREQQIEEHRRKQQTLEAEEAKRRLKEQSIFGDHRDEEEETHMKKSESEVEEAAAIIA
QRPDNPREFFKQQERVASASAGSCDVPSPFNHRPGRPYCPFIKASDSGPSSSSSSSSSPPRTPFPTITCHRTPNLSSSLPCSHLDSHRRM
APTPIPTRSPSDSSTASTPVAEQIERALDEVTSSQPPPLPPPPPPAQETQEPSPILDSEETRAAAPQAWAGPMEEPPQAQAPPRGPGSPA
EDLMFMESAEQAVLAAPVEPATADATEIHDAADTIETDTATADTTVANNVPPAATSLIDLWPGNGEGASTLQGEPRAPTPPSGTEVTLAE
VPLLDEVAPEPLLPAGEGCATLLNFDELPEPPATFCDPEEVEGESLAAPQTPTLPSALEELEQEQEPEPHLLTNGETTQKEGTQASEGYF

>In-frame_LMAN2_ENST00000303127_chr5_176778174_-_DBN1_ENST00000309007_chr5_176887704_-_498aa
MAAEGWIWRWGWGRRCLGRPGLLGPGPGPTTPLFLLLLLGSVTADITDGNSEHLKREHSLIKPYQGVGSSSMPLWDFQGSTMLTSQYVRL
TPDERSKEGSIWNHQGDHRDEEEETHMKKSESEVEEAAAIIAQRPDNPREFFKQQERVASASAGSCDVPSPFNHRPGSHLDSHRRMAPTP
IPTRSPSDSSTASTPVAEQIERALDEVTSSQPPPLPPPPPPAQETQEPSPILDSEETRAAAPQAWAGPMEEPPQAQAPPRGPGSPAEDLM
FMESAEQAVLAAPVEPATADATEIHDAADTIETDTATADTTVANNVPPAATSLIDLWPGNGEGASTLQGEPRAPTPPSGTEVTLAEVPLL
DEVAPEPLLPAGEGCATLLNFDELPEPPATFCDPEEVEGESLAAPQTPTLPSALEELEQEQEPEPHLLTNGETTQKEGTQASEGYFSQSQ

>In-frame_LMAN2_ENST00000303127_chr5_176778174_-_DBN1_ENST00000292385_chr5_176887704_-_498aa
MAAEGWIWRWGWGRRCLGRPGLLGPGPGPTTPLFLLLLLGSVTADITDGNSEHLKREHSLIKPYQGVGSSSMPLWDFQGSTMLTSQYVRL
TPDERSKEGSIWNHQGDHRDEEEETHMKKSESEVEEAAAIIAQRPDNPREFFKQQERVASASAGSCDVPSPFNHRPGSHLDSHRRMAPTP
IPTRSPSDSSTASTPVAEQIERALDEVTSSQPPPLPPPPPPAQETQEPSPILDSEETRAAAPQAWAGPMEEPPQAQAPPRGPGSPAEDLM
FMESAEQAVLAAPVEPATADATEIHDAADTIETDTATADTTVANNVPPAATSLIDLWPGNGEGASTLQGEPRAPTPPSGTEVTLAEVPLL
DEVAPEPLLPAGEGCATLLNFDELPEPPATFCDPEEVEGESLAAPQTPTLPSALEELEQEQEPEPHLLTNGETTQKEGTQASEGYFSQSQ

>In-frame_LMAN2_ENST00000303127_chr5_176778174_-_DBN1_ENST00000393565_chr5_176887704_-_544aa
MAAEGWIWRWGWGRRCLGRPGLLGPGPGPTTPLFLLLLLGSVTADITDGNSEHLKREHSLIKPYQGVGSSSMPLWDFQGSTMLTSQYVRL
TPDERSKEGSIWNHQGDHRDEEEETHMKKSESEVEEAAAIIAQRPDNPREFFKQQERVASASAGSCDVPSPFNHRPGRPYCPFIKASDSG
PSSSSSSSSSPPRTPFPTITCHRTPNLSSSLPCSHLDSHRRMAPTPIPTRSPSDSSTASTPVAEQIERALDEVTSSQPPPLPPPPPPAQE
TQEPSPILDSEETRAAAPQAWAGPMEEPPQAQAPPRGPGSPAEDLMFMESAEQAVLAAPVEPATADATEIHDAADTIETDTATADTTVAN
NVPPAATSLIDLWPGNGEGASTLQGEPRAPTPPSGTEVTLAEVPLLDEVAPEPLLPAGEGCATLLNFDELPEPPATFCDPEEVEGESLAA
PQTPTLPSALEELEQEQEPEPHLLTNGETTQKEGTQASEGYFSQSQEEEFAQSEELCAKAPPPVFYNKPPEIDITCWDADPVPEEEEGFE

>In-frame_LMAN2_ENST00000515209_chr5_176778174_-_DBN1_ENST00000309007_chr5_176887704_-_498aa
MAAEGWIWRWGWGRRCLGRPGLLGPGPGPTTPLFLLLLLGSVTADITDGNSEHLKREHSLIKPYQGVGSSSMPLWDFQGSTMLTSQYVRL
TPDERSKEGSIWNHQGDHRDEEEETHMKKSESEVEEAAAIIAQRPDNPREFFKQQERVASASAGSCDVPSPFNHRPGSHLDSHRRMAPTP
IPTRSPSDSSTASTPVAEQIERALDEVTSSQPPPLPPPPPPAQETQEPSPILDSEETRAAAPQAWAGPMEEPPQAQAPPRGPGSPAEDLM
FMESAEQAVLAAPVEPATADATEIHDAADTIETDTATADTTVANNVPPAATSLIDLWPGNGEGASTLQGEPRAPTPPSGTEVTLAEVPLL
DEVAPEPLLPAGEGCATLLNFDELPEPPATFCDPEEVEGESLAAPQTPTLPSALEELEQEQEPEPHLLTNGETTQKEGTQASEGYFSQSQ

>In-frame_LMAN2_ENST00000515209_chr5_176778174_-_DBN1_ENST00000292385_chr5_176887704_-_498aa
MAAEGWIWRWGWGRRCLGRPGLLGPGPGPTTPLFLLLLLGSVTADITDGNSEHLKREHSLIKPYQGVGSSSMPLWDFQGSTMLTSQYVRL
TPDERSKEGSIWNHQGDHRDEEEETHMKKSESEVEEAAAIIAQRPDNPREFFKQQERVASASAGSCDVPSPFNHRPGSHLDSHRRMAPTP
IPTRSPSDSSTASTPVAEQIERALDEVTSSQPPPLPPPPPPAQETQEPSPILDSEETRAAAPQAWAGPMEEPPQAQAPPRGPGSPAEDLM
FMESAEQAVLAAPVEPATADATEIHDAADTIETDTATADTTVANNVPPAATSLIDLWPGNGEGASTLQGEPRAPTPPSGTEVTLAEVPLL
DEVAPEPLLPAGEGCATLLNFDELPEPPATFCDPEEVEGESLAAPQTPTLPSALEELEQEQEPEPHLLTNGETTQKEGTQASEGYFSQSQ

>In-frame_LMAN2_ENST00000515209_chr5_176778174_-_DBN1_ENST00000393565_chr5_176887704_-_544aa
MAAEGWIWRWGWGRRCLGRPGLLGPGPGPTTPLFLLLLLGSVTADITDGNSEHLKREHSLIKPYQGVGSSSMPLWDFQGSTMLTSQYVRL
TPDERSKEGSIWNHQGDHRDEEEETHMKKSESEVEEAAAIIAQRPDNPREFFKQQERVASASAGSCDVPSPFNHRPGRPYCPFIKASDSG
PSSSSSSSSSPPRTPFPTITCHRTPNLSSSLPCSHLDSHRRMAPTPIPTRSPSDSSTASTPVAEQIERALDEVTSSQPPPLPPPPPPAQE
TQEPSPILDSEETRAAAPQAWAGPMEEPPQAQAPPRGPGSPAEDLMFMESAEQAVLAAPVEPATADATEIHDAADTIETDTATADTTVAN
NVPPAATSLIDLWPGNGEGASTLQGEPRAPTPPSGTEVTLAEVPLLDEVAPEPLLPAGEGCATLLNFDELPEPPATFCDPEEVEGESLAA
PQTPTLPSALEELEQEQEPEPHLLTNGETTQKEGTQASEGYFSQSQEEEFAQSEELCAKAPPPVFYNKPPEIDITCWDADPVPEEEEGFE


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_LMAN2_ENST00000303127_chr5_176761285_-_DBN1_ENST00000309007_chr5_176895221_-_2718nt
ATGGCGGCGGAAGGCTGGATTTGGCGTTGGGGCTGGGGCCGGCGGTGCCTGGGAAGGCCTGGGCTTCTCGGCCCCGGCCCTGGCCCCACT
ACACCTCTCTTTCTTCTTTTGTTGTTGGGGTCTGTGACTGCGGATATAACTGACGGCAACAGTGAACATCTCAAGCGGGAGCATTCGCTC
ATTAAGCCCTACCAAGGGGTCGGTTCCAGCTCTATGCCCCTCTGGGACTTCCAGGGCAGCACTATGCTCACGAGCCAGTACGTACGTCTG
ACCCCTGACGAGCGCAGCAAAGAGGGCTCTATCTGGAACCACCAGCCGTGCTTCCTCAAAGACTGGGAAATGCACGTCCACTTCAAAGTC
CACGGCACAGGGAAGAAGAACCTCCATGGAGACGGCATCGCCTTGTGGTACACCCGGGACCGCCTCGTGCCAGGGCCTGTGTTTGGAAGC
AAAGATAACTTCCACGGCTTAGCCATCTTCCTGGACACCTACCCCAATGATGAGACCACTGAGCGCGTGTTCCCGTACATCTCGGTGATG
GTGAACAATGGCTCCCTGTCCTACGACCACAGCAAGGATGGGCGCTGGACCGAGCTGGCGGGCTGCACGGCTGACTTCCGCAACCGCGAT
CACGACACCTTCCTGGCTGTGCGCTACTCCCGGGGCCGTCTGACGGTGATGACCGACCTGGAGGACAAGAACGAGTGGAAGAACTGCATT
GACATCACGGGAGTGCGCCTGCCCACCGGCTACTACTTCGGGGCCTCCGCCGGCACCGGCGACCTGTCTGACAATCATGACATCATCTCC
ATGAAGCTGTTCCAGCTGATGGTGGAGCACACGCCCGACGAGGAGAGCATCGACTGGACCAAGATCGAGCCCAGCGTCAACTTCCTCAAG
TCGCCCAAAGAAGGGGGCTTGCAGGAGCTTTCGGGACACTTTGAGAACCAGAAGGTGATGTACGGCTTCTGCAGTGTCAAGGACTCCCAA
GCTGCTCTGCCAAAATACGTGCTCATCAACTGGGTGGGCGAAGATGTGCCTGATGCCCGCAAGTGCGCTTGTGCCAGCCACGTGGCTAAG
GTGGCGGAGTTCTTCCAGGGTGTCGACGTGATCGTGAACGCCAGCAGCGTGGAAGACATAGACGCGGGTGCCATCGGGCAGCGGCTCTCT
AACGGGCTGGCGCGACTCTCCAGCCCTGTGCTGCACCGACTGCGGCTGCGAGAGGATGAGAACGCAGAGCCCGTGGGCACCACCTACCAG
AAGACGGATGCAGCTGTGGAAATGAAGCGGATTAACCGAGAGCAGTTCTGGGAGCAGGCCAAGAAGGAAGAAGAGCTGCGGAAGGAGGAG
GAGCGGAAGAAGGCCCTGGATGAGAGGCTCAGGTTCGAGCAGGAGCGGATGGAGCAGGAGCGGCAGGAGCAAGAGGAGCGCGAGCGGCGC
TACCGGGAGCGGGAGCAGCAGATCGAGGAGCACAGGAGGAAACAGCAGACTTTAGAAGCGGAAGAGGCCAAGAGGCGGTTGAAGGAGCAG
TCTATCTTTGGTGACCATCGGGATGAGGAGGAAGAGACCCACATGAAGAAGTCAGAGTCGGAGGTGGAGGAGGCAGCAGCTATTATTGCC
CAGCGGCCTGACAACCCAAGGGAGTTCTTCAAGCAGCAGGAAAGAGTCGCATCGGCCTCTGCGGGCAGCTGTGATGTACCCTCGCCCTTC
AACCATCGACCAGGCAGCCACCTGGACAGCCACCGGAGGATGGCGCCCACTCCCATCCCCACGCGGAGCCCGTCTGACTCCAGCACCGCC
TCCACCCCTGTCGCTGAGCAGATAGAGCGGGCCCTGGATGAGGTCACCTCCTCGCAGCCTCCACCACTGCCACCGCCACCCCCACCAGCC
CAAGAGACCCAGGAGCCCAGCCCCATCCTAGACAGTGAGGAGACCAGAGCAGCAGCCCCTCAGGCCTGGGCCGGCCCCATGGAGGAGCCC
CCTCAGGCACAGGCGCCTCCCCGGGGGCCAGGCAGCCCTGCAGAGGACTTGATGTTCATGGAGTCTGCAGAGCAGGCTGTCCTGGCTGCT
CCCGTGGAGCCTGCCACAGCTGACGCCACGGAGATCCACGATGCAGCTGACACCATTGAAACTGACACTGCCACTGCTGACACCACTGTT
GCCAACAACGTACCCCCCGCCGCCACCAGCCTCATTGACCTATGGCCTGGCAACGGGGAAGGGGCCTCCACACTCCAGGGTGAGCCCAGG
GCCCCCACGCCACCCTCGGGTACTGAGGTCACCCTGGCAGAGGTGCCCCTGCTGGATGAGGTGGCTCCGGAGCCACTGCTGCCAGCAGGC
GAAGGCTGTGCCACCCTTCTCAACTTTGATGAGCTGCCTGAGCCGCCAGCCACCTTCTGTGACCCAGAGGAAGTGGAAGGGGAGTCCCTG
GCTGCCCCCCAGACCCCAACTCTGCCCTCAGCCCTTGAGGAGCTGGAGCAAGAGCAGGAGCCGGAGCCCCACCTGCTAACCAATGGCGAG
ACCACCCAGAAGGAGGGGACCCAGGCCAGTGAGGGGTACTTCAGTCAATCACAGGAGGAGGAGTTTGCCCAATCGGAAGAGCTCTGTGCC
AAGGCTCCGCCTCCTGTGTTCTACAACAAGCCTCCAGAGATCGACATCACATGCTGGGATGCAGACCCAGTTCCAGAAGAGGAGGAGGGC

>In-frame_LMAN2_ENST00000303127_chr5_176761285_-_DBN1_ENST00000292385_chr5_176895221_-_2718nt
ATGGCGGCGGAAGGCTGGATTTGGCGTTGGGGCTGGGGCCGGCGGTGCCTGGGAAGGCCTGGGCTTCTCGGCCCCGGCCCTGGCCCCACT
ACACCTCTCTTTCTTCTTTTGTTGTTGGGGTCTGTGACTGCGGATATAACTGACGGCAACAGTGAACATCTCAAGCGGGAGCATTCGCTC
ATTAAGCCCTACCAAGGGGTCGGTTCCAGCTCTATGCCCCTCTGGGACTTCCAGGGCAGCACTATGCTCACGAGCCAGTACGTACGTCTG
ACCCCTGACGAGCGCAGCAAAGAGGGCTCTATCTGGAACCACCAGCCGTGCTTCCTCAAAGACTGGGAAATGCACGTCCACTTCAAAGTC
CACGGCACAGGGAAGAAGAACCTCCATGGAGACGGCATCGCCTTGTGGTACACCCGGGACCGCCTCGTGCCAGGGCCTGTGTTTGGAAGC
AAAGATAACTTCCACGGCTTAGCCATCTTCCTGGACACCTACCCCAATGATGAGACCACTGAGCGCGTGTTCCCGTACATCTCGGTGATG
GTGAACAATGGCTCCCTGTCCTACGACCACAGCAAGGATGGGCGCTGGACCGAGCTGGCGGGCTGCACGGCTGACTTCCGCAACCGCGAT
CACGACACCTTCCTGGCTGTGCGCTACTCCCGGGGCCGTCTGACGGTGATGACCGACCTGGAGGACAAGAACGAGTGGAAGAACTGCATT
GACATCACGGGAGTGCGCCTGCCCACCGGCTACTACTTCGGGGCCTCCGCCGGCACCGGCGACCTGTCTGACAATCATGACATCATCTCC
ATGAAGCTGTTCCAGCTGATGGTGGAGCACACGCCCGACGAGGAGAGCATCGACTGGACCAAGATCGAGCCCAGCGTCAACTTCCTCAAG
TCGCCCAAAGAAGGGGGCTTGCAGGAGCTTTCGGGACACTTTGAGAACCAGAAGGTGATGTACGGCTTCTGCAGTGTCAAGGACTCCCAA
GCTGCTCTGCCAAAATACGTGCTCATCAACTGGGTGGGCGAAGATGTGCCTGATGCCCGCAAGTGCGCTTGTGCCAGCCACGTGGCTAAG
GTGGCGGAGTTCTTCCAGGGTGTCGACGTGATCGTGAACGCCAGCAGCGTGGAAGACATAGACGCGGGTGCCATCGGGCAGCGGCTCTCT
AACGGGCTGGCGCGACTCTCCAGCCCTGTGCTGCACCGACTGCGGCTGCGAGAGGATGAGAACGCAGAGCCCGTGGGCACCACCTACCAG
AAGACGGATGCAGCTGTGGAAATGAAGCGGATTAACCGAGAGCAGTTCTGGGAGCAGGCCAAGAAGGAAGAAGAGCTGCGGAAGGAGGAG
GAGCGGAAGAAGGCCCTGGATGAGAGGCTCAGGTTCGAGCAGGAGCGGATGGAGCAGGAGCGGCAGGAGCAAGAGGAGCGCGAGCGGCGC
TACCGGGAGCGGGAGCAGCAGATCGAGGAGCACAGGAGGAAACAGCAGACTTTAGAAGCGGAAGAGGCCAAGAGGCGGTTGAAGGAGCAG
TCTATCTTTGGTGACCATCGGGATGAGGAGGAAGAGACCCACATGAAGAAGTCAGAGTCGGAGGTGGAGGAGGCAGCAGCTATTATTGCC
CAGCGGCCTGACAACCCAAGGGAGTTCTTCAAGCAGCAGGAAAGAGTCGCATCGGCCTCTGCGGGCAGCTGTGATGTACCCTCGCCCTTC
AACCATCGACCAGGCAGCCACCTGGACAGCCACCGGAGGATGGCGCCCACTCCCATCCCCACGCGGAGCCCGTCTGACTCCAGCACCGCC
TCCACCCCTGTCGCTGAGCAGATAGAGCGGGCCCTGGATGAGGTCACCTCCTCGCAGCCTCCACCACTGCCACCGCCACCCCCACCAGCC
CAAGAGACCCAGGAGCCCAGCCCCATCCTAGACAGTGAGGAGACCAGAGCAGCAGCCCCTCAGGCCTGGGCCGGCCCCATGGAGGAGCCC
CCTCAGGCACAGGCGCCTCCCCGGGGGCCAGGCAGCCCTGCAGAGGACTTGATGTTCATGGAGTCTGCAGAGCAGGCTGTCCTGGCTGCT
CCCGTGGAGCCTGCCACAGCTGACGCCACGGAGATCCACGATGCAGCTGACACCATTGAAACTGACACTGCCACTGCTGACACCACTGTT
GCCAACAACGTACCCCCCGCCGCCACCAGCCTCATTGACCTATGGCCTGGCAACGGGGAAGGGGCCTCCACACTCCAGGGTGAGCCCAGG
GCCCCCACGCCACCCTCGGGTACTGAGGTCACCCTGGCAGAGGTGCCCCTGCTGGATGAGGTGGCTCCGGAGCCACTGCTGCCAGCAGGC
GAAGGCTGTGCCACCCTTCTCAACTTTGATGAGCTGCCTGAGCCGCCAGCCACCTTCTGTGACCCAGAGGAAGTGGAAGGGGAGTCCCTG
GCTGCCCCCCAGACCCCAACTCTGCCCTCAGCCCTTGAGGAGCTGGAGCAAGAGCAGGAGCCGGAGCCCCACCTGCTAACCAATGGCGAG
ACCACCCAGAAGGAGGGGACCCAGGCCAGTGAGGGGTACTTCAGTCAATCACAGGAGGAGGAGTTTGCCCAATCGGAAGAGCTCTGTGCC
AAGGCTCCGCCTCCTGTGTTCTACAACAAGCCTCCAGAGATCGACATCACATGCTGGGATGCAGACCCAGTTCCAGAAGAGGAGGAGGGC

>In-frame_LMAN2_ENST00000303127_chr5_176761285_-_DBN1_ENST00000393565_chr5_176895221_-_2856nt
ATGGCGGCGGAAGGCTGGATTTGGCGTTGGGGCTGGGGCCGGCGGTGCCTGGGAAGGCCTGGGCTTCTCGGCCCCGGCCCTGGCCCCACT
ACACCTCTCTTTCTTCTTTTGTTGTTGGGGTCTGTGACTGCGGATATAACTGACGGCAACAGTGAACATCTCAAGCGGGAGCATTCGCTC
ATTAAGCCCTACCAAGGGGTCGGTTCCAGCTCTATGCCCCTCTGGGACTTCCAGGGCAGCACTATGCTCACGAGCCAGTACGTACGTCTG
ACCCCTGACGAGCGCAGCAAAGAGGGCTCTATCTGGAACCACCAGCCGTGCTTCCTCAAAGACTGGGAAATGCACGTCCACTTCAAAGTC
CACGGCACAGGGAAGAAGAACCTCCATGGAGACGGCATCGCCTTGTGGTACACCCGGGACCGCCTCGTGCCAGGGCCTGTGTTTGGAAGC
AAAGATAACTTCCACGGCTTAGCCATCTTCCTGGACACCTACCCCAATGATGAGACCACTGAGCGCGTGTTCCCGTACATCTCGGTGATG
GTGAACAATGGCTCCCTGTCCTACGACCACAGCAAGGATGGGCGCTGGACCGAGCTGGCGGGCTGCACGGCTGACTTCCGCAACCGCGAT
CACGACACCTTCCTGGCTGTGCGCTACTCCCGGGGCCGTCTGACGGTGATGACCGACCTGGAGGACAAGAACGAGTGGAAGAACTGCATT
GACATCACGGGAGTGCGCCTGCCCACCGGCTACTACTTCGGGGCCTCCGCCGGCACCGGCGACCTGTCTGACAATCATGACATCATCTCC
ATGAAGCTGTTCCAGCTGATGGTGGAGCACACGCCCGACGAGGAGAGCATCGACTGGACCAAGATCGAGCCCAGCGTCAACTTCCTCAAG
TCGCCCAAAGAAGGGGGCTTGCAGGAGCTTTCGGGACACTTTGAGAACCAGAAGGTGATGTACGGCTTCTGCAGTGTCAAGGACTCCCAA
GCTGCTCTGCCAAAATACGTGCTCATCAACTGGGTGGGCGAAGATGTGCCTGATGCCCGCAAGTGCGCTTGTGCCAGCCACGTGGCTAAG
GTGGCGGAGTTCTTCCAGGGTGTCGACGTGATCGTGAACGCCAGCAGCGTGGAAGACATAGACGCGGGTGCCATCGGGCAGCGGCTCTCT
AACGGGCTGGCGCGACTCTCCAGCCCTGTGCTGCACCGACTGCGGCTGCGAGAGGATGAGAACGCAGAGCCCGTGGGCACCACCTACCAG
AAGACGGATGCAGCTGTGGAAATGAAGCGGATTAACCGAGAGCAGTTCTGGGAGCAGGCCAAGAAGGAAGAAGAGCTGCGGAAGGAGGAG
GAGCGGAAGAAGGCCCTGGATGAGAGGCTCAGGTTCGAGCAGGAGCGGATGGAGCAGGAGCGGCAGGAGCAAGAGGAGCGCGAGCGGCGC
TACCGGGAGCGGGAGCAGCAGATCGAGGAGCACAGGAGGAAACAGCAGACTTTAGAAGCGGAAGAGGCCAAGAGGCGGTTGAAGGAGCAG
TCTATCTTTGGTGACCATCGGGATGAGGAGGAAGAGACCCACATGAAGAAGTCAGAGTCGGAGGTGGAGGAGGCAGCAGCTATTATTGCC
CAGCGGCCTGACAACCCAAGGGAGTTCTTCAAGCAGCAGGAAAGAGTCGCATCGGCCTCTGCGGGCAGCTGTGATGTACCCTCGCCCTTC
AACCATCGACCAGGTCGTCCGTACTGCCCTTTCATAAAGGCATCGGACAGTGGGCCTTCCTCCTCCTCCTCTTCCTCCTCCTCCCCTCCA
CGGACTCCCTTTCCCTATATCACCTGCCACCGCACCCCAAACCTCTCTTCCTCCCTCCCATGCAGCCACCTGGACAGCCACCGGAGGATG
GCGCCCACTCCCATCCCCACGCGGAGCCCGTCTGACTCCAGCACCGCCTCCACCCCTGTCGCTGAGCAGATAGAGCGGGCCCTGGATGAG
GTCACCTCCTCGCAGCCTCCACCACTGCCACCGCCACCCCCACCAGCCCAAGAGACCCAGGAGCCCAGCCCCATCCTAGACAGTGAGGAG
ACCAGAGCAGCAGCCCCTCAGGCCTGGGCCGGCCCCATGGAGGAGCCCCCTCAGGCACAGGCGCCTCCCCGGGGGCCAGGCAGCCCTGCA
GAGGACTTGATGTTCATGGAGTCTGCAGAGCAGGCTGTCCTGGCTGCTCCCGTGGAGCCTGCCACAGCTGACGCCACGGAGATCCACGAT
GCAGCTGACACCATTGAAACTGACACTGCCACTGCTGACACCACTGTTGCCAACAACGTACCCCCCGCCGCCACCAGCCTCATTGACCTA
TGGCCTGGCAACGGGGAAGGGGCCTCCACACTCCAGGGTGAGCCCAGGGCCCCCACGCCACCCTCGGGTACTGAGGTCACCCTGGCAGAG
GTGCCCCTGCTGGATGAGGTGGCTCCGGAGCCACTGCTGCCAGCAGGCGAAGGCTGTGCCACCCTTCTCAACTTTGATGAGCTGCCTGAG
CCGCCAGCCACCTTCTGTGACCCAGAGGAAGTGGAAGGGGAGTCCCTGGCTGCCCCCCAGACCCCAACTCTGCCCTCAGCCCTTGAGGAG
CTGGAGCAAGAGCAGGAGCCGGAGCCCCACCTGCTAACCAATGGCGAGACCACCCAGAAGGAGGGGACCCAGGCCAGTGAGGGGTACTTC
AGTCAATCACAGGAGGAGGAGTTTGCCCAATCGGAAGAGCTCTGTGCCAAGGCTCCGCCTCCTGTGTTCTACAACAAGCCTCCAGAGATC

>In-frame_LMAN2_ENST00000515209_chr5_176761285_-_DBN1_ENST00000309007_chr5_176895221_-_2718nt
ATGGCGGCGGAAGGCTGGATTTGGCGTTGGGGCTGGGGCCGGCGGTGCCTGGGAAGGCCTGGGCTTCTCGGCCCCGGCCCTGGCCCCACT
ACACCTCTCTTTCTTCTTTTGTTGTTGGGGTCTGTGACTGCGGATATAACTGACGGCAACAGTGAACATCTCAAGCGGGAGCATTCGCTC
ATTAAGCCCTACCAAGGGGTCGGTTCCAGCTCTATGCCCCTCTGGGACTTCCAGGGCAGCACTATGCTCACGAGCCAGTACGTACGTCTG
ACCCCTGACGAGCGCAGCAAAGAGGGCTCTATCTGGAACCACCAGCCGTGCTTCCTCAAAGACTGGGAAATGCACGTCCACTTCAAAGTC
CACGGCACAGGGAAGAAGAACCTCCATGGAGACGGCATCGCCTTGTGGTACACCCGGGACCGCCTCGTGCCAGGGCCTGTGTTTGGAAGC
AAAGATAACTTCCACGGCTTAGCCATCTTCCTGGACACCTACCCCAATGATGAGACCACTGAGCGCGTGTTCCCGTACATCTCGGTGATG
GTGAACAATGGCTCCCTGTCCTACGACCACAGCAAGGATGGGCGCTGGACCGAGCTGGCGGGCTGCACGGCTGACTTCCGCAACCGCGAT
CACGACACCTTCCTGGCTGTGCGCTACTCCCGGGGCCGTCTGACGGTGATGACCGACCTGGAGGACAAGAACGAGTGGAAGAACTGCATT
GACATCACGGGAGTGCGCCTGCCCACCGGCTACTACTTCGGGGCCTCCGCCGGCACCGGCGACCTGTCTGACAATCATGACATCATCTCC
ATGAAGCTGTTCCAGCTGATGGTGGAGCACACGCCCGACGAGGAGAGCATCGACTGGACCAAGATCGAGCCCAGCGTCAACTTCCTCAAG
TCGCCCAAAGAAGGGGGCTTGCAGGAGCTTTCGGGACACTTTGAGAACCAGAAGGTGATGTACGGCTTCTGCAGTGTCAAGGACTCCCAA
GCTGCTCTGCCAAAATACGTGCTCATCAACTGGGTGGGCGAAGATGTGCCTGATGCCCGCAAGTGCGCTTGTGCCAGCCACGTGGCTAAG
GTGGCGGAGTTCTTCCAGGGTGTCGACGTGATCGTGAACGCCAGCAGCGTGGAAGACATAGACGCGGGTGCCATCGGGCAGCGGCTCTCT
AACGGGCTGGCGCGACTCTCCAGCCCTGTGCTGCACCGACTGCGGCTGCGAGAGGATGAGAACGCAGAGCCCGTGGGCACCACCTACCAG
AAGACGGATGCAGCTGTGGAAATGAAGCGGATTAACCGAGAGCAGTTCTGGGAGCAGGCCAAGAAGGAAGAAGAGCTGCGGAAGGAGGAG
GAGCGGAAGAAGGCCCTGGATGAGAGGCTCAGGTTCGAGCAGGAGCGGATGGAGCAGGAGCGGCAGGAGCAAGAGGAGCGCGAGCGGCGC
TACCGGGAGCGGGAGCAGCAGATCGAGGAGCACAGGAGGAAACAGCAGACTTTAGAAGCGGAAGAGGCCAAGAGGCGGTTGAAGGAGCAG
TCTATCTTTGGTGACCATCGGGATGAGGAGGAAGAGACCCACATGAAGAAGTCAGAGTCGGAGGTGGAGGAGGCAGCAGCTATTATTGCC
CAGCGGCCTGACAACCCAAGGGAGTTCTTCAAGCAGCAGGAAAGAGTCGCATCGGCCTCTGCGGGCAGCTGTGATGTACCCTCGCCCTTC
AACCATCGACCAGGCAGCCACCTGGACAGCCACCGGAGGATGGCGCCCACTCCCATCCCCACGCGGAGCCCGTCTGACTCCAGCACCGCC
TCCACCCCTGTCGCTGAGCAGATAGAGCGGGCCCTGGATGAGGTCACCTCCTCGCAGCCTCCACCACTGCCACCGCCACCCCCACCAGCC
CAAGAGACCCAGGAGCCCAGCCCCATCCTAGACAGTGAGGAGACCAGAGCAGCAGCCCCTCAGGCCTGGGCCGGCCCCATGGAGGAGCCC
CCTCAGGCACAGGCGCCTCCCCGGGGGCCAGGCAGCCCTGCAGAGGACTTGATGTTCATGGAGTCTGCAGAGCAGGCTGTCCTGGCTGCT
CCCGTGGAGCCTGCCACAGCTGACGCCACGGAGATCCACGATGCAGCTGACACCATTGAAACTGACACTGCCACTGCTGACACCACTGTT
GCCAACAACGTACCCCCCGCCGCCACCAGCCTCATTGACCTATGGCCTGGCAACGGGGAAGGGGCCTCCACACTCCAGGGTGAGCCCAGG
GCCCCCACGCCACCCTCGGGTACTGAGGTCACCCTGGCAGAGGTGCCCCTGCTGGATGAGGTGGCTCCGGAGCCACTGCTGCCAGCAGGC
GAAGGCTGTGCCACCCTTCTCAACTTTGATGAGCTGCCTGAGCCGCCAGCCACCTTCTGTGACCCAGAGGAAGTGGAAGGGGAGTCCCTG
GCTGCCCCCCAGACCCCAACTCTGCCCTCAGCCCTTGAGGAGCTGGAGCAAGAGCAGGAGCCGGAGCCCCACCTGCTAACCAATGGCGAG
ACCACCCAGAAGGAGGGGACCCAGGCCAGTGAGGGGTACTTCAGTCAATCACAGGAGGAGGAGTTTGCCCAATCGGAAGAGCTCTGTGCC
AAGGCTCCGCCTCCTGTGTTCTACAACAAGCCTCCAGAGATCGACATCACATGCTGGGATGCAGACCCAGTTCCAGAAGAGGAGGAGGGC

>In-frame_LMAN2_ENST00000515209_chr5_176761285_-_DBN1_ENST00000292385_chr5_176895221_-_2718nt
ATGGCGGCGGAAGGCTGGATTTGGCGTTGGGGCTGGGGCCGGCGGTGCCTGGGAAGGCCTGGGCTTCTCGGCCCCGGCCCTGGCCCCACT
ACACCTCTCTTTCTTCTTTTGTTGTTGGGGTCTGTGACTGCGGATATAACTGACGGCAACAGTGAACATCTCAAGCGGGAGCATTCGCTC
ATTAAGCCCTACCAAGGGGTCGGTTCCAGCTCTATGCCCCTCTGGGACTTCCAGGGCAGCACTATGCTCACGAGCCAGTACGTACGTCTG
ACCCCTGACGAGCGCAGCAAAGAGGGCTCTATCTGGAACCACCAGCCGTGCTTCCTCAAAGACTGGGAAATGCACGTCCACTTCAAAGTC
CACGGCACAGGGAAGAAGAACCTCCATGGAGACGGCATCGCCTTGTGGTACACCCGGGACCGCCTCGTGCCAGGGCCTGTGTTTGGAAGC
AAAGATAACTTCCACGGCTTAGCCATCTTCCTGGACACCTACCCCAATGATGAGACCACTGAGCGCGTGTTCCCGTACATCTCGGTGATG
GTGAACAATGGCTCCCTGTCCTACGACCACAGCAAGGATGGGCGCTGGACCGAGCTGGCGGGCTGCACGGCTGACTTCCGCAACCGCGAT
CACGACACCTTCCTGGCTGTGCGCTACTCCCGGGGCCGTCTGACGGTGATGACCGACCTGGAGGACAAGAACGAGTGGAAGAACTGCATT
GACATCACGGGAGTGCGCCTGCCCACCGGCTACTACTTCGGGGCCTCCGCCGGCACCGGCGACCTGTCTGACAATCATGACATCATCTCC
ATGAAGCTGTTCCAGCTGATGGTGGAGCACACGCCCGACGAGGAGAGCATCGACTGGACCAAGATCGAGCCCAGCGTCAACTTCCTCAAG
TCGCCCAAAGAAGGGGGCTTGCAGGAGCTTTCGGGACACTTTGAGAACCAGAAGGTGATGTACGGCTTCTGCAGTGTCAAGGACTCCCAA
GCTGCTCTGCCAAAATACGTGCTCATCAACTGGGTGGGCGAAGATGTGCCTGATGCCCGCAAGTGCGCTTGTGCCAGCCACGTGGCTAAG
GTGGCGGAGTTCTTCCAGGGTGTCGACGTGATCGTGAACGCCAGCAGCGTGGAAGACATAGACGCGGGTGCCATCGGGCAGCGGCTCTCT
AACGGGCTGGCGCGACTCTCCAGCCCTGTGCTGCACCGACTGCGGCTGCGAGAGGATGAGAACGCAGAGCCCGTGGGCACCACCTACCAG
AAGACGGATGCAGCTGTGGAAATGAAGCGGATTAACCGAGAGCAGTTCTGGGAGCAGGCCAAGAAGGAAGAAGAGCTGCGGAAGGAGGAG
GAGCGGAAGAAGGCCCTGGATGAGAGGCTCAGGTTCGAGCAGGAGCGGATGGAGCAGGAGCGGCAGGAGCAAGAGGAGCGCGAGCGGCGC
TACCGGGAGCGGGAGCAGCAGATCGAGGAGCACAGGAGGAAACAGCAGACTTTAGAAGCGGAAGAGGCCAAGAGGCGGTTGAAGGAGCAG
TCTATCTTTGGTGACCATCGGGATGAGGAGGAAGAGACCCACATGAAGAAGTCAGAGTCGGAGGTGGAGGAGGCAGCAGCTATTATTGCC
CAGCGGCCTGACAACCCAAGGGAGTTCTTCAAGCAGCAGGAAAGAGTCGCATCGGCCTCTGCGGGCAGCTGTGATGTACCCTCGCCCTTC
AACCATCGACCAGGCAGCCACCTGGACAGCCACCGGAGGATGGCGCCCACTCCCATCCCCACGCGGAGCCCGTCTGACTCCAGCACCGCC
TCCACCCCTGTCGCTGAGCAGATAGAGCGGGCCCTGGATGAGGTCACCTCCTCGCAGCCTCCACCACTGCCACCGCCACCCCCACCAGCC
CAAGAGACCCAGGAGCCCAGCCCCATCCTAGACAGTGAGGAGACCAGAGCAGCAGCCCCTCAGGCCTGGGCCGGCCCCATGGAGGAGCCC
CCTCAGGCACAGGCGCCTCCCCGGGGGCCAGGCAGCCCTGCAGAGGACTTGATGTTCATGGAGTCTGCAGAGCAGGCTGTCCTGGCTGCT
CCCGTGGAGCCTGCCACAGCTGACGCCACGGAGATCCACGATGCAGCTGACACCATTGAAACTGACACTGCCACTGCTGACACCACTGTT
GCCAACAACGTACCCCCCGCCGCCACCAGCCTCATTGACCTATGGCCTGGCAACGGGGAAGGGGCCTCCACACTCCAGGGTGAGCCCAGG
GCCCCCACGCCACCCTCGGGTACTGAGGTCACCCTGGCAGAGGTGCCCCTGCTGGATGAGGTGGCTCCGGAGCCACTGCTGCCAGCAGGC
GAAGGCTGTGCCACCCTTCTCAACTTTGATGAGCTGCCTGAGCCGCCAGCCACCTTCTGTGACCCAGAGGAAGTGGAAGGGGAGTCCCTG
GCTGCCCCCCAGACCCCAACTCTGCCCTCAGCCCTTGAGGAGCTGGAGCAAGAGCAGGAGCCGGAGCCCCACCTGCTAACCAATGGCGAG
ACCACCCAGAAGGAGGGGACCCAGGCCAGTGAGGGGTACTTCAGTCAATCACAGGAGGAGGAGTTTGCCCAATCGGAAGAGCTCTGTGCC
AAGGCTCCGCCTCCTGTGTTCTACAACAAGCCTCCAGAGATCGACATCACATGCTGGGATGCAGACCCAGTTCCAGAAGAGGAGGAGGGC

>In-frame_LMAN2_ENST00000515209_chr5_176761285_-_DBN1_ENST00000393565_chr5_176895221_-_2856nt
ATGGCGGCGGAAGGCTGGATTTGGCGTTGGGGCTGGGGCCGGCGGTGCCTGGGAAGGCCTGGGCTTCTCGGCCCCGGCCCTGGCCCCACT
ACACCTCTCTTTCTTCTTTTGTTGTTGGGGTCTGTGACTGCGGATATAACTGACGGCAACAGTGAACATCTCAAGCGGGAGCATTCGCTC
ATTAAGCCCTACCAAGGGGTCGGTTCCAGCTCTATGCCCCTCTGGGACTTCCAGGGCAGCACTATGCTCACGAGCCAGTACGTACGTCTG
ACCCCTGACGAGCGCAGCAAAGAGGGCTCTATCTGGAACCACCAGCCGTGCTTCCTCAAAGACTGGGAAATGCACGTCCACTTCAAAGTC
CACGGCACAGGGAAGAAGAACCTCCATGGAGACGGCATCGCCTTGTGGTACACCCGGGACCGCCTCGTGCCAGGGCCTGTGTTTGGAAGC
AAAGATAACTTCCACGGCTTAGCCATCTTCCTGGACACCTACCCCAATGATGAGACCACTGAGCGCGTGTTCCCGTACATCTCGGTGATG
GTGAACAATGGCTCCCTGTCCTACGACCACAGCAAGGATGGGCGCTGGACCGAGCTGGCGGGCTGCACGGCTGACTTCCGCAACCGCGAT
CACGACACCTTCCTGGCTGTGCGCTACTCCCGGGGCCGTCTGACGGTGATGACCGACCTGGAGGACAAGAACGAGTGGAAGAACTGCATT
GACATCACGGGAGTGCGCCTGCCCACCGGCTACTACTTCGGGGCCTCCGCCGGCACCGGCGACCTGTCTGACAATCATGACATCATCTCC
ATGAAGCTGTTCCAGCTGATGGTGGAGCACACGCCCGACGAGGAGAGCATCGACTGGACCAAGATCGAGCCCAGCGTCAACTTCCTCAAG
TCGCCCAAAGAAGGGGGCTTGCAGGAGCTTTCGGGACACTTTGAGAACCAGAAGGTGATGTACGGCTTCTGCAGTGTCAAGGACTCCCAA
GCTGCTCTGCCAAAATACGTGCTCATCAACTGGGTGGGCGAAGATGTGCCTGATGCCCGCAAGTGCGCTTGTGCCAGCCACGTGGCTAAG
GTGGCGGAGTTCTTCCAGGGTGTCGACGTGATCGTGAACGCCAGCAGCGTGGAAGACATAGACGCGGGTGCCATCGGGCAGCGGCTCTCT
AACGGGCTGGCGCGACTCTCCAGCCCTGTGCTGCACCGACTGCGGCTGCGAGAGGATGAGAACGCAGAGCCCGTGGGCACCACCTACCAG
AAGACGGATGCAGCTGTGGAAATGAAGCGGATTAACCGAGAGCAGTTCTGGGAGCAGGCCAAGAAGGAAGAAGAGCTGCGGAAGGAGGAG
GAGCGGAAGAAGGCCCTGGATGAGAGGCTCAGGTTCGAGCAGGAGCGGATGGAGCAGGAGCGGCAGGAGCAAGAGGAGCGCGAGCGGCGC
TACCGGGAGCGGGAGCAGCAGATCGAGGAGCACAGGAGGAAACAGCAGACTTTAGAAGCGGAAGAGGCCAAGAGGCGGTTGAAGGAGCAG
TCTATCTTTGGTGACCATCGGGATGAGGAGGAAGAGACCCACATGAAGAAGTCAGAGTCGGAGGTGGAGGAGGCAGCAGCTATTATTGCC
CAGCGGCCTGACAACCCAAGGGAGTTCTTCAAGCAGCAGGAAAGAGTCGCATCGGCCTCTGCGGGCAGCTGTGATGTACCCTCGCCCTTC
AACCATCGACCAGGTCGTCCGTACTGCCCTTTCATAAAGGCATCGGACAGTGGGCCTTCCTCCTCCTCCTCTTCCTCCTCCTCCCCTCCA
CGGACTCCCTTTCCCTATATCACCTGCCACCGCACCCCAAACCTCTCTTCCTCCCTCCCATGCAGCCACCTGGACAGCCACCGGAGGATG
GCGCCCACTCCCATCCCCACGCGGAGCCCGTCTGACTCCAGCACCGCCTCCACCCCTGTCGCTGAGCAGATAGAGCGGGCCCTGGATGAG
GTCACCTCCTCGCAGCCTCCACCACTGCCACCGCCACCCCCACCAGCCCAAGAGACCCAGGAGCCCAGCCCCATCCTAGACAGTGAGGAG
ACCAGAGCAGCAGCCCCTCAGGCCTGGGCCGGCCCCATGGAGGAGCCCCCTCAGGCACAGGCGCCTCCCCGGGGGCCAGGCAGCCCTGCA
GAGGACTTGATGTTCATGGAGTCTGCAGAGCAGGCTGTCCTGGCTGCTCCCGTGGAGCCTGCCACAGCTGACGCCACGGAGATCCACGAT
GCAGCTGACACCATTGAAACTGACACTGCCACTGCTGACACCACTGTTGCCAACAACGTACCCCCCGCCGCCACCAGCCTCATTGACCTA
TGGCCTGGCAACGGGGAAGGGGCCTCCACACTCCAGGGTGAGCCCAGGGCCCCCACGCCACCCTCGGGTACTGAGGTCACCCTGGCAGAG
GTGCCCCTGCTGGATGAGGTGGCTCCGGAGCCACTGCTGCCAGCAGGCGAAGGCTGTGCCACCCTTCTCAACTTTGATGAGCTGCCTGAG
CCGCCAGCCACCTTCTGTGACCCAGAGGAAGTGGAAGGGGAGTCCCTGGCTGCCCCCCAGACCCCAACTCTGCCCTCAGCCCTTGAGGAG
CTGGAGCAAGAGCAGGAGCCGGAGCCCCACCTGCTAACCAATGGCGAGACCACCCAGAAGGAGGGGACCCAGGCCAGTGAGGGGTACTTC
AGTCAATCACAGGAGGAGGAGTTTGCCCAATCGGAAGAGCTCTGTGCCAAGGCTCCGCCTCCTGTGTTCTACAACAAGCCTCCAGAGATC

>In-frame_LMAN2_ENST00000303127_chr5_176778174_-_DBN1_ENST00000309007_chr5_176887704_-_1494nt
ATGGCGGCGGAAGGCTGGATTTGGCGTTGGGGCTGGGGCCGGCGGTGCCTGGGAAGGCCTGGGCTTCTCGGCCCCGGCCCTGGCCCCACT
ACACCTCTCTTTCTTCTTTTGTTGTTGGGGTCTGTGACTGCGGATATAACTGACGGCAACAGTGAACATCTCAAGCGGGAGCATTCGCTC
ATTAAGCCCTACCAAGGGGTCGGTTCCAGCTCTATGCCCCTCTGGGACTTCCAGGGCAGCACTATGCTCACGAGCCAGTACGTACGTCTG
ACCCCTGACGAGCGCAGCAAAGAGGGCTCTATCTGGAACCACCAGGGTGACCATCGGGATGAGGAGGAAGAGACCCACATGAAGAAGTCA
GAGTCGGAGGTGGAGGAGGCAGCAGCTATTATTGCCCAGCGGCCTGACAACCCAAGGGAGTTCTTCAAGCAGCAGGAAAGAGTCGCATCG
GCCTCTGCGGGCAGCTGTGATGTACCCTCGCCCTTCAACCATCGACCAGGCAGCCACCTGGACAGCCACCGGAGGATGGCGCCCACTCCC
ATCCCCACGCGGAGCCCGTCTGACTCCAGCACCGCCTCCACCCCTGTCGCTGAGCAGATAGAGCGGGCCCTGGATGAGGTCACCTCCTCG
CAGCCTCCACCACTGCCACCGCCACCCCCACCAGCCCAAGAGACCCAGGAGCCCAGCCCCATCCTAGACAGTGAGGAGACCAGAGCAGCA
GCCCCTCAGGCCTGGGCCGGCCCCATGGAGGAGCCCCCTCAGGCACAGGCGCCTCCCCGGGGGCCAGGCAGCCCTGCAGAGGACTTGATG
TTCATGGAGTCTGCAGAGCAGGCTGTCCTGGCTGCTCCCGTGGAGCCTGCCACAGCTGACGCCACGGAGATCCACGATGCAGCTGACACC
ATTGAAACTGACACTGCCACTGCTGACACCACTGTTGCCAACAACGTACCCCCCGCCGCCACCAGCCTCATTGACCTATGGCCTGGCAAC
GGGGAAGGGGCCTCCACACTCCAGGGTGAGCCCAGGGCCCCCACGCCACCCTCGGGTACTGAGGTCACCCTGGCAGAGGTGCCCCTGCTG
GATGAGGTGGCTCCGGAGCCACTGCTGCCAGCAGGCGAAGGCTGTGCCACCCTTCTCAACTTTGATGAGCTGCCTGAGCCGCCAGCCACC
TTCTGTGACCCAGAGGAAGTGGAAGGGGAGTCCCTGGCTGCCCCCCAGACCCCAACTCTGCCCTCAGCCCTTGAGGAGCTGGAGCAAGAG
CAGGAGCCGGAGCCCCACCTGCTAACCAATGGCGAGACCACCCAGAAGGAGGGGACCCAGGCCAGTGAGGGGTACTTCAGTCAATCACAG
GAGGAGGAGTTTGCCCAATCGGAAGAGCTCTGTGCCAAGGCTCCGCCTCCTGTGTTCTACAACAAGCCTCCAGAGATCGACATCACATGC

>In-frame_LMAN2_ENST00000303127_chr5_176778174_-_DBN1_ENST00000292385_chr5_176887704_-_1494nt
ATGGCGGCGGAAGGCTGGATTTGGCGTTGGGGCTGGGGCCGGCGGTGCCTGGGAAGGCCTGGGCTTCTCGGCCCCGGCCCTGGCCCCACT
ACACCTCTCTTTCTTCTTTTGTTGTTGGGGTCTGTGACTGCGGATATAACTGACGGCAACAGTGAACATCTCAAGCGGGAGCATTCGCTC
ATTAAGCCCTACCAAGGGGTCGGTTCCAGCTCTATGCCCCTCTGGGACTTCCAGGGCAGCACTATGCTCACGAGCCAGTACGTACGTCTG
ACCCCTGACGAGCGCAGCAAAGAGGGCTCTATCTGGAACCACCAGGGTGACCATCGGGATGAGGAGGAAGAGACCCACATGAAGAAGTCA
GAGTCGGAGGTGGAGGAGGCAGCAGCTATTATTGCCCAGCGGCCTGACAACCCAAGGGAGTTCTTCAAGCAGCAGGAAAGAGTCGCATCG
GCCTCTGCGGGCAGCTGTGATGTACCCTCGCCCTTCAACCATCGACCAGGCAGCCACCTGGACAGCCACCGGAGGATGGCGCCCACTCCC
ATCCCCACGCGGAGCCCGTCTGACTCCAGCACCGCCTCCACCCCTGTCGCTGAGCAGATAGAGCGGGCCCTGGATGAGGTCACCTCCTCG
CAGCCTCCACCACTGCCACCGCCACCCCCACCAGCCCAAGAGACCCAGGAGCCCAGCCCCATCCTAGACAGTGAGGAGACCAGAGCAGCA
GCCCCTCAGGCCTGGGCCGGCCCCATGGAGGAGCCCCCTCAGGCACAGGCGCCTCCCCGGGGGCCAGGCAGCCCTGCAGAGGACTTGATG
TTCATGGAGTCTGCAGAGCAGGCTGTCCTGGCTGCTCCCGTGGAGCCTGCCACAGCTGACGCCACGGAGATCCACGATGCAGCTGACACC
ATTGAAACTGACACTGCCACTGCTGACACCACTGTTGCCAACAACGTACCCCCCGCCGCCACCAGCCTCATTGACCTATGGCCTGGCAAC
GGGGAAGGGGCCTCCACACTCCAGGGTGAGCCCAGGGCCCCCACGCCACCCTCGGGTACTGAGGTCACCCTGGCAGAGGTGCCCCTGCTG
GATGAGGTGGCTCCGGAGCCACTGCTGCCAGCAGGCGAAGGCTGTGCCACCCTTCTCAACTTTGATGAGCTGCCTGAGCCGCCAGCCACC
TTCTGTGACCCAGAGGAAGTGGAAGGGGAGTCCCTGGCTGCCCCCCAGACCCCAACTCTGCCCTCAGCCCTTGAGGAGCTGGAGCAAGAG
CAGGAGCCGGAGCCCCACCTGCTAACCAATGGCGAGACCACCCAGAAGGAGGGGACCCAGGCCAGTGAGGGGTACTTCAGTCAATCACAG
GAGGAGGAGTTTGCCCAATCGGAAGAGCTCTGTGCCAAGGCTCCGCCTCCTGTGTTCTACAACAAGCCTCCAGAGATCGACATCACATGC

>In-frame_LMAN2_ENST00000303127_chr5_176778174_-_DBN1_ENST00000393565_chr5_176887704_-_1632nt
ATGGCGGCGGAAGGCTGGATTTGGCGTTGGGGCTGGGGCCGGCGGTGCCTGGGAAGGCCTGGGCTTCTCGGCCCCGGCCCTGGCCCCACT
ACACCTCTCTTTCTTCTTTTGTTGTTGGGGTCTGTGACTGCGGATATAACTGACGGCAACAGTGAACATCTCAAGCGGGAGCATTCGCTC
ATTAAGCCCTACCAAGGGGTCGGTTCCAGCTCTATGCCCCTCTGGGACTTCCAGGGCAGCACTATGCTCACGAGCCAGTACGTACGTCTG
ACCCCTGACGAGCGCAGCAAAGAGGGCTCTATCTGGAACCACCAGGGTGACCATCGGGATGAGGAGGAAGAGACCCACATGAAGAAGTCA
GAGTCGGAGGTGGAGGAGGCAGCAGCTATTATTGCCCAGCGGCCTGACAACCCAAGGGAGTTCTTCAAGCAGCAGGAAAGAGTCGCATCG
GCCTCTGCGGGCAGCTGTGATGTACCCTCGCCCTTCAACCATCGACCAGGTCGTCCGTACTGCCCTTTCATAAAGGCATCGGACAGTGGG
CCTTCCTCCTCCTCCTCTTCCTCCTCCTCCCCTCCACGGACTCCCTTTCCCTATATCACCTGCCACCGCACCCCAAACCTCTCTTCCTCC
CTCCCATGCAGCCACCTGGACAGCCACCGGAGGATGGCGCCCACTCCCATCCCCACGCGGAGCCCGTCTGACTCCAGCACCGCCTCCACC
CCTGTCGCTGAGCAGATAGAGCGGGCCCTGGATGAGGTCACCTCCTCGCAGCCTCCACCACTGCCACCGCCACCCCCACCAGCCCAAGAG
ACCCAGGAGCCCAGCCCCATCCTAGACAGTGAGGAGACCAGAGCAGCAGCCCCTCAGGCCTGGGCCGGCCCCATGGAGGAGCCCCCTCAG
GCACAGGCGCCTCCCCGGGGGCCAGGCAGCCCTGCAGAGGACTTGATGTTCATGGAGTCTGCAGAGCAGGCTGTCCTGGCTGCTCCCGTG
GAGCCTGCCACAGCTGACGCCACGGAGATCCACGATGCAGCTGACACCATTGAAACTGACACTGCCACTGCTGACACCACTGTTGCCAAC
AACGTACCCCCCGCCGCCACCAGCCTCATTGACCTATGGCCTGGCAACGGGGAAGGGGCCTCCACACTCCAGGGTGAGCCCAGGGCCCCC
ACGCCACCCTCGGGTACTGAGGTCACCCTGGCAGAGGTGCCCCTGCTGGATGAGGTGGCTCCGGAGCCACTGCTGCCAGCAGGCGAAGGC
TGTGCCACCCTTCTCAACTTTGATGAGCTGCCTGAGCCGCCAGCCACCTTCTGTGACCCAGAGGAAGTGGAAGGGGAGTCCCTGGCTGCC
CCCCAGACCCCAACTCTGCCCTCAGCCCTTGAGGAGCTGGAGCAAGAGCAGGAGCCGGAGCCCCACCTGCTAACCAATGGCGAGACCACC
CAGAAGGAGGGGACCCAGGCCAGTGAGGGGTACTTCAGTCAATCACAGGAGGAGGAGTTTGCCCAATCGGAAGAGCTCTGTGCCAAGGCT
CCGCCTCCTGTGTTCTACAACAAGCCTCCAGAGATCGACATCACATGCTGGGATGCAGACCCAGTTCCAGAAGAGGAGGAGGGCTTCGAG

>In-frame_LMAN2_ENST00000515209_chr5_176778174_-_DBN1_ENST00000309007_chr5_176887704_-_1494nt
ATGGCGGCGGAAGGCTGGATTTGGCGTTGGGGCTGGGGCCGGCGGTGCCTGGGAAGGCCTGGGCTTCTCGGCCCCGGCCCTGGCCCCACT
ACACCTCTCTTTCTTCTTTTGTTGTTGGGGTCTGTGACTGCGGATATAACTGACGGCAACAGTGAACATCTCAAGCGGGAGCATTCGCTC
ATTAAGCCCTACCAAGGGGTCGGTTCCAGCTCTATGCCCCTCTGGGACTTCCAGGGCAGCACTATGCTCACGAGCCAGTACGTACGTCTG
ACCCCTGACGAGCGCAGCAAAGAGGGCTCTATCTGGAACCACCAGGGTGACCATCGGGATGAGGAGGAAGAGACCCACATGAAGAAGTCA
GAGTCGGAGGTGGAGGAGGCAGCAGCTATTATTGCCCAGCGGCCTGACAACCCAAGGGAGTTCTTCAAGCAGCAGGAAAGAGTCGCATCG
GCCTCTGCGGGCAGCTGTGATGTACCCTCGCCCTTCAACCATCGACCAGGCAGCCACCTGGACAGCCACCGGAGGATGGCGCCCACTCCC
ATCCCCACGCGGAGCCCGTCTGACTCCAGCACCGCCTCCACCCCTGTCGCTGAGCAGATAGAGCGGGCCCTGGATGAGGTCACCTCCTCG
CAGCCTCCACCACTGCCACCGCCACCCCCACCAGCCCAAGAGACCCAGGAGCCCAGCCCCATCCTAGACAGTGAGGAGACCAGAGCAGCA
GCCCCTCAGGCCTGGGCCGGCCCCATGGAGGAGCCCCCTCAGGCACAGGCGCCTCCCCGGGGGCCAGGCAGCCCTGCAGAGGACTTGATG
TTCATGGAGTCTGCAGAGCAGGCTGTCCTGGCTGCTCCCGTGGAGCCTGCCACAGCTGACGCCACGGAGATCCACGATGCAGCTGACACC
ATTGAAACTGACACTGCCACTGCTGACACCACTGTTGCCAACAACGTACCCCCCGCCGCCACCAGCCTCATTGACCTATGGCCTGGCAAC
GGGGAAGGGGCCTCCACACTCCAGGGTGAGCCCAGGGCCCCCACGCCACCCTCGGGTACTGAGGTCACCCTGGCAGAGGTGCCCCTGCTG
GATGAGGTGGCTCCGGAGCCACTGCTGCCAGCAGGCGAAGGCTGTGCCACCCTTCTCAACTTTGATGAGCTGCCTGAGCCGCCAGCCACC
TTCTGTGACCCAGAGGAAGTGGAAGGGGAGTCCCTGGCTGCCCCCCAGACCCCAACTCTGCCCTCAGCCCTTGAGGAGCTGGAGCAAGAG
CAGGAGCCGGAGCCCCACCTGCTAACCAATGGCGAGACCACCCAGAAGGAGGGGACCCAGGCCAGTGAGGGGTACTTCAGTCAATCACAG
GAGGAGGAGTTTGCCCAATCGGAAGAGCTCTGTGCCAAGGCTCCGCCTCCTGTGTTCTACAACAAGCCTCCAGAGATCGACATCACATGC

>In-frame_LMAN2_ENST00000515209_chr5_176778174_-_DBN1_ENST00000292385_chr5_176887704_-_1494nt
ATGGCGGCGGAAGGCTGGATTTGGCGTTGGGGCTGGGGCCGGCGGTGCCTGGGAAGGCCTGGGCTTCTCGGCCCCGGCCCTGGCCCCACT
ACACCTCTCTTTCTTCTTTTGTTGTTGGGGTCTGTGACTGCGGATATAACTGACGGCAACAGTGAACATCTCAAGCGGGAGCATTCGCTC
ATTAAGCCCTACCAAGGGGTCGGTTCCAGCTCTATGCCCCTCTGGGACTTCCAGGGCAGCACTATGCTCACGAGCCAGTACGTACGTCTG
ACCCCTGACGAGCGCAGCAAAGAGGGCTCTATCTGGAACCACCAGGGTGACCATCGGGATGAGGAGGAAGAGACCCACATGAAGAAGTCA
GAGTCGGAGGTGGAGGAGGCAGCAGCTATTATTGCCCAGCGGCCTGACAACCCAAGGGAGTTCTTCAAGCAGCAGGAAAGAGTCGCATCG
GCCTCTGCGGGCAGCTGTGATGTACCCTCGCCCTTCAACCATCGACCAGGCAGCCACCTGGACAGCCACCGGAGGATGGCGCCCACTCCC
ATCCCCACGCGGAGCCCGTCTGACTCCAGCACCGCCTCCACCCCTGTCGCTGAGCAGATAGAGCGGGCCCTGGATGAGGTCACCTCCTCG
CAGCCTCCACCACTGCCACCGCCACCCCCACCAGCCCAAGAGACCCAGGAGCCCAGCCCCATCCTAGACAGTGAGGAGACCAGAGCAGCA
GCCCCTCAGGCCTGGGCCGGCCCCATGGAGGAGCCCCCTCAGGCACAGGCGCCTCCCCGGGGGCCAGGCAGCCCTGCAGAGGACTTGATG
TTCATGGAGTCTGCAGAGCAGGCTGTCCTGGCTGCTCCCGTGGAGCCTGCCACAGCTGACGCCACGGAGATCCACGATGCAGCTGACACC
ATTGAAACTGACACTGCCACTGCTGACACCACTGTTGCCAACAACGTACCCCCCGCCGCCACCAGCCTCATTGACCTATGGCCTGGCAAC
GGGGAAGGGGCCTCCACACTCCAGGGTGAGCCCAGGGCCCCCACGCCACCCTCGGGTACTGAGGTCACCCTGGCAGAGGTGCCCCTGCTG
GATGAGGTGGCTCCGGAGCCACTGCTGCCAGCAGGCGAAGGCTGTGCCACCCTTCTCAACTTTGATGAGCTGCCTGAGCCGCCAGCCACC
TTCTGTGACCCAGAGGAAGTGGAAGGGGAGTCCCTGGCTGCCCCCCAGACCCCAACTCTGCCCTCAGCCCTTGAGGAGCTGGAGCAAGAG
CAGGAGCCGGAGCCCCACCTGCTAACCAATGGCGAGACCACCCAGAAGGAGGGGACCCAGGCCAGTGAGGGGTACTTCAGTCAATCACAG
GAGGAGGAGTTTGCCCAATCGGAAGAGCTCTGTGCCAAGGCTCCGCCTCCTGTGTTCTACAACAAGCCTCCAGAGATCGACATCACATGC

>In-frame_LMAN2_ENST00000515209_chr5_176778174_-_DBN1_ENST00000393565_chr5_176887704_-_1632nt
ATGGCGGCGGAAGGCTGGATTTGGCGTTGGGGCTGGGGCCGGCGGTGCCTGGGAAGGCCTGGGCTTCTCGGCCCCGGCCCTGGCCCCACT
ACACCTCTCTTTCTTCTTTTGTTGTTGGGGTCTGTGACTGCGGATATAACTGACGGCAACAGTGAACATCTCAAGCGGGAGCATTCGCTC
ATTAAGCCCTACCAAGGGGTCGGTTCCAGCTCTATGCCCCTCTGGGACTTCCAGGGCAGCACTATGCTCACGAGCCAGTACGTACGTCTG
ACCCCTGACGAGCGCAGCAAAGAGGGCTCTATCTGGAACCACCAGGGTGACCATCGGGATGAGGAGGAAGAGACCCACATGAAGAAGTCA
GAGTCGGAGGTGGAGGAGGCAGCAGCTATTATTGCCCAGCGGCCTGACAACCCAAGGGAGTTCTTCAAGCAGCAGGAAAGAGTCGCATCG
GCCTCTGCGGGCAGCTGTGATGTACCCTCGCCCTTCAACCATCGACCAGGTCGTCCGTACTGCCCTTTCATAAAGGCATCGGACAGTGGG
CCTTCCTCCTCCTCCTCTTCCTCCTCCTCCCCTCCACGGACTCCCTTTCCCTATATCACCTGCCACCGCACCCCAAACCTCTCTTCCTCC
CTCCCATGCAGCCACCTGGACAGCCACCGGAGGATGGCGCCCACTCCCATCCCCACGCGGAGCCCGTCTGACTCCAGCACCGCCTCCACC
CCTGTCGCTGAGCAGATAGAGCGGGCCCTGGATGAGGTCACCTCCTCGCAGCCTCCACCACTGCCACCGCCACCCCCACCAGCCCAAGAG
ACCCAGGAGCCCAGCCCCATCCTAGACAGTGAGGAGACCAGAGCAGCAGCCCCTCAGGCCTGGGCCGGCCCCATGGAGGAGCCCCCTCAG
GCACAGGCGCCTCCCCGGGGGCCAGGCAGCCCTGCAGAGGACTTGATGTTCATGGAGTCTGCAGAGCAGGCTGTCCTGGCTGCTCCCGTG
GAGCCTGCCACAGCTGACGCCACGGAGATCCACGATGCAGCTGACACCATTGAAACTGACACTGCCACTGCTGACACCACTGTTGCCAAC
AACGTACCCCCCGCCGCCACCAGCCTCATTGACCTATGGCCTGGCAACGGGGAAGGGGCCTCCACACTCCAGGGTGAGCCCAGGGCCCCC
ACGCCACCCTCGGGTACTGAGGTCACCCTGGCAGAGGTGCCCCTGCTGGATGAGGTGGCTCCGGAGCCACTGCTGCCAGCAGGCGAAGGC
TGTGCCACCCTTCTCAACTTTGATGAGCTGCCTGAGCCGCCAGCCACCTTCTGTGACCCAGAGGAAGTGGAAGGGGAGTCCCTGGCTGCC
CCCCAGACCCCAACTCTGCCCTCAGCCCTTGAGGAGCTGGAGCAAGAGCAGGAGCCGGAGCCCCACCTGCTAACCAATGGCGAGACCACC
CAGAAGGAGGGGACCCAGGCCAGTGAGGGGTACTTCAGTCAATCACAGGAGGAGGAGTTTGCCCAATCGGAAGAGCTCTGTGCCAAGGCT
CCGCCTCCTGTGTTCTACAACAAGCCTCCAGAGATCGACATCACATGCTGGGATGCAGACCCAGTTCCAGAAGAGGAGGAGGGCTTCGAG


* Fusion transcript sequences (Full-length transcript).
>In-frame_LMAN2_ENST00000303127_chr5_176761285_-_DBN1_ENST00000309007_chr5_176895221_-_3748nt
CTTGGAGCCTCTAAGGAGATGAAACTGCACTCAACCAGGATGAGAGGCTGCCCGGCCAATGCAGCTGCCGCCCCGTCTGCTGCGGAGGCT
TTGCTTTTTGACTCCCTGGCGACAGTAAAGTTGAAGAGCTTCCGGCCGGAGGCCAATAGATGGGACCCCCGGAAGGCGGAAGTTCTAGGG
CGGAAGTGGCCGAGAGGAGAGGAGAATGGCGGCGGAAGGCTGGATTTGGCGTTGGGGCTGGGGCCGGCGGTGCCTGGGAAGGCCTGGGCT
TCTCGGCCCCGGCCCTGGCCCCACTACACCTCTCTTTCTTCTTTTGTTGTTGGGGTCTGTGACTGCGGATATAACTGACGGCAACAGTGA
ACATCTCAAGCGGGAGCATTCGCTCATTAAGCCCTACCAAGGGGTCGGTTCCAGCTCTATGCCCCTCTGGGACTTCCAGGGCAGCACTAT
GCTCACGAGCCAGTACGTACGTCTGACCCCTGACGAGCGCAGCAAAGAGGGCTCTATCTGGAACCACCAGCCGTGCTTCCTCAAAGACTG
GGAAATGCACGTCCACTTCAAAGTCCACGGCACAGGGAAGAAGAACCTCCATGGAGACGGCATCGCCTTGTGGTACACCCGGGACCGCCT
CGTGCCAGGGCCTGTGTTTGGAAGCAAAGATAACTTCCACGGCTTAGCCATCTTCCTGGACACCTACCCCAATGATGAGACCACTGAGCG
CGTGTTCCCGTACATCTCGGTGATGGTGAACAATGGCTCCCTGTCCTACGACCACAGCAAGGATGGGCGCTGGACCGAGCTGGCGGGCTG
CACGGCTGACTTCCGCAACCGCGATCACGACACCTTCCTGGCTGTGCGCTACTCCCGGGGCCGTCTGACGGTGATGACCGACCTGGAGGA
CAAGAACGAGTGGAAGAACTGCATTGACATCACGGGAGTGCGCCTGCCCACCGGCTACTACTTCGGGGCCTCCGCCGGCACCGGCGACCT
GTCTGACAATCATGACATCATCTCCATGAAGCTGTTCCAGCTGATGGTGGAGCACACGCCCGACGAGGAGAGCATCGACTGGACCAAGAT
CGAGCCCAGCGTCAACTTCCTCAAGTCGCCCAAAGAAGGGGGCTTGCAGGAGCTTTCGGGACACTTTGAGAACCAGAAGGTGATGTACGG
CTTCTGCAGTGTCAAGGACTCCCAAGCTGCTCTGCCAAAATACGTGCTCATCAACTGGGTGGGCGAAGATGTGCCTGATGCCCGCAAGTG
CGCTTGTGCCAGCCACGTGGCTAAGGTGGCGGAGTTCTTCCAGGGTGTCGACGTGATCGTGAACGCCAGCAGCGTGGAAGACATAGACGC
GGGTGCCATCGGGCAGCGGCTCTCTAACGGGCTGGCGCGACTCTCCAGCCCTGTGCTGCACCGACTGCGGCTGCGAGAGGATGAGAACGC
AGAGCCCGTGGGCACCACCTACCAGAAGACGGATGCAGCTGTGGAAATGAAGCGGATTAACCGAGAGCAGTTCTGGGAGCAGGCCAAGAA
GGAAGAAGAGCTGCGGAAGGAGGAGGAGCGGAAGAAGGCCCTGGATGAGAGGCTCAGGTTCGAGCAGGAGCGGATGGAGCAGGAGCGGCA
GGAGCAAGAGGAGCGCGAGCGGCGCTACCGGGAGCGGGAGCAGCAGATCGAGGAGCACAGGAGGAAACAGCAGACTTTAGAAGCGGAAGA
GGCCAAGAGGCGGTTGAAGGAGCAGTCTATCTTTGGTGACCATCGGGATGAGGAGGAAGAGACCCACATGAAGAAGTCAGAGTCGGAGGT
GGAGGAGGCAGCAGCTATTATTGCCCAGCGGCCTGACAACCCAAGGGAGTTCTTCAAGCAGCAGGAAAGAGTCGCATCGGCCTCTGCGGG
CAGCTGTGATGTACCCTCGCCCTTCAACCATCGACCAGGCAGCCACCTGGACAGCCACCGGAGGATGGCGCCCACTCCCATCCCCACGCG
GAGCCCGTCTGACTCCAGCACCGCCTCCACCCCTGTCGCTGAGCAGATAGAGCGGGCCCTGGATGAGGTCACCTCCTCGCAGCCTCCACC
ACTGCCACCGCCACCCCCACCAGCCCAAGAGACCCAGGAGCCCAGCCCCATCCTAGACAGTGAGGAGACCAGAGCAGCAGCCCCTCAGGC
CTGGGCCGGCCCCATGGAGGAGCCCCCTCAGGCACAGGCGCCTCCCCGGGGGCCAGGCAGCCCTGCAGAGGACTTGATGTTCATGGAGTC
TGCAGAGCAGGCTGTCCTGGCTGCTCCCGTGGAGCCTGCCACAGCTGACGCCACGGAGATCCACGATGCAGCTGACACCATTGAAACTGA
CACTGCCACTGCTGACACCACTGTTGCCAACAACGTACCCCCCGCCGCCACCAGCCTCATTGACCTATGGCCTGGCAACGGGGAAGGGGC
CTCCACACTCCAGGGTGAGCCCAGGGCCCCCACGCCACCCTCGGGTACTGAGGTCACCCTGGCAGAGGTGCCCCTGCTGGATGAGGTGGC
TCCGGAGCCACTGCTGCCAGCAGGCGAAGGCTGTGCCACCCTTCTCAACTTTGATGAGCTGCCTGAGCCGCCAGCCACCTTCTGTGACCC
AGAGGAAGTGGAAGGGGAGTCCCTGGCTGCCCCCCAGACCCCAACTCTGCCCTCAGCCCTTGAGGAGCTGGAGCAAGAGCAGGAGCCGGA
GCCCCACCTGCTAACCAATGGCGAGACCACCCAGAAGGAGGGGACCCAGGCCAGTGAGGGGTACTTCAGTCAATCACAGGAGGAGGAGTT
TGCCCAATCGGAAGAGCTCTGTGCCAAGGCTCCGCCTCCTGTGTTCTACAACAAGCCTCCAGAGATCGACATCACATGCTGGGATGCAGA
CCCAGTTCCAGAAGAGGAGGAGGGCTTCGAGGGTGGTGATTAGCGGTGGCGCCAGCCCTAGGCTACCCTTGCCAAGGCCGCCCACCTGCA
TCAGCCTCTGGCCAGACGGCCCGCCGTGCCTGCATTCGCAGCAGCTCCGCCTGGCACCCACTCCGGATTCCGGCCCTGGCTGGGGACTTG
GCCGCTTCCCTACCCACAGGGCCTGACTTTTACAGCTTTTCTCTTTTTTTAAAAAGTTGATAGGAGACTTGTACAGTTGACTGGCTTTCC
TCTCGTTGGTAGTTGAGACGCTGTTGCAAATTCCACCCCTCCTTCCCTGGTCCAGATTGTAGCTCTTAGTCCTCCCTGCTCAGCTGGCCG
GGTTGGAGGCCTCACCCTGCTTGGGGCCTGGCGTGGGGGGAGCTCTGGTGGGAAAATGTCCCCCACCTCTTTTCCTAGTTTTATGTTTCT
TGGGAAAATATCACTTTGTATTCTCTGTCCAGGGCTTCAGATATTTTGCACGAATTTTAAAACATGGCAATAAATGGCTCGTGGGCTCTG
GCTCCCTGGGACCCCCTCCCCGCCCTTCTTTTGACCCCTTCCTGTCTGGCCCAAAGGAAGTAGCAGGCCCAGCTGGGGCCCCTCGGCTAC
CCCCCGTCTCCTGCCGGGCAGGTCCCAGGTTGGAGGCCCTAGGCGCGGTTCAGGTCAGGGCTATGGATGGGGCCCAGGGGCTTTGGTGGC
CCCTCCCCAACTCCTTCCTCTTTGCTTGGGTTCCTTTTTCACGTTTAGTAACTGTTTTTTTTTTTTTTTTTTTTTTTTTTTTGGAAAGCA

>In-frame_LMAN2_ENST00000303127_chr5_176761285_-_DBN1_ENST00000292385_chr5_176895221_-_3429nt
CTTGGAGCCTCTAAGGAGATGAAACTGCACTCAACCAGGATGAGAGGCTGCCCGGCCAATGCAGCTGCCGCCCCGTCTGCTGCGGAGGCT
TTGCTTTTTGACTCCCTGGCGACAGTAAAGTTGAAGAGCTTCCGGCCGGAGGCCAATAGATGGGACCCCCGGAAGGCGGAAGTTCTAGGG
CGGAAGTGGCCGAGAGGAGAGGAGAATGGCGGCGGAAGGCTGGATTTGGCGTTGGGGCTGGGGCCGGCGGTGCCTGGGAAGGCCTGGGCT
TCTCGGCCCCGGCCCTGGCCCCACTACACCTCTCTTTCTTCTTTTGTTGTTGGGGTCTGTGACTGCGGATATAACTGACGGCAACAGTGA
ACATCTCAAGCGGGAGCATTCGCTCATTAAGCCCTACCAAGGGGTCGGTTCCAGCTCTATGCCCCTCTGGGACTTCCAGGGCAGCACTAT
GCTCACGAGCCAGTACGTACGTCTGACCCCTGACGAGCGCAGCAAAGAGGGCTCTATCTGGAACCACCAGCCGTGCTTCCTCAAAGACTG
GGAAATGCACGTCCACTTCAAAGTCCACGGCACAGGGAAGAAGAACCTCCATGGAGACGGCATCGCCTTGTGGTACACCCGGGACCGCCT
CGTGCCAGGGCCTGTGTTTGGAAGCAAAGATAACTTCCACGGCTTAGCCATCTTCCTGGACACCTACCCCAATGATGAGACCACTGAGCG
CGTGTTCCCGTACATCTCGGTGATGGTGAACAATGGCTCCCTGTCCTACGACCACAGCAAGGATGGGCGCTGGACCGAGCTGGCGGGCTG
CACGGCTGACTTCCGCAACCGCGATCACGACACCTTCCTGGCTGTGCGCTACTCCCGGGGCCGTCTGACGGTGATGACCGACCTGGAGGA
CAAGAACGAGTGGAAGAACTGCATTGACATCACGGGAGTGCGCCTGCCCACCGGCTACTACTTCGGGGCCTCCGCCGGCACCGGCGACCT
GTCTGACAATCATGACATCATCTCCATGAAGCTGTTCCAGCTGATGGTGGAGCACACGCCCGACGAGGAGAGCATCGACTGGACCAAGAT
CGAGCCCAGCGTCAACTTCCTCAAGTCGCCCAAAGAAGGGGGCTTGCAGGAGCTTTCGGGACACTTTGAGAACCAGAAGGTGATGTACGG
CTTCTGCAGTGTCAAGGACTCCCAAGCTGCTCTGCCAAAATACGTGCTCATCAACTGGGTGGGCGAAGATGTGCCTGATGCCCGCAAGTG
CGCTTGTGCCAGCCACGTGGCTAAGGTGGCGGAGTTCTTCCAGGGTGTCGACGTGATCGTGAACGCCAGCAGCGTGGAAGACATAGACGC
GGGTGCCATCGGGCAGCGGCTCTCTAACGGGCTGGCGCGACTCTCCAGCCCTGTGCTGCACCGACTGCGGCTGCGAGAGGATGAGAACGC
AGAGCCCGTGGGCACCACCTACCAGAAGACGGATGCAGCTGTGGAAATGAAGCGGATTAACCGAGAGCAGTTCTGGGAGCAGGCCAAGAA
GGAAGAAGAGCTGCGGAAGGAGGAGGAGCGGAAGAAGGCCCTGGATGAGAGGCTCAGGTTCGAGCAGGAGCGGATGGAGCAGGAGCGGCA
GGAGCAAGAGGAGCGCGAGCGGCGCTACCGGGAGCGGGAGCAGCAGATCGAGGAGCACAGGAGGAAACAGCAGACTTTAGAAGCGGAAGA
GGCCAAGAGGCGGTTGAAGGAGCAGTCTATCTTTGGTGACCATCGGGATGAGGAGGAAGAGACCCACATGAAGAAGTCAGAGTCGGAGGT
GGAGGAGGCAGCAGCTATTATTGCCCAGCGGCCTGACAACCCAAGGGAGTTCTTCAAGCAGCAGGAAAGAGTCGCATCGGCCTCTGCGGG
CAGCTGTGATGTACCCTCGCCCTTCAACCATCGACCAGGCAGCCACCTGGACAGCCACCGGAGGATGGCGCCCACTCCCATCCCCACGCG
GAGCCCGTCTGACTCCAGCACCGCCTCCACCCCTGTCGCTGAGCAGATAGAGCGGGCCCTGGATGAGGTCACCTCCTCGCAGCCTCCACC
ACTGCCACCGCCACCCCCACCAGCCCAAGAGACCCAGGAGCCCAGCCCCATCCTAGACAGTGAGGAGACCAGAGCAGCAGCCCCTCAGGC
CTGGGCCGGCCCCATGGAGGAGCCCCCTCAGGCACAGGCGCCTCCCCGGGGGCCAGGCAGCCCTGCAGAGGACTTGATGTTCATGGAGTC
TGCAGAGCAGGCTGTCCTGGCTGCTCCCGTGGAGCCTGCCACAGCTGACGCCACGGAGATCCACGATGCAGCTGACACCATTGAAACTGA
CACTGCCACTGCTGACACCACTGTTGCCAACAACGTACCCCCCGCCGCCACCAGCCTCATTGACCTATGGCCTGGCAACGGGGAAGGGGC
CTCCACACTCCAGGGTGAGCCCAGGGCCCCCACGCCACCCTCGGGTACTGAGGTCACCCTGGCAGAGGTGCCCCTGCTGGATGAGGTGGC
TCCGGAGCCACTGCTGCCAGCAGGCGAAGGCTGTGCCACCCTTCTCAACTTTGATGAGCTGCCTGAGCCGCCAGCCACCTTCTGTGACCC
AGAGGAAGTGGAAGGGGAGTCCCTGGCTGCCCCCCAGACCCCAACTCTGCCCTCAGCCCTTGAGGAGCTGGAGCAAGAGCAGGAGCCGGA
GCCCCACCTGCTAACCAATGGCGAGACCACCCAGAAGGAGGGGACCCAGGCCAGTGAGGGGTACTTCAGTCAATCACAGGAGGAGGAGTT
TGCCCAATCGGAAGAGCTCTGTGCCAAGGCTCCGCCTCCTGTGTTCTACAACAAGCCTCCAGAGATCGACATCACATGCTGGGATGCAGA
CCCAGTTCCAGAAGAGGAGGAGGGCTTCGAGGGTGGTGATTAGCGGTGGCGCCAGCCCTAGGCTACCCTTGCCAAGGCCGCCCACCTGCA
TCAGCCTCTGGCCAGACGGCCCGCCGTGCCTGCATTCGCAGCAGCTCCGCCTGGCACCCACTCCGGATTCCGGCCCTGGCTGGGGACTTG
GCCGCTTCCCTACCCACAGGGCCTGACTTTTACAGCTTTTCTCTTTTTTTAAAAAGTTGATAGGAGACTTGTACAGTTGACTGGCTTTCC
TCTCGTTGGTAGTTGAGACGCTGTTGCAAATTCCACCCCTCCTTCCCTGGTCCAGATTGTAGCTCTTAGTCCTCCCTGCTCAGCTGGCCG
GGTTGGAGGCCTCACCCTGCTTGGGGCCTGGCGTGGGGGGAGCTCTGGTGGGAAAATGTCCCCCACCTCTTTTCCTAGTTTTATGTTTCT
TGGGAAAATATCACTTTGTATTCTCTGTCCAGGGCTTCAGATATTTTGCACGAATTTTAAAACATGGCAATAAATGGCTCGTGGGCTCTG

>In-frame_LMAN2_ENST00000303127_chr5_176761285_-_DBN1_ENST00000393565_chr5_176895221_-_3558nt
CTTGGAGCCTCTAAGGAGATGAAACTGCACTCAACCAGGATGAGAGGCTGCCCGGCCAATGCAGCTGCCGCCCCGTCTGCTGCGGAGGCT
TTGCTTTTTGACTCCCTGGCGACAGTAAAGTTGAAGAGCTTCCGGCCGGAGGCCAATAGATGGGACCCCCGGAAGGCGGAAGTTCTAGGG
CGGAAGTGGCCGAGAGGAGAGGAGAATGGCGGCGGAAGGCTGGATTTGGCGTTGGGGCTGGGGCCGGCGGTGCCTGGGAAGGCCTGGGCT
TCTCGGCCCCGGCCCTGGCCCCACTACACCTCTCTTTCTTCTTTTGTTGTTGGGGTCTGTGACTGCGGATATAACTGACGGCAACAGTGA
ACATCTCAAGCGGGAGCATTCGCTCATTAAGCCCTACCAAGGGGTCGGTTCCAGCTCTATGCCCCTCTGGGACTTCCAGGGCAGCACTAT
GCTCACGAGCCAGTACGTACGTCTGACCCCTGACGAGCGCAGCAAAGAGGGCTCTATCTGGAACCACCAGCCGTGCTTCCTCAAAGACTG
GGAAATGCACGTCCACTTCAAAGTCCACGGCACAGGGAAGAAGAACCTCCATGGAGACGGCATCGCCTTGTGGTACACCCGGGACCGCCT
CGTGCCAGGGCCTGTGTTTGGAAGCAAAGATAACTTCCACGGCTTAGCCATCTTCCTGGACACCTACCCCAATGATGAGACCACTGAGCG
CGTGTTCCCGTACATCTCGGTGATGGTGAACAATGGCTCCCTGTCCTACGACCACAGCAAGGATGGGCGCTGGACCGAGCTGGCGGGCTG
CACGGCTGACTTCCGCAACCGCGATCACGACACCTTCCTGGCTGTGCGCTACTCCCGGGGCCGTCTGACGGTGATGACCGACCTGGAGGA
CAAGAACGAGTGGAAGAACTGCATTGACATCACGGGAGTGCGCCTGCCCACCGGCTACTACTTCGGGGCCTCCGCCGGCACCGGCGACCT
GTCTGACAATCATGACATCATCTCCATGAAGCTGTTCCAGCTGATGGTGGAGCACACGCCCGACGAGGAGAGCATCGACTGGACCAAGAT
CGAGCCCAGCGTCAACTTCCTCAAGTCGCCCAAAGAAGGGGGCTTGCAGGAGCTTTCGGGACACTTTGAGAACCAGAAGGTGATGTACGG
CTTCTGCAGTGTCAAGGACTCCCAAGCTGCTCTGCCAAAATACGTGCTCATCAACTGGGTGGGCGAAGATGTGCCTGATGCCCGCAAGTG
CGCTTGTGCCAGCCACGTGGCTAAGGTGGCGGAGTTCTTCCAGGGTGTCGACGTGATCGTGAACGCCAGCAGCGTGGAAGACATAGACGC
GGGTGCCATCGGGCAGCGGCTCTCTAACGGGCTGGCGCGACTCTCCAGCCCTGTGCTGCACCGACTGCGGCTGCGAGAGGATGAGAACGC
AGAGCCCGTGGGCACCACCTACCAGAAGACGGATGCAGCTGTGGAAATGAAGCGGATTAACCGAGAGCAGTTCTGGGAGCAGGCCAAGAA
GGAAGAAGAGCTGCGGAAGGAGGAGGAGCGGAAGAAGGCCCTGGATGAGAGGCTCAGGTTCGAGCAGGAGCGGATGGAGCAGGAGCGGCA
GGAGCAAGAGGAGCGCGAGCGGCGCTACCGGGAGCGGGAGCAGCAGATCGAGGAGCACAGGAGGAAACAGCAGACTTTAGAAGCGGAAGA
GGCCAAGAGGCGGTTGAAGGAGCAGTCTATCTTTGGTGACCATCGGGATGAGGAGGAAGAGACCCACATGAAGAAGTCAGAGTCGGAGGT
GGAGGAGGCAGCAGCTATTATTGCCCAGCGGCCTGACAACCCAAGGGAGTTCTTCAAGCAGCAGGAAAGAGTCGCATCGGCCTCTGCGGG
CAGCTGTGATGTACCCTCGCCCTTCAACCATCGACCAGGTCGTCCGTACTGCCCTTTCATAAAGGCATCGGACAGTGGGCCTTCCTCCTC
CTCCTCTTCCTCCTCCTCCCCTCCACGGACTCCCTTTCCCTATATCACCTGCCACCGCACCCCAAACCTCTCTTCCTCCCTCCCATGCAG
CCACCTGGACAGCCACCGGAGGATGGCGCCCACTCCCATCCCCACGCGGAGCCCGTCTGACTCCAGCACCGCCTCCACCCCTGTCGCTGA
GCAGATAGAGCGGGCCCTGGATGAGGTCACCTCCTCGCAGCCTCCACCACTGCCACCGCCACCCCCACCAGCCCAAGAGACCCAGGAGCC
CAGCCCCATCCTAGACAGTGAGGAGACCAGAGCAGCAGCCCCTCAGGCCTGGGCCGGCCCCATGGAGGAGCCCCCTCAGGCACAGGCGCC
TCCCCGGGGGCCAGGCAGCCCTGCAGAGGACTTGATGTTCATGGAGTCTGCAGAGCAGGCTGTCCTGGCTGCTCCCGTGGAGCCTGCCAC
AGCTGACGCCACGGAGATCCACGATGCAGCTGACACCATTGAAACTGACACTGCCACTGCTGACACCACTGTTGCCAACAACGTACCCCC
CGCCGCCACCAGCCTCATTGACCTATGGCCTGGCAACGGGGAAGGGGCCTCCACACTCCAGGGTGAGCCCAGGGCCCCCACGCCACCCTC
GGGTACTGAGGTCACCCTGGCAGAGGTGCCCCTGCTGGATGAGGTGGCTCCGGAGCCACTGCTGCCAGCAGGCGAAGGCTGTGCCACCCT
TCTCAACTTTGATGAGCTGCCTGAGCCGCCAGCCACCTTCTGTGACCCAGAGGAAGTGGAAGGGGAGTCCCTGGCTGCCCCCCAGACCCC
AACTCTGCCCTCAGCCCTTGAGGAGCTGGAGCAAGAGCAGGAGCCGGAGCCCCACCTGCTAACCAATGGCGAGACCACCCAGAAGGAGGG
GACCCAGGCCAGTGAGGGGTACTTCAGTCAATCACAGGAGGAGGAGTTTGCCCAATCGGAAGAGCTCTGTGCCAAGGCTCCGCCTCCTGT
GTTCTACAACAAGCCTCCAGAGATCGACATCACATGCTGGGATGCAGACCCAGTTCCAGAAGAGGAGGAGGGCTTCGAGGGTGGTGATTA
GCGGTGGCGCCAGCCCTAGGCTACCCTTGCCAAGGCCGCCCACCTGCATCAGCCTCTGGCCAGACGGCCCGCCGTGCCTGCATTCGCAGC
AGCTCCGCCTGGCACCCACTCCGGATTCCGGCCCTGGCTGGGGACTTGGCCGCTTCCCTACCCACAGGGCCTGACTTTTACAGCTTTTCT
CTTTTTTTAAAAAGTTGATAGGAGACTTGTACAGTTGACTGGCTTTCCTCTCGTTGGTAGTTGAGACGCTGTTGCAAATTCCACCCCTCC
TTCCCTGGTCCAGATTGTAGCTCTTAGTCCTCCCTGCTCAGCTGGCCGGGTTGGAGGCCTCACCCTGCTTGGGGCCTGGCGTGGGGGGAG
CTCTGGTGGGAAAATGTCCCCCACCTCTTTTCCTAGTTTTATGTTTCTTGGGAAAATATCACTTTGTATTCTCTGTCCAGGGCTTCAGAT

>In-frame_LMAN2_ENST00000515209_chr5_176761285_-_DBN1_ENST00000309007_chr5_176895221_-_3543nt
ATGGCGGCGGAAGGCTGGATTTGGCGTTGGGGCTGGGGCCGGCGGTGCCTGGGAAGGCCTGGGCTTCTCGGCCCCGGCCCTGGCCCCACT
ACACCTCTCTTTCTTCTTTTGTTGTTGGGGTCTGTGACTGCGGATATAACTGACGGCAACAGTGAACATCTCAAGCGGGAGCATTCGCTC
ATTAAGCCCTACCAAGGGGTCGGTTCCAGCTCTATGCCCCTCTGGGACTTCCAGGGCAGCACTATGCTCACGAGCCAGTACGTACGTCTG
ACCCCTGACGAGCGCAGCAAAGAGGGCTCTATCTGGAACCACCAGCCGTGCTTCCTCAAAGACTGGGAAATGCACGTCCACTTCAAAGTC
CACGGCACAGGGAAGAAGAACCTCCATGGAGACGGCATCGCCTTGTGGTACACCCGGGACCGCCTCGTGCCAGGGCCTGTGTTTGGAAGC
AAAGATAACTTCCACGGCTTAGCCATCTTCCTGGACACCTACCCCAATGATGAGACCACTGAGCGCGTGTTCCCGTACATCTCGGTGATG
GTGAACAATGGCTCCCTGTCCTACGACCACAGCAAGGATGGGCGCTGGACCGAGCTGGCGGGCTGCACGGCTGACTTCCGCAACCGCGAT
CACGACACCTTCCTGGCTGTGCGCTACTCCCGGGGCCGTCTGACGGTGATGACCGACCTGGAGGACAAGAACGAGTGGAAGAACTGCATT
GACATCACGGGAGTGCGCCTGCCCACCGGCTACTACTTCGGGGCCTCCGCCGGCACCGGCGACCTGTCTGACAATCATGACATCATCTCC
ATGAAGCTGTTCCAGCTGATGGTGGAGCACACGCCCGACGAGGAGAGCATCGACTGGACCAAGATCGAGCCCAGCGTCAACTTCCTCAAG
TCGCCCAAAGAAGGGGGCTTGCAGGAGCTTTCGGGACACTTTGAGAACCAGAAGGTGATGTACGGCTTCTGCAGTGTCAAGGACTCCCAA
GCTGCTCTGCCAAAATACGTGCTCATCAACTGGGTGGGCGAAGATGTGCCTGATGCCCGCAAGTGCGCTTGTGCCAGCCACGTGGCTAAG
GTGGCGGAGTTCTTCCAGGGTGTCGACGTGATCGTGAACGCCAGCAGCGTGGAAGACATAGACGCGGGTGCCATCGGGCAGCGGCTCTCT
AACGGGCTGGCGCGACTCTCCAGCCCTGTGCTGCACCGACTGCGGCTGCGAGAGGATGAGAACGCAGAGCCCGTGGGCACCACCTACCAG
AAGACGGATGCAGCTGTGGAAATGAAGCGGATTAACCGAGAGCAGTTCTGGGAGCAGGCCAAGAAGGAAGAAGAGCTGCGGAAGGAGGAG
GAGCGGAAGAAGGCCCTGGATGAGAGGCTCAGGTTCGAGCAGGAGCGGATGGAGCAGGAGCGGCAGGAGCAAGAGGAGCGCGAGCGGCGC
TACCGGGAGCGGGAGCAGCAGATCGAGGAGCACAGGAGGAAACAGCAGACTTTAGAAGCGGAAGAGGCCAAGAGGCGGTTGAAGGAGCAG
TCTATCTTTGGTGACCATCGGGATGAGGAGGAAGAGACCCACATGAAGAAGTCAGAGTCGGAGGTGGAGGAGGCAGCAGCTATTATTGCC
CAGCGGCCTGACAACCCAAGGGAGTTCTTCAAGCAGCAGGAAAGAGTCGCATCGGCCTCTGCGGGCAGCTGTGATGTACCCTCGCCCTTC
AACCATCGACCAGGCAGCCACCTGGACAGCCACCGGAGGATGGCGCCCACTCCCATCCCCACGCGGAGCCCGTCTGACTCCAGCACCGCC
TCCACCCCTGTCGCTGAGCAGATAGAGCGGGCCCTGGATGAGGTCACCTCCTCGCAGCCTCCACCACTGCCACCGCCACCCCCACCAGCC
CAAGAGACCCAGGAGCCCAGCCCCATCCTAGACAGTGAGGAGACCAGAGCAGCAGCCCCTCAGGCCTGGGCCGGCCCCATGGAGGAGCCC
CCTCAGGCACAGGCGCCTCCCCGGGGGCCAGGCAGCCCTGCAGAGGACTTGATGTTCATGGAGTCTGCAGAGCAGGCTGTCCTGGCTGCT
CCCGTGGAGCCTGCCACAGCTGACGCCACGGAGATCCACGATGCAGCTGACACCATTGAAACTGACACTGCCACTGCTGACACCACTGTT
GCCAACAACGTACCCCCCGCCGCCACCAGCCTCATTGACCTATGGCCTGGCAACGGGGAAGGGGCCTCCACACTCCAGGGTGAGCCCAGG
GCCCCCACGCCACCCTCGGGTACTGAGGTCACCCTGGCAGAGGTGCCCCTGCTGGATGAGGTGGCTCCGGAGCCACTGCTGCCAGCAGGC
GAAGGCTGTGCCACCCTTCTCAACTTTGATGAGCTGCCTGAGCCGCCAGCCACCTTCTGTGACCCAGAGGAAGTGGAAGGGGAGTCCCTG
GCTGCCCCCCAGACCCCAACTCTGCCCTCAGCCCTTGAGGAGCTGGAGCAAGAGCAGGAGCCGGAGCCCCACCTGCTAACCAATGGCGAG
ACCACCCAGAAGGAGGGGACCCAGGCCAGTGAGGGGTACTTCAGTCAATCACAGGAGGAGGAGTTTGCCCAATCGGAAGAGCTCTGTGCC
AAGGCTCCGCCTCCTGTGTTCTACAACAAGCCTCCAGAGATCGACATCACATGCTGGGATGCAGACCCAGTTCCAGAAGAGGAGGAGGGC
TTCGAGGGTGGTGATTAGCGGTGGCGCCAGCCCTAGGCTACCCTTGCCAAGGCCGCCCACCTGCATCAGCCTCTGGCCAGACGGCCCGCC
GTGCCTGCATTCGCAGCAGCTCCGCCTGGCACCCACTCCGGATTCCGGCCCTGGCTGGGGACTTGGCCGCTTCCCTACCCACAGGGCCTG
ACTTTTACAGCTTTTCTCTTTTTTTAAAAAGTTGATAGGAGACTTGTACAGTTGACTGGCTTTCCTCTCGTTGGTAGTTGAGACGCTGTT
GCAAATTCCACCCCTCCTTCCCTGGTCCAGATTGTAGCTCTTAGTCCTCCCTGCTCAGCTGGCCGGGTTGGAGGCCTCACCCTGCTTGGG
GCCTGGCGTGGGGGGAGCTCTGGTGGGAAAATGTCCCCCACCTCTTTTCCTAGTTTTATGTTTCTTGGGAAAATATCACTTTGTATTCTC
TGTCCAGGGCTTCAGATATTTTGCACGAATTTTAAAACATGGCAATAAATGGCTCGTGGGCTCTGGCTCCCTGGGACCCCCTCCCCGCCC
TTCTTTTGACCCCTTCCTGTCTGGCCCAAAGGAAGTAGCAGGCCCAGCTGGGGCCCCTCGGCTACCCCCCGTCTCCTGCCGGGCAGGTCC
CAGGTTGGAGGCCCTAGGCGCGGTTCAGGTCAGGGCTATGGATGGGGCCCAGGGGCTTTGGTGGCCCCTCCCCAACTCCTTCCTCTTTGC
TTGGGTTCCTTTTTCACGTTTAGTAACTGTTTTTTTTTTTTTTTTTTTTTTTTTTTTGGAAAGCACAAACTTCTGTAACGGGTCGTGCTC

>In-frame_LMAN2_ENST00000515209_chr5_176761285_-_DBN1_ENST00000292385_chr5_176895221_-_3224nt
ATGGCGGCGGAAGGCTGGATTTGGCGTTGGGGCTGGGGCCGGCGGTGCCTGGGAAGGCCTGGGCTTCTCGGCCCCGGCCCTGGCCCCACT
ACACCTCTCTTTCTTCTTTTGTTGTTGGGGTCTGTGACTGCGGATATAACTGACGGCAACAGTGAACATCTCAAGCGGGAGCATTCGCTC
ATTAAGCCCTACCAAGGGGTCGGTTCCAGCTCTATGCCCCTCTGGGACTTCCAGGGCAGCACTATGCTCACGAGCCAGTACGTACGTCTG
ACCCCTGACGAGCGCAGCAAAGAGGGCTCTATCTGGAACCACCAGCCGTGCTTCCTCAAAGACTGGGAAATGCACGTCCACTTCAAAGTC
CACGGCACAGGGAAGAAGAACCTCCATGGAGACGGCATCGCCTTGTGGTACACCCGGGACCGCCTCGTGCCAGGGCCTGTGTTTGGAAGC
AAAGATAACTTCCACGGCTTAGCCATCTTCCTGGACACCTACCCCAATGATGAGACCACTGAGCGCGTGTTCCCGTACATCTCGGTGATG
GTGAACAATGGCTCCCTGTCCTACGACCACAGCAAGGATGGGCGCTGGACCGAGCTGGCGGGCTGCACGGCTGACTTCCGCAACCGCGAT
CACGACACCTTCCTGGCTGTGCGCTACTCCCGGGGCCGTCTGACGGTGATGACCGACCTGGAGGACAAGAACGAGTGGAAGAACTGCATT
GACATCACGGGAGTGCGCCTGCCCACCGGCTACTACTTCGGGGCCTCCGCCGGCACCGGCGACCTGTCTGACAATCATGACATCATCTCC
ATGAAGCTGTTCCAGCTGATGGTGGAGCACACGCCCGACGAGGAGAGCATCGACTGGACCAAGATCGAGCCCAGCGTCAACTTCCTCAAG
TCGCCCAAAGAAGGGGGCTTGCAGGAGCTTTCGGGACACTTTGAGAACCAGAAGGTGATGTACGGCTTCTGCAGTGTCAAGGACTCCCAA
GCTGCTCTGCCAAAATACGTGCTCATCAACTGGGTGGGCGAAGATGTGCCTGATGCCCGCAAGTGCGCTTGTGCCAGCCACGTGGCTAAG
GTGGCGGAGTTCTTCCAGGGTGTCGACGTGATCGTGAACGCCAGCAGCGTGGAAGACATAGACGCGGGTGCCATCGGGCAGCGGCTCTCT
AACGGGCTGGCGCGACTCTCCAGCCCTGTGCTGCACCGACTGCGGCTGCGAGAGGATGAGAACGCAGAGCCCGTGGGCACCACCTACCAG
AAGACGGATGCAGCTGTGGAAATGAAGCGGATTAACCGAGAGCAGTTCTGGGAGCAGGCCAAGAAGGAAGAAGAGCTGCGGAAGGAGGAG
GAGCGGAAGAAGGCCCTGGATGAGAGGCTCAGGTTCGAGCAGGAGCGGATGGAGCAGGAGCGGCAGGAGCAAGAGGAGCGCGAGCGGCGC
TACCGGGAGCGGGAGCAGCAGATCGAGGAGCACAGGAGGAAACAGCAGACTTTAGAAGCGGAAGAGGCCAAGAGGCGGTTGAAGGAGCAG
TCTATCTTTGGTGACCATCGGGATGAGGAGGAAGAGACCCACATGAAGAAGTCAGAGTCGGAGGTGGAGGAGGCAGCAGCTATTATTGCC
CAGCGGCCTGACAACCCAAGGGAGTTCTTCAAGCAGCAGGAAAGAGTCGCATCGGCCTCTGCGGGCAGCTGTGATGTACCCTCGCCCTTC
AACCATCGACCAGGCAGCCACCTGGACAGCCACCGGAGGATGGCGCCCACTCCCATCCCCACGCGGAGCCCGTCTGACTCCAGCACCGCC
TCCACCCCTGTCGCTGAGCAGATAGAGCGGGCCCTGGATGAGGTCACCTCCTCGCAGCCTCCACCACTGCCACCGCCACCCCCACCAGCC
CAAGAGACCCAGGAGCCCAGCCCCATCCTAGACAGTGAGGAGACCAGAGCAGCAGCCCCTCAGGCCTGGGCCGGCCCCATGGAGGAGCCC
CCTCAGGCACAGGCGCCTCCCCGGGGGCCAGGCAGCCCTGCAGAGGACTTGATGTTCATGGAGTCTGCAGAGCAGGCTGTCCTGGCTGCT
CCCGTGGAGCCTGCCACAGCTGACGCCACGGAGATCCACGATGCAGCTGACACCATTGAAACTGACACTGCCACTGCTGACACCACTGTT
GCCAACAACGTACCCCCCGCCGCCACCAGCCTCATTGACCTATGGCCTGGCAACGGGGAAGGGGCCTCCACACTCCAGGGTGAGCCCAGG
GCCCCCACGCCACCCTCGGGTACTGAGGTCACCCTGGCAGAGGTGCCCCTGCTGGATGAGGTGGCTCCGGAGCCACTGCTGCCAGCAGGC
GAAGGCTGTGCCACCCTTCTCAACTTTGATGAGCTGCCTGAGCCGCCAGCCACCTTCTGTGACCCAGAGGAAGTGGAAGGGGAGTCCCTG
GCTGCCCCCCAGACCCCAACTCTGCCCTCAGCCCTTGAGGAGCTGGAGCAAGAGCAGGAGCCGGAGCCCCACCTGCTAACCAATGGCGAG
ACCACCCAGAAGGAGGGGACCCAGGCCAGTGAGGGGTACTTCAGTCAATCACAGGAGGAGGAGTTTGCCCAATCGGAAGAGCTCTGTGCC
AAGGCTCCGCCTCCTGTGTTCTACAACAAGCCTCCAGAGATCGACATCACATGCTGGGATGCAGACCCAGTTCCAGAAGAGGAGGAGGGC
TTCGAGGGTGGTGATTAGCGGTGGCGCCAGCCCTAGGCTACCCTTGCCAAGGCCGCCCACCTGCATCAGCCTCTGGCCAGACGGCCCGCC
GTGCCTGCATTCGCAGCAGCTCCGCCTGGCACCCACTCCGGATTCCGGCCCTGGCTGGGGACTTGGCCGCTTCCCTACCCACAGGGCCTG
ACTTTTACAGCTTTTCTCTTTTTTTAAAAAGTTGATAGGAGACTTGTACAGTTGACTGGCTTTCCTCTCGTTGGTAGTTGAGACGCTGTT
GCAAATTCCACCCCTCCTTCCCTGGTCCAGATTGTAGCTCTTAGTCCTCCCTGCTCAGCTGGCCGGGTTGGAGGCCTCACCCTGCTTGGG
GCCTGGCGTGGGGGGAGCTCTGGTGGGAAAATGTCCCCCACCTCTTTTCCTAGTTTTATGTTTCTTGGGAAAATATCACTTTGTATTCTC

>In-frame_LMAN2_ENST00000515209_chr5_176761285_-_DBN1_ENST00000393565_chr5_176895221_-_3353nt
ATGGCGGCGGAAGGCTGGATTTGGCGTTGGGGCTGGGGCCGGCGGTGCCTGGGAAGGCCTGGGCTTCTCGGCCCCGGCCCTGGCCCCACT
ACACCTCTCTTTCTTCTTTTGTTGTTGGGGTCTGTGACTGCGGATATAACTGACGGCAACAGTGAACATCTCAAGCGGGAGCATTCGCTC
ATTAAGCCCTACCAAGGGGTCGGTTCCAGCTCTATGCCCCTCTGGGACTTCCAGGGCAGCACTATGCTCACGAGCCAGTACGTACGTCTG
ACCCCTGACGAGCGCAGCAAAGAGGGCTCTATCTGGAACCACCAGCCGTGCTTCCTCAAAGACTGGGAAATGCACGTCCACTTCAAAGTC
CACGGCACAGGGAAGAAGAACCTCCATGGAGACGGCATCGCCTTGTGGTACACCCGGGACCGCCTCGTGCCAGGGCCTGTGTTTGGAAGC
AAAGATAACTTCCACGGCTTAGCCATCTTCCTGGACACCTACCCCAATGATGAGACCACTGAGCGCGTGTTCCCGTACATCTCGGTGATG
GTGAACAATGGCTCCCTGTCCTACGACCACAGCAAGGATGGGCGCTGGACCGAGCTGGCGGGCTGCACGGCTGACTTCCGCAACCGCGAT
CACGACACCTTCCTGGCTGTGCGCTACTCCCGGGGCCGTCTGACGGTGATGACCGACCTGGAGGACAAGAACGAGTGGAAGAACTGCATT
GACATCACGGGAGTGCGCCTGCCCACCGGCTACTACTTCGGGGCCTCCGCCGGCACCGGCGACCTGTCTGACAATCATGACATCATCTCC
ATGAAGCTGTTCCAGCTGATGGTGGAGCACACGCCCGACGAGGAGAGCATCGACTGGACCAAGATCGAGCCCAGCGTCAACTTCCTCAAG
TCGCCCAAAGAAGGGGGCTTGCAGGAGCTTTCGGGACACTTTGAGAACCAGAAGGTGATGTACGGCTTCTGCAGTGTCAAGGACTCCCAA
GCTGCTCTGCCAAAATACGTGCTCATCAACTGGGTGGGCGAAGATGTGCCTGATGCCCGCAAGTGCGCTTGTGCCAGCCACGTGGCTAAG
GTGGCGGAGTTCTTCCAGGGTGTCGACGTGATCGTGAACGCCAGCAGCGTGGAAGACATAGACGCGGGTGCCATCGGGCAGCGGCTCTCT
AACGGGCTGGCGCGACTCTCCAGCCCTGTGCTGCACCGACTGCGGCTGCGAGAGGATGAGAACGCAGAGCCCGTGGGCACCACCTACCAG
AAGACGGATGCAGCTGTGGAAATGAAGCGGATTAACCGAGAGCAGTTCTGGGAGCAGGCCAAGAAGGAAGAAGAGCTGCGGAAGGAGGAG
GAGCGGAAGAAGGCCCTGGATGAGAGGCTCAGGTTCGAGCAGGAGCGGATGGAGCAGGAGCGGCAGGAGCAAGAGGAGCGCGAGCGGCGC
TACCGGGAGCGGGAGCAGCAGATCGAGGAGCACAGGAGGAAACAGCAGACTTTAGAAGCGGAAGAGGCCAAGAGGCGGTTGAAGGAGCAG
TCTATCTTTGGTGACCATCGGGATGAGGAGGAAGAGACCCACATGAAGAAGTCAGAGTCGGAGGTGGAGGAGGCAGCAGCTATTATTGCC
CAGCGGCCTGACAACCCAAGGGAGTTCTTCAAGCAGCAGGAAAGAGTCGCATCGGCCTCTGCGGGCAGCTGTGATGTACCCTCGCCCTTC
AACCATCGACCAGGTCGTCCGTACTGCCCTTTCATAAAGGCATCGGACAGTGGGCCTTCCTCCTCCTCCTCTTCCTCCTCCTCCCCTCCA
CGGACTCCCTTTCCCTATATCACCTGCCACCGCACCCCAAACCTCTCTTCCTCCCTCCCATGCAGCCACCTGGACAGCCACCGGAGGATG
GCGCCCACTCCCATCCCCACGCGGAGCCCGTCTGACTCCAGCACCGCCTCCACCCCTGTCGCTGAGCAGATAGAGCGGGCCCTGGATGAG
GTCACCTCCTCGCAGCCTCCACCACTGCCACCGCCACCCCCACCAGCCCAAGAGACCCAGGAGCCCAGCCCCATCCTAGACAGTGAGGAG
ACCAGAGCAGCAGCCCCTCAGGCCTGGGCCGGCCCCATGGAGGAGCCCCCTCAGGCACAGGCGCCTCCCCGGGGGCCAGGCAGCCCTGCA
GAGGACTTGATGTTCATGGAGTCTGCAGAGCAGGCTGTCCTGGCTGCTCCCGTGGAGCCTGCCACAGCTGACGCCACGGAGATCCACGAT
GCAGCTGACACCATTGAAACTGACACTGCCACTGCTGACACCACTGTTGCCAACAACGTACCCCCCGCCGCCACCAGCCTCATTGACCTA
TGGCCTGGCAACGGGGAAGGGGCCTCCACACTCCAGGGTGAGCCCAGGGCCCCCACGCCACCCTCGGGTACTGAGGTCACCCTGGCAGAG
GTGCCCCTGCTGGATGAGGTGGCTCCGGAGCCACTGCTGCCAGCAGGCGAAGGCTGTGCCACCCTTCTCAACTTTGATGAGCTGCCTGAG
CCGCCAGCCACCTTCTGTGACCCAGAGGAAGTGGAAGGGGAGTCCCTGGCTGCCCCCCAGACCCCAACTCTGCCCTCAGCCCTTGAGGAG
CTGGAGCAAGAGCAGGAGCCGGAGCCCCACCTGCTAACCAATGGCGAGACCACCCAGAAGGAGGGGACCCAGGCCAGTGAGGGGTACTTC
AGTCAATCACAGGAGGAGGAGTTTGCCCAATCGGAAGAGCTCTGTGCCAAGGCTCCGCCTCCTGTGTTCTACAACAAGCCTCCAGAGATC
GACATCACATGCTGGGATGCAGACCCAGTTCCAGAAGAGGAGGAGGGCTTCGAGGGTGGTGATTAGCGGTGGCGCCAGCCCTAGGCTACC
CTTGCCAAGGCCGCCCACCTGCATCAGCCTCTGGCCAGACGGCCCGCCGTGCCTGCATTCGCAGCAGCTCCGCCTGGCACCCACTCCGGA
TTCCGGCCCTGGCTGGGGACTTGGCCGCTTCCCTACCCACAGGGCCTGACTTTTACAGCTTTTCTCTTTTTTTAAAAAGTTGATAGGAGA
CTTGTACAGTTGACTGGCTTTCCTCTCGTTGGTAGTTGAGACGCTGTTGCAAATTCCACCCCTCCTTCCCTGGTCCAGATTGTAGCTCTT
AGTCCTCCCTGCTCAGCTGGCCGGGTTGGAGGCCTCACCCTGCTTGGGGCCTGGCGTGGGGGGAGCTCTGGTGGGAAAATGTCCCCCACC
TCTTTTCCTAGTTTTATGTTTCTTGGGAAAATATCACTTTGTATTCTCTGTCCAGGGCTTCAGATATTTTGCACGAATTTTAAAACATGG

>In-frame_LMAN2_ENST00000303127_chr5_176778174_-_DBN1_ENST00000309007_chr5_176887704_-_2524nt
CTTGGAGCCTCTAAGGAGATGAAACTGCACTCAACCAGGATGAGAGGCTGCCCGGCCAATGCAGCTGCCGCCCCGTCTGCTGCGGAGGCT
TTGCTTTTTGACTCCCTGGCGACAGTAAAGTTGAAGAGCTTCCGGCCGGAGGCCAATAGATGGGACCCCCGGAAGGCGGAAGTTCTAGGG
CGGAAGTGGCCGAGAGGAGAGGAGAATGGCGGCGGAAGGCTGGATTTGGCGTTGGGGCTGGGGCCGGCGGTGCCTGGGAAGGCCTGGGCT
TCTCGGCCCCGGCCCTGGCCCCACTACACCTCTCTTTCTTCTTTTGTTGTTGGGGTCTGTGACTGCGGATATAACTGACGGCAACAGTGA
ACATCTCAAGCGGGAGCATTCGCTCATTAAGCCCTACCAAGGGGTCGGTTCCAGCTCTATGCCCCTCTGGGACTTCCAGGGCAGCACTAT
GCTCACGAGCCAGTACGTACGTCTGACCCCTGACGAGCGCAGCAAAGAGGGCTCTATCTGGAACCACCAGGGTGACCATCGGGATGAGGA
GGAAGAGACCCACATGAAGAAGTCAGAGTCGGAGGTGGAGGAGGCAGCAGCTATTATTGCCCAGCGGCCTGACAACCCAAGGGAGTTCTT
CAAGCAGCAGGAAAGAGTCGCATCGGCCTCTGCGGGCAGCTGTGATGTACCCTCGCCCTTCAACCATCGACCAGGCAGCCACCTGGACAG
CCACCGGAGGATGGCGCCCACTCCCATCCCCACGCGGAGCCCGTCTGACTCCAGCACCGCCTCCACCCCTGTCGCTGAGCAGATAGAGCG
GGCCCTGGATGAGGTCACCTCCTCGCAGCCTCCACCACTGCCACCGCCACCCCCACCAGCCCAAGAGACCCAGGAGCCCAGCCCCATCCT
AGACAGTGAGGAGACCAGAGCAGCAGCCCCTCAGGCCTGGGCCGGCCCCATGGAGGAGCCCCCTCAGGCACAGGCGCCTCCCCGGGGGCC
AGGCAGCCCTGCAGAGGACTTGATGTTCATGGAGTCTGCAGAGCAGGCTGTCCTGGCTGCTCCCGTGGAGCCTGCCACAGCTGACGCCAC
GGAGATCCACGATGCAGCTGACACCATTGAAACTGACACTGCCACTGCTGACACCACTGTTGCCAACAACGTACCCCCCGCCGCCACCAG
CCTCATTGACCTATGGCCTGGCAACGGGGAAGGGGCCTCCACACTCCAGGGTGAGCCCAGGGCCCCCACGCCACCCTCGGGTACTGAGGT
CACCCTGGCAGAGGTGCCCCTGCTGGATGAGGTGGCTCCGGAGCCACTGCTGCCAGCAGGCGAAGGCTGTGCCACCCTTCTCAACTTTGA
TGAGCTGCCTGAGCCGCCAGCCACCTTCTGTGACCCAGAGGAAGTGGAAGGGGAGTCCCTGGCTGCCCCCCAGACCCCAACTCTGCCCTC
AGCCCTTGAGGAGCTGGAGCAAGAGCAGGAGCCGGAGCCCCACCTGCTAACCAATGGCGAGACCACCCAGAAGGAGGGGACCCAGGCCAG
TGAGGGGTACTTCAGTCAATCACAGGAGGAGGAGTTTGCCCAATCGGAAGAGCTCTGTGCCAAGGCTCCGCCTCCTGTGTTCTACAACAA
GCCTCCAGAGATCGACATCACATGCTGGGATGCAGACCCAGTTCCAGAAGAGGAGGAGGGCTTCGAGGGTGGTGATTAGCGGTGGCGCCA
GCCCTAGGCTACCCTTGCCAAGGCCGCCCACCTGCATCAGCCTCTGGCCAGACGGCCCGCCGTGCCTGCATTCGCAGCAGCTCCGCCTGG
CACCCACTCCGGATTCCGGCCCTGGCTGGGGACTTGGCCGCTTCCCTACCCACAGGGCCTGACTTTTACAGCTTTTCTCTTTTTTTAAAA
AGTTGATAGGAGACTTGTACAGTTGACTGGCTTTCCTCTCGTTGGTAGTTGAGACGCTGTTGCAAATTCCACCCCTCCTTCCCTGGTCCA
GATTGTAGCTCTTAGTCCTCCCTGCTCAGCTGGCCGGGTTGGAGGCCTCACCCTGCTTGGGGCCTGGCGTGGGGGGAGCTCTGGTGGGAA
AATGTCCCCCACCTCTTTTCCTAGTTTTATGTTTCTTGGGAAAATATCACTTTGTATTCTCTGTCCAGGGCTTCAGATATTTTGCACGAA
TTTTAAAACATGGCAATAAATGGCTCGTGGGCTCTGGCTCCCTGGGACCCCCTCCCCGCCCTTCTTTTGACCCCTTCCTGTCTGGCCCAA
AGGAAGTAGCAGGCCCAGCTGGGGCCCCTCGGCTACCCCCCGTCTCCTGCCGGGCAGGTCCCAGGTTGGAGGCCCTAGGCGCGGTTCAGG
TCAGGGCTATGGATGGGGCCCAGGGGCTTTGGTGGCCCCTCCCCAACTCCTTCCTCTTTGCTTGGGTTCCTTTTTCACGTTTAGTAACTG
TTTTTTTTTTTTTTTTTTTTTTTTTTTTGGAAAGCACAAACTTCTGTAACGGGTCGTGCTCATGTCTGTTAATAAAGAAATCCAGATCCC

>In-frame_LMAN2_ENST00000303127_chr5_176778174_-_DBN1_ENST00000292385_chr5_176887704_-_2205nt
CTTGGAGCCTCTAAGGAGATGAAACTGCACTCAACCAGGATGAGAGGCTGCCCGGCCAATGCAGCTGCCGCCCCGTCTGCTGCGGAGGCT
TTGCTTTTTGACTCCCTGGCGACAGTAAAGTTGAAGAGCTTCCGGCCGGAGGCCAATAGATGGGACCCCCGGAAGGCGGAAGTTCTAGGG
CGGAAGTGGCCGAGAGGAGAGGAGAATGGCGGCGGAAGGCTGGATTTGGCGTTGGGGCTGGGGCCGGCGGTGCCTGGGAAGGCCTGGGCT
TCTCGGCCCCGGCCCTGGCCCCACTACACCTCTCTTTCTTCTTTTGTTGTTGGGGTCTGTGACTGCGGATATAACTGACGGCAACAGTGA
ACATCTCAAGCGGGAGCATTCGCTCATTAAGCCCTACCAAGGGGTCGGTTCCAGCTCTATGCCCCTCTGGGACTTCCAGGGCAGCACTAT
GCTCACGAGCCAGTACGTACGTCTGACCCCTGACGAGCGCAGCAAAGAGGGCTCTATCTGGAACCACCAGGGTGACCATCGGGATGAGGA
GGAAGAGACCCACATGAAGAAGTCAGAGTCGGAGGTGGAGGAGGCAGCAGCTATTATTGCCCAGCGGCCTGACAACCCAAGGGAGTTCTT
CAAGCAGCAGGAAAGAGTCGCATCGGCCTCTGCGGGCAGCTGTGATGTACCCTCGCCCTTCAACCATCGACCAGGCAGCCACCTGGACAG
CCACCGGAGGATGGCGCCCACTCCCATCCCCACGCGGAGCCCGTCTGACTCCAGCACCGCCTCCACCCCTGTCGCTGAGCAGATAGAGCG
GGCCCTGGATGAGGTCACCTCCTCGCAGCCTCCACCACTGCCACCGCCACCCCCACCAGCCCAAGAGACCCAGGAGCCCAGCCCCATCCT
AGACAGTGAGGAGACCAGAGCAGCAGCCCCTCAGGCCTGGGCCGGCCCCATGGAGGAGCCCCCTCAGGCACAGGCGCCTCCCCGGGGGCC
AGGCAGCCCTGCAGAGGACTTGATGTTCATGGAGTCTGCAGAGCAGGCTGTCCTGGCTGCTCCCGTGGAGCCTGCCACAGCTGACGCCAC
GGAGATCCACGATGCAGCTGACACCATTGAAACTGACACTGCCACTGCTGACACCACTGTTGCCAACAACGTACCCCCCGCCGCCACCAG
CCTCATTGACCTATGGCCTGGCAACGGGGAAGGGGCCTCCACACTCCAGGGTGAGCCCAGGGCCCCCACGCCACCCTCGGGTACTGAGGT
CACCCTGGCAGAGGTGCCCCTGCTGGATGAGGTGGCTCCGGAGCCACTGCTGCCAGCAGGCGAAGGCTGTGCCACCCTTCTCAACTTTGA
TGAGCTGCCTGAGCCGCCAGCCACCTTCTGTGACCCAGAGGAAGTGGAAGGGGAGTCCCTGGCTGCCCCCCAGACCCCAACTCTGCCCTC
AGCCCTTGAGGAGCTGGAGCAAGAGCAGGAGCCGGAGCCCCACCTGCTAACCAATGGCGAGACCACCCAGAAGGAGGGGACCCAGGCCAG
TGAGGGGTACTTCAGTCAATCACAGGAGGAGGAGTTTGCCCAATCGGAAGAGCTCTGTGCCAAGGCTCCGCCTCCTGTGTTCTACAACAA
GCCTCCAGAGATCGACATCACATGCTGGGATGCAGACCCAGTTCCAGAAGAGGAGGAGGGCTTCGAGGGTGGTGATTAGCGGTGGCGCCA
GCCCTAGGCTACCCTTGCCAAGGCCGCCCACCTGCATCAGCCTCTGGCCAGACGGCCCGCCGTGCCTGCATTCGCAGCAGCTCCGCCTGG
CACCCACTCCGGATTCCGGCCCTGGCTGGGGACTTGGCCGCTTCCCTACCCACAGGGCCTGACTTTTACAGCTTTTCTCTTTTTTTAAAA
AGTTGATAGGAGACTTGTACAGTTGACTGGCTTTCCTCTCGTTGGTAGTTGAGACGCTGTTGCAAATTCCACCCCTCCTTCCCTGGTCCA
GATTGTAGCTCTTAGTCCTCCCTGCTCAGCTGGCCGGGTTGGAGGCCTCACCCTGCTTGGGGCCTGGCGTGGGGGGAGCTCTGGTGGGAA
AATGTCCCCCACCTCTTTTCCTAGTTTTATGTTTCTTGGGAAAATATCACTTTGTATTCTCTGTCCAGGGCTTCAGATATTTTGCACGAA

>In-frame_LMAN2_ENST00000303127_chr5_176778174_-_DBN1_ENST00000393565_chr5_176887704_-_2334nt
CTTGGAGCCTCTAAGGAGATGAAACTGCACTCAACCAGGATGAGAGGCTGCCCGGCCAATGCAGCTGCCGCCCCGTCTGCTGCGGAGGCT
TTGCTTTTTGACTCCCTGGCGACAGTAAAGTTGAAGAGCTTCCGGCCGGAGGCCAATAGATGGGACCCCCGGAAGGCGGAAGTTCTAGGG
CGGAAGTGGCCGAGAGGAGAGGAGAATGGCGGCGGAAGGCTGGATTTGGCGTTGGGGCTGGGGCCGGCGGTGCCTGGGAAGGCCTGGGCT
TCTCGGCCCCGGCCCTGGCCCCACTACACCTCTCTTTCTTCTTTTGTTGTTGGGGTCTGTGACTGCGGATATAACTGACGGCAACAGTGA
ACATCTCAAGCGGGAGCATTCGCTCATTAAGCCCTACCAAGGGGTCGGTTCCAGCTCTATGCCCCTCTGGGACTTCCAGGGCAGCACTAT
GCTCACGAGCCAGTACGTACGTCTGACCCCTGACGAGCGCAGCAAAGAGGGCTCTATCTGGAACCACCAGGGTGACCATCGGGATGAGGA
GGAAGAGACCCACATGAAGAAGTCAGAGTCGGAGGTGGAGGAGGCAGCAGCTATTATTGCCCAGCGGCCTGACAACCCAAGGGAGTTCTT
CAAGCAGCAGGAAAGAGTCGCATCGGCCTCTGCGGGCAGCTGTGATGTACCCTCGCCCTTCAACCATCGACCAGGTCGTCCGTACTGCCC
TTTCATAAAGGCATCGGACAGTGGGCCTTCCTCCTCCTCCTCTTCCTCCTCCTCCCCTCCACGGACTCCCTTTCCCTATATCACCTGCCA
CCGCACCCCAAACCTCTCTTCCTCCCTCCCATGCAGCCACCTGGACAGCCACCGGAGGATGGCGCCCACTCCCATCCCCACGCGGAGCCC
GTCTGACTCCAGCACCGCCTCCACCCCTGTCGCTGAGCAGATAGAGCGGGCCCTGGATGAGGTCACCTCCTCGCAGCCTCCACCACTGCC
ACCGCCACCCCCACCAGCCCAAGAGACCCAGGAGCCCAGCCCCATCCTAGACAGTGAGGAGACCAGAGCAGCAGCCCCTCAGGCCTGGGC
CGGCCCCATGGAGGAGCCCCCTCAGGCACAGGCGCCTCCCCGGGGGCCAGGCAGCCCTGCAGAGGACTTGATGTTCATGGAGTCTGCAGA
GCAGGCTGTCCTGGCTGCTCCCGTGGAGCCTGCCACAGCTGACGCCACGGAGATCCACGATGCAGCTGACACCATTGAAACTGACACTGC
CACTGCTGACACCACTGTTGCCAACAACGTACCCCCCGCCGCCACCAGCCTCATTGACCTATGGCCTGGCAACGGGGAAGGGGCCTCCAC
ACTCCAGGGTGAGCCCAGGGCCCCCACGCCACCCTCGGGTACTGAGGTCACCCTGGCAGAGGTGCCCCTGCTGGATGAGGTGGCTCCGGA
GCCACTGCTGCCAGCAGGCGAAGGCTGTGCCACCCTTCTCAACTTTGATGAGCTGCCTGAGCCGCCAGCCACCTTCTGTGACCCAGAGGA
AGTGGAAGGGGAGTCCCTGGCTGCCCCCCAGACCCCAACTCTGCCCTCAGCCCTTGAGGAGCTGGAGCAAGAGCAGGAGCCGGAGCCCCA
CCTGCTAACCAATGGCGAGACCACCCAGAAGGAGGGGACCCAGGCCAGTGAGGGGTACTTCAGTCAATCACAGGAGGAGGAGTTTGCCCA
ATCGGAAGAGCTCTGTGCCAAGGCTCCGCCTCCTGTGTTCTACAACAAGCCTCCAGAGATCGACATCACATGCTGGGATGCAGACCCAGT
TCCAGAAGAGGAGGAGGGCTTCGAGGGTGGTGATTAGCGGTGGCGCCAGCCCTAGGCTACCCTTGCCAAGGCCGCCCACCTGCATCAGCC
TCTGGCCAGACGGCCCGCCGTGCCTGCATTCGCAGCAGCTCCGCCTGGCACCCACTCCGGATTCCGGCCCTGGCTGGGGACTTGGCCGCT
TCCCTACCCACAGGGCCTGACTTTTACAGCTTTTCTCTTTTTTTAAAAAGTTGATAGGAGACTTGTACAGTTGACTGGCTTTCCTCTCGT
TGGTAGTTGAGACGCTGTTGCAAATTCCACCCCTCCTTCCCTGGTCCAGATTGTAGCTCTTAGTCCTCCCTGCTCAGCTGGCCGGGTTGG
AGGCCTCACCCTGCTTGGGGCCTGGCGTGGGGGGAGCTCTGGTGGGAAAATGTCCCCCACCTCTTTTCCTAGTTTTATGTTTCTTGGGAA

>In-frame_LMAN2_ENST00000515209_chr5_176778174_-_DBN1_ENST00000309007_chr5_176887704_-_2319nt
ATGGCGGCGGAAGGCTGGATTTGGCGTTGGGGCTGGGGCCGGCGGTGCCTGGGAAGGCCTGGGCTTCTCGGCCCCGGCCCTGGCCCCACT
ACACCTCTCTTTCTTCTTTTGTTGTTGGGGTCTGTGACTGCGGATATAACTGACGGCAACAGTGAACATCTCAAGCGGGAGCATTCGCTC
ATTAAGCCCTACCAAGGGGTCGGTTCCAGCTCTATGCCCCTCTGGGACTTCCAGGGCAGCACTATGCTCACGAGCCAGTACGTACGTCTG
ACCCCTGACGAGCGCAGCAAAGAGGGCTCTATCTGGAACCACCAGGGTGACCATCGGGATGAGGAGGAAGAGACCCACATGAAGAAGTCA
GAGTCGGAGGTGGAGGAGGCAGCAGCTATTATTGCCCAGCGGCCTGACAACCCAAGGGAGTTCTTCAAGCAGCAGGAAAGAGTCGCATCG
GCCTCTGCGGGCAGCTGTGATGTACCCTCGCCCTTCAACCATCGACCAGGCAGCCACCTGGACAGCCACCGGAGGATGGCGCCCACTCCC
ATCCCCACGCGGAGCCCGTCTGACTCCAGCACCGCCTCCACCCCTGTCGCTGAGCAGATAGAGCGGGCCCTGGATGAGGTCACCTCCTCG
CAGCCTCCACCACTGCCACCGCCACCCCCACCAGCCCAAGAGACCCAGGAGCCCAGCCCCATCCTAGACAGTGAGGAGACCAGAGCAGCA
GCCCCTCAGGCCTGGGCCGGCCCCATGGAGGAGCCCCCTCAGGCACAGGCGCCTCCCCGGGGGCCAGGCAGCCCTGCAGAGGACTTGATG
TTCATGGAGTCTGCAGAGCAGGCTGTCCTGGCTGCTCCCGTGGAGCCTGCCACAGCTGACGCCACGGAGATCCACGATGCAGCTGACACC
ATTGAAACTGACACTGCCACTGCTGACACCACTGTTGCCAACAACGTACCCCCCGCCGCCACCAGCCTCATTGACCTATGGCCTGGCAAC
GGGGAAGGGGCCTCCACACTCCAGGGTGAGCCCAGGGCCCCCACGCCACCCTCGGGTACTGAGGTCACCCTGGCAGAGGTGCCCCTGCTG
GATGAGGTGGCTCCGGAGCCACTGCTGCCAGCAGGCGAAGGCTGTGCCACCCTTCTCAACTTTGATGAGCTGCCTGAGCCGCCAGCCACC
TTCTGTGACCCAGAGGAAGTGGAAGGGGAGTCCCTGGCTGCCCCCCAGACCCCAACTCTGCCCTCAGCCCTTGAGGAGCTGGAGCAAGAG
CAGGAGCCGGAGCCCCACCTGCTAACCAATGGCGAGACCACCCAGAAGGAGGGGACCCAGGCCAGTGAGGGGTACTTCAGTCAATCACAG
GAGGAGGAGTTTGCCCAATCGGAAGAGCTCTGTGCCAAGGCTCCGCCTCCTGTGTTCTACAACAAGCCTCCAGAGATCGACATCACATGC
TGGGATGCAGACCCAGTTCCAGAAGAGGAGGAGGGCTTCGAGGGTGGTGATTAGCGGTGGCGCCAGCCCTAGGCTACCCTTGCCAAGGCC
GCCCACCTGCATCAGCCTCTGGCCAGACGGCCCGCCGTGCCTGCATTCGCAGCAGCTCCGCCTGGCACCCACTCCGGATTCCGGCCCTGG
CTGGGGACTTGGCCGCTTCCCTACCCACAGGGCCTGACTTTTACAGCTTTTCTCTTTTTTTAAAAAGTTGATAGGAGACTTGTACAGTTG
ACTGGCTTTCCTCTCGTTGGTAGTTGAGACGCTGTTGCAAATTCCACCCCTCCTTCCCTGGTCCAGATTGTAGCTCTTAGTCCTCCCTGC
TCAGCTGGCCGGGTTGGAGGCCTCACCCTGCTTGGGGCCTGGCGTGGGGGGAGCTCTGGTGGGAAAATGTCCCCCACCTCTTTTCCTAGT
TTTATGTTTCTTGGGAAAATATCACTTTGTATTCTCTGTCCAGGGCTTCAGATATTTTGCACGAATTTTAAAACATGGCAATAAATGGCT
CGTGGGCTCTGGCTCCCTGGGACCCCCTCCCCGCCCTTCTTTTGACCCCTTCCTGTCTGGCCCAAAGGAAGTAGCAGGCCCAGCTGGGGC
CCCTCGGCTACCCCCCGTCTCCTGCCGGGCAGGTCCCAGGTTGGAGGCCCTAGGCGCGGTTCAGGTCAGGGCTATGGATGGGGCCCAGGG
GCTTTGGTGGCCCCTCCCCAACTCCTTCCTCTTTGCTTGGGTTCCTTTTTCACGTTTAGTAACTGTTTTTTTTTTTTTTTTTTTTTTTTT

>In-frame_LMAN2_ENST00000515209_chr5_176778174_-_DBN1_ENST00000292385_chr5_176887704_-_2000nt
ATGGCGGCGGAAGGCTGGATTTGGCGTTGGGGCTGGGGCCGGCGGTGCCTGGGAAGGCCTGGGCTTCTCGGCCCCGGCCCTGGCCCCACT
ACACCTCTCTTTCTTCTTTTGTTGTTGGGGTCTGTGACTGCGGATATAACTGACGGCAACAGTGAACATCTCAAGCGGGAGCATTCGCTC
ATTAAGCCCTACCAAGGGGTCGGTTCCAGCTCTATGCCCCTCTGGGACTTCCAGGGCAGCACTATGCTCACGAGCCAGTACGTACGTCTG
ACCCCTGACGAGCGCAGCAAAGAGGGCTCTATCTGGAACCACCAGGGTGACCATCGGGATGAGGAGGAAGAGACCCACATGAAGAAGTCA
GAGTCGGAGGTGGAGGAGGCAGCAGCTATTATTGCCCAGCGGCCTGACAACCCAAGGGAGTTCTTCAAGCAGCAGGAAAGAGTCGCATCG
GCCTCTGCGGGCAGCTGTGATGTACCCTCGCCCTTCAACCATCGACCAGGCAGCCACCTGGACAGCCACCGGAGGATGGCGCCCACTCCC
ATCCCCACGCGGAGCCCGTCTGACTCCAGCACCGCCTCCACCCCTGTCGCTGAGCAGATAGAGCGGGCCCTGGATGAGGTCACCTCCTCG
CAGCCTCCACCACTGCCACCGCCACCCCCACCAGCCCAAGAGACCCAGGAGCCCAGCCCCATCCTAGACAGTGAGGAGACCAGAGCAGCA
GCCCCTCAGGCCTGGGCCGGCCCCATGGAGGAGCCCCCTCAGGCACAGGCGCCTCCCCGGGGGCCAGGCAGCCCTGCAGAGGACTTGATG
TTCATGGAGTCTGCAGAGCAGGCTGTCCTGGCTGCTCCCGTGGAGCCTGCCACAGCTGACGCCACGGAGATCCACGATGCAGCTGACACC
ATTGAAACTGACACTGCCACTGCTGACACCACTGTTGCCAACAACGTACCCCCCGCCGCCACCAGCCTCATTGACCTATGGCCTGGCAAC
GGGGAAGGGGCCTCCACACTCCAGGGTGAGCCCAGGGCCCCCACGCCACCCTCGGGTACTGAGGTCACCCTGGCAGAGGTGCCCCTGCTG
GATGAGGTGGCTCCGGAGCCACTGCTGCCAGCAGGCGAAGGCTGTGCCACCCTTCTCAACTTTGATGAGCTGCCTGAGCCGCCAGCCACC
TTCTGTGACCCAGAGGAAGTGGAAGGGGAGTCCCTGGCTGCCCCCCAGACCCCAACTCTGCCCTCAGCCCTTGAGGAGCTGGAGCAAGAG
CAGGAGCCGGAGCCCCACCTGCTAACCAATGGCGAGACCACCCAGAAGGAGGGGACCCAGGCCAGTGAGGGGTACTTCAGTCAATCACAG
GAGGAGGAGTTTGCCCAATCGGAAGAGCTCTGTGCCAAGGCTCCGCCTCCTGTGTTCTACAACAAGCCTCCAGAGATCGACATCACATGC
TGGGATGCAGACCCAGTTCCAGAAGAGGAGGAGGGCTTCGAGGGTGGTGATTAGCGGTGGCGCCAGCCCTAGGCTACCCTTGCCAAGGCC
GCCCACCTGCATCAGCCTCTGGCCAGACGGCCCGCCGTGCCTGCATTCGCAGCAGCTCCGCCTGGCACCCACTCCGGATTCCGGCCCTGG
CTGGGGACTTGGCCGCTTCCCTACCCACAGGGCCTGACTTTTACAGCTTTTCTCTTTTTTTAAAAAGTTGATAGGAGACTTGTACAGTTG
ACTGGCTTTCCTCTCGTTGGTAGTTGAGACGCTGTTGCAAATTCCACCCCTCCTTCCCTGGTCCAGATTGTAGCTCTTAGTCCTCCCTGC
TCAGCTGGCCGGGTTGGAGGCCTCACCCTGCTTGGGGCCTGGCGTGGGGGGAGCTCTGGTGGGAAAATGTCCCCCACCTCTTTTCCTAGT
TTTATGTTTCTTGGGAAAATATCACTTTGTATTCTCTGTCCAGGGCTTCAGATATTTTGCACGAATTTTAAAACATGGCAATAAATGGCT

>In-frame_LMAN2_ENST00000515209_chr5_176778174_-_DBN1_ENST00000393565_chr5_176887704_-_2129nt
ATGGCGGCGGAAGGCTGGATTTGGCGTTGGGGCTGGGGCCGGCGGTGCCTGGGAAGGCCTGGGCTTCTCGGCCCCGGCCCTGGCCCCACT
ACACCTCTCTTTCTTCTTTTGTTGTTGGGGTCTGTGACTGCGGATATAACTGACGGCAACAGTGAACATCTCAAGCGGGAGCATTCGCTC
ATTAAGCCCTACCAAGGGGTCGGTTCCAGCTCTATGCCCCTCTGGGACTTCCAGGGCAGCACTATGCTCACGAGCCAGTACGTACGTCTG
ACCCCTGACGAGCGCAGCAAAGAGGGCTCTATCTGGAACCACCAGGGTGACCATCGGGATGAGGAGGAAGAGACCCACATGAAGAAGTCA
GAGTCGGAGGTGGAGGAGGCAGCAGCTATTATTGCCCAGCGGCCTGACAACCCAAGGGAGTTCTTCAAGCAGCAGGAAAGAGTCGCATCG
GCCTCTGCGGGCAGCTGTGATGTACCCTCGCCCTTCAACCATCGACCAGGTCGTCCGTACTGCCCTTTCATAAAGGCATCGGACAGTGGG
CCTTCCTCCTCCTCCTCTTCCTCCTCCTCCCCTCCACGGACTCCCTTTCCCTATATCACCTGCCACCGCACCCCAAACCTCTCTTCCTCC
CTCCCATGCAGCCACCTGGACAGCCACCGGAGGATGGCGCCCACTCCCATCCCCACGCGGAGCCCGTCTGACTCCAGCACCGCCTCCACC
CCTGTCGCTGAGCAGATAGAGCGGGCCCTGGATGAGGTCACCTCCTCGCAGCCTCCACCACTGCCACCGCCACCCCCACCAGCCCAAGAG
ACCCAGGAGCCCAGCCCCATCCTAGACAGTGAGGAGACCAGAGCAGCAGCCCCTCAGGCCTGGGCCGGCCCCATGGAGGAGCCCCCTCAG
GCACAGGCGCCTCCCCGGGGGCCAGGCAGCCCTGCAGAGGACTTGATGTTCATGGAGTCTGCAGAGCAGGCTGTCCTGGCTGCTCCCGTG
GAGCCTGCCACAGCTGACGCCACGGAGATCCACGATGCAGCTGACACCATTGAAACTGACACTGCCACTGCTGACACCACTGTTGCCAAC
AACGTACCCCCCGCCGCCACCAGCCTCATTGACCTATGGCCTGGCAACGGGGAAGGGGCCTCCACACTCCAGGGTGAGCCCAGGGCCCCC
ACGCCACCCTCGGGTACTGAGGTCACCCTGGCAGAGGTGCCCCTGCTGGATGAGGTGGCTCCGGAGCCACTGCTGCCAGCAGGCGAAGGC
TGTGCCACCCTTCTCAACTTTGATGAGCTGCCTGAGCCGCCAGCCACCTTCTGTGACCCAGAGGAAGTGGAAGGGGAGTCCCTGGCTGCC
CCCCAGACCCCAACTCTGCCCTCAGCCCTTGAGGAGCTGGAGCAAGAGCAGGAGCCGGAGCCCCACCTGCTAACCAATGGCGAGACCACC
CAGAAGGAGGGGACCCAGGCCAGTGAGGGGTACTTCAGTCAATCACAGGAGGAGGAGTTTGCCCAATCGGAAGAGCTCTGTGCCAAGGCT
CCGCCTCCTGTGTTCTACAACAAGCCTCCAGAGATCGACATCACATGCTGGGATGCAGACCCAGTTCCAGAAGAGGAGGAGGGCTTCGAG
GGTGGTGATTAGCGGTGGCGCCAGCCCTAGGCTACCCTTGCCAAGGCCGCCCACCTGCATCAGCCTCTGGCCAGACGGCCCGCCGTGCCT
GCATTCGCAGCAGCTCCGCCTGGCACCCACTCCGGATTCCGGCCCTGGCTGGGGACTTGGCCGCTTCCCTACCCACAGGGCCTGACTTTT
ACAGCTTTTCTCTTTTTTTAAAAAGTTGATAGGAGACTTGTACAGTTGACTGGCTTTCCTCTCGTTGGTAGTTGAGACGCTGTTGCAAAT
TCCACCCCTCCTTCCCTGGTCCAGATTGTAGCTCTTAGTCCTCCCTGCTCAGCTGGCCGGGTTGGAGGCCTCACCCTGCTTGGGGCCTGG
CGTGGGGGGAGCTCTGGTGGGAAAATGTCCCCCACCTCTTTTCCTAGTTTTATGTTTCTTGGGAAAATATCACTTTGTATTCTCTGTCCA


Top

FusionGenePPI for LMAN2_DBN1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
LMAN2ISG15, ATP13A2, FLOT1, UBL4A, ATP4A, FRAT1, MAPK9, SUPT5H, RPA3, RPA2, RPA1, MOV10, NXF1, CCDC8, HEATR3, PLXNB2, CENPH, GPC3, TTYH3, CACNA2D1, NDUFS2, PDIA6, TM9SF4, NDUFS3, TMED10, TMED2, NTRK1, SPPL2BDBN1DNMBP, SNUPN, BAK1, NUDT21, MEST, NUDT3, DUSP23, MAPK6, FHL1, BTRC, TPT1, MAP1LC3B, UBE2D3, TAB1, CDK2AP2, ARRB2, SP1, UBE2Q2, FBXO25, TERF1, TINF2, ACD, POT1, LRRK2, TPM1, CALU, ZC3H4, TPM4, RPLP0, TXNDC5, FLNA, MTHFD1, NUP133, JUP, ECE1, CDH2, SPTBN1, SPTAN1, HNRNPUL1, MARCKS, ESR1, MAGOH, BTK, FN1, PHB, PAN2, PIK3C3, FBXO6, LRCH3, TP53, MOV10, EZH2, SUZ12, BMI1, USP7, NTRK1, GRB2, RABGAP1L, PTEN, HIST1H3E, ACTG1, ACTN4, ACTN1, AP2A1, AP2A2, AP2B1, ANXA2, ATP6V1A, ATP6AP1, DST, CALM1, CAMK2G, CAPZA2, CAPZB, CAV1, CD44, CD59, CDC42, CFL1, CFL2, AP2M1, CLTA, CLTB, CLTC, CPM, DAB2, CDK2, GAK, MYH9, MYO1C, PPP1CB, IQGAP1, ACTR2, SYNPO, MAPRE1, LIMA1, ANLN, MYO19, MYO18A, DSG2, CTTN, STOM, EPS15, FLII, FLNB, FLOT2, GART, GNAS, GNB2, GSN, HSP90AB1, IARS, ITPKA, LGALS1, ABLIM1, LMO7, MYO1B, MYO1E, MYO5A, MYO5B, MYO6, PPP1R12A, NAP1L1, NAP1L4, NF2, PALM, PIK3C2A, PPP1CA, PPP1CC, TWF1, RAB1A, SDC4, SIPA1, FSCN1, SSFA2, SVIL, TMOD1, CORO2A, YES1, LUZP1, CLTCL1, PICALM, SORBS2, NUMB, GPRC5A, LRRFIP1, LRRFIP2, XPR1, ABCG2, HOMER3, HOMER1, CLINT1, ARHGAP11A, SEC16A, WDR1, ARPC5, ARPC4, ARPC3, ARPC1B, ACTR3, ARPC2, FLOT1, BASP1, DCTN2, ARPC1A, ERLIN1, AKAP2, RRAS2, CEP162, TAB2, MPRIP, COBL, SPECC1L, CORO1C, ZDHHC5, PLEKHG3, RAI14, TIMM13, UHRF1, PACSIN3, TMOD3, CARD10, GTSE1, C14orf166, PALMD, BMP2K, PPP1R9A, ERBB2IP, MYO5C, CGN, ARHGAP21, AFAP1, INF2, CYBRD1, ARPC5L, KCTD10, DCTN5, PPP1R9B, STON2, DIXDC1, SSH2, NEXN, SPECC1, FCHO2, MISP, CHMP4B, PPP1R18, PTRF, TPRN, MCM5, CDH1, HOMER2, ACTA2, ACTB, ACTBL2, TMOD2, COX15, DLST, DNM1L, PARK7, PDHA1, RNF168, TES


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for LMAN2_DBN1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for LMAN2_DBN1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneDBN1C0036341Schizophrenia3PSYGENET
TgeneDBN1C0005586Bipolar Disorder1PSYGENET