FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 1986

FusionGeneSummary for ANXA2_SLC51A

check button Fusion gene summary
Fusion gene informationFusion gene name: ANXA2_SLC51A
Fusion gene ID: 1986
HgeneTgene
Gene symbol

ANXA2

SLC51A

Gene ID

302

200931

Gene nameannexin A2solute carrier family 51 alpha subunit
SynonymsANX2|ANX2L4|CAL1H|HEL-S-270|LIP2|LPC2|LPC2D|P36|PAP-IVOSTA|OSTalpha
Cytomap

15q22.2

3q29

Type of geneprotein-codingprotein-coding
Descriptionannexin A2annexin IIannexin-2calpactin I heavy chaincalpactin I heavy polypeptidecalpactin-1 heavy chainchromobindin 8epididymis secretory protein Li 270lipocortin IIplacental anticoagulant protein IVprotein Iorganic solute transporter subunit alphaOST-alphaorganic solute transporter alphaorganic solute transporter, alpha subunitsolute carrier family 51 subunit alpha
Modification date2018052220180523
UniProtAcc

P07355

Q86UW1

Ensembl transtripts involved in fusion geneENST00000396024, ENST00000451270, 
ENST00000332680, ENST00000421017, 
ENST00000557937, 
ENST00000296327, 
ENST00000479732, 
Fusion gene scores* DoF score7 X 7 X 3=1471 X 1 X 1=1
# samples 81
** MAII scorelog2(8/147*10)=-0.877744249949002
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(1/1*10)=3.32192809488736
Context

PubMed: ANXA2 [Title/Abstract] AND SLC51A [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneANXA2

GO:0001921

positive regulation of receptor recycling

22848640

HgeneANXA2

GO:0031340

positive regulation of vesicle fusion

2138016

HgeneANXA2

GO:0032804

negative regulation of low-density lipoprotein particle receptor catabolic process

22848640

HgeneANXA2

GO:0036035

osteoclast development

7961821

HgeneANXA2

GO:0051290

protein heterotetramerization

23091277|23861394

HgeneANXA2

GO:1905581

positive regulation of low-density lipoprotein particle clearance

22848640

HgeneANXA2

GO:1905597

positive regulation of low-density lipoprotein particle receptor binding

22848640

HgeneANXA2

GO:1905602

positive regulation of receptor-mediated endocytosis involved in cholesterol transport

22848640


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDSTADTCGA-CG-4437-01AANXA2chr15

60653140

-SLC51Achr3

195959290

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000396024ENST00000296327ANXA2chr15

60653140

-SLC51Achr3

195959290

+
5CDS-intronENST00000396024ENST00000479732ANXA2chr15

60653140

-SLC51Achr3

195959290

+
In-frameENST00000451270ENST00000296327ANXA2chr15

60653140

-SLC51Achr3

195959290

+
5CDS-intronENST00000451270ENST00000479732ANXA2chr15

60653140

-SLC51Achr3

195959290

+
In-frameENST00000332680ENST00000296327ANXA2chr15

60653140

-SLC51Achr3

195959290

+
5CDS-intronENST00000332680ENST00000479732ANXA2chr15

60653140

-SLC51Achr3

195959290

+
In-frameENST00000421017ENST00000296327ANXA2chr15

60653140

-SLC51Achr3

195959290

+
5CDS-intronENST00000421017ENST00000479732ANXA2chr15

60653140

-SLC51Achr3

195959290

+
intron-3CDSENST00000557937ENST00000296327ANXA2chr15

60653140

-SLC51Achr3

195959290

+
intron-intronENST00000557937ENST00000479732ANXA2chr15

60653140

-SLC51Achr3

195959290

+

Top

FusionProtFeatures for ANXA2_SLC51A


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ANXA2

P07355

SLC51A

Q86UW1

Calcium-regulated membrane-binding protein whoseaffinity for calcium is greatly enhanced by anionic phospholipids.It binds two calcium ions with high affinity. May be involved inheat-stress response. Inhibits PCSK9-enhanced LDLR degradation,probably reduces PCSK9 protein levels via a translationalmechanism but also competes with LDLR for binding with PCSK9(PubMed:18799458, PubMed:24808179, PubMed:22848640).{ECO:0000269|PubMed:18799458, ECO:0000269|PubMed:22848640,ECO:0000269|PubMed:24808179}. Essential component of the Ost-alpha/Ost-beta complex, aheterodimer that acts as the intestinal basolateral transporterresponsible for bile acid export from enterocytes into portalblood. Efficiently transports the major species of bile acids.{ECO:0000269|PubMed:16317684}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneANXA2chr15:60653140chr3:195959290ENST00000332680-5132_24137358RegionS100A10-binding site
HgeneANXA2chr15:60653140chr3:195959290ENST00000396024-6142_24119340RegionS100A10-binding site
HgeneANXA2chr15:60653140chr3:195959290ENST00000421017-6142_24119340RegionS100A10-binding site
HgeneANXA2chr15:60653140chr3:195959290ENST00000451270-5132_24119340RegionS100A10-binding site
HgeneANXA2chr15:60653140chr3:195959290ENST00000332680-51342_102137358RepeatNote=Annexin 1
HgeneANXA2chr15:60653140chr3:195959290ENST00000396024-61442_102119340RepeatNote=Annexin 1
HgeneANXA2chr15:60653140chr3:195959290ENST00000421017-61442_102119340RepeatNote=Annexin 1
HgeneANXA2chr15:60653140chr3:195959290ENST00000451270-51342_102119340RepeatNote=Annexin 1
TgeneSLC51Achr15:60653140chr3:195959290ENST00000296327+69277_294260341Topological domainExtracellular
TgeneSLC51Achr15:60653140chr3:195959290ENST00000296327+69318_340260341Topological domainCytoplasmic
TgeneSLC51Achr15:60653140chr3:195959290ENST00000296327+69295_317260341TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneANXA2chr15:60653140chr3:195959290ENST00000332680-513114_174137358RepeatNote=Annexin 2
HgeneANXA2chr15:60653140chr3:195959290ENST00000332680-513199_259137358RepeatNote=Annexin 3
HgeneANXA2chr15:60653140chr3:195959290ENST00000332680-513274_334137358RepeatNote=Annexin 4
HgeneANXA2chr15:60653140chr3:195959290ENST00000396024-614114_174119340RepeatNote=Annexin 2
HgeneANXA2chr15:60653140chr3:195959290ENST00000396024-614199_259119340RepeatNote=Annexin 3
HgeneANXA2chr15:60653140chr3:195959290ENST00000396024-614274_334119340RepeatNote=Annexin 4
HgeneANXA2chr15:60653140chr3:195959290ENST00000421017-614114_174119340RepeatNote=Annexin 2
HgeneANXA2chr15:60653140chr3:195959290ENST00000421017-614199_259119340RepeatNote=Annexin 3
HgeneANXA2chr15:60653140chr3:195959290ENST00000421017-614274_334119340RepeatNote=Annexin 4
HgeneANXA2chr15:60653140chr3:195959290ENST00000451270-513114_174119340RepeatNote=Annexin 2
HgeneANXA2chr15:60653140chr3:195959290ENST00000451270-513199_259119340RepeatNote=Annexin 3
HgeneANXA2chr15:60653140chr3:195959290ENST00000451270-513274_334119340RepeatNote=Annexin 4
TgeneSLC51Achr15:60653140chr3:195959290ENST00000296327+69160_167260341Compositional biasNote=Poly-Cys
TgeneSLC51Achr15:60653140chr3:195959290ENST00000296327+69109_118260341Topological domainExtracellular
TgeneSLC51Achr15:60653140chr3:195959290ENST00000296327+69140_181260341Topological domainCytoplasmic
TgeneSLC51Achr15:60653140chr3:195959290ENST00000296327+691_48260341Topological domainExtracellular
TgeneSLC51Achr15:60653140chr3:195959290ENST00000296327+69203_218260341Topological domainExtracellular
TgeneSLC51Achr15:60653140chr3:195959290ENST00000296327+69240_255260341Topological domainCytoplasmic
TgeneSLC51Achr15:60653140chr3:195959290ENST00000296327+6970_87260341Topological domainCytoplasmic
TgeneSLC51Achr15:60653140chr3:195959290ENST00000296327+69119_139260341TransmembraneHelical
TgeneSLC51Achr15:60653140chr3:195959290ENST00000296327+69182_202260341TransmembraneHelical
TgeneSLC51Achr15:60653140chr3:195959290ENST00000296327+69219_239260341TransmembraneHelical
TgeneSLC51Achr15:60653140chr3:195959290ENST00000296327+69256_276260341TransmembraneHelical
TgeneSLC51Achr15:60653140chr3:195959290ENST00000296327+6949_69260341TransmembraneHelical
TgeneSLC51Achr15:60653140chr3:195959290ENST00000296327+6988_108260341TransmembraneHelical


Top

FusionGeneSequence for ANXA2_SLC51A


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ANXA2_ENST00000396024_chr15_60653140_-_SLC51A_ENST00000296327_chr3_195959290_+_200aa
MSTVHEILCKLSLEGDHSTPPSATGSVKATTNFDAERDALNIETAIKTKGVDEVTIVNILTNRSNAQRQDIAFAYQRRTKKELASALKSA
LSGHLETVILGLLKTPAQTDASELKASMKVLLILTALQPSIFSVLANGGQIACSPPTSSKTRSQVMNCHLLILETFLMTVLTRMYYRRKD

>In-frame_ANXA2_ENST00000451270_chr15_60653140_-_SLC51A_ENST00000296327_chr3_195959290_+_200aa
MSTVHEILCKLSLEGDHSTPPSATGSVKATTNFDAERDALNIETAIKTKGVDEVTIVNILTNRSNAQRQDIAFAYQRRTKKELASALKSA
LSGHLETVILGLLKTPAQTDASELKASMKVLLILTALQPSIFSVLANGGQIACSPPTSSKTRSQVMNCHLLILETFLMTVLTRMYYRRKD

>In-frame_ANXA2_ENST00000332680_chr15_60653140_-_SLC51A_ENST00000296327_chr3_195959290_+_218aa
MGRQLAGCGDAGKKASFKMSTVHEILCKLSLEGDHSTPPSATGSVKATTNFDAERDALNIETAIKTKGVDEVTIVNILTNRSNAQRQDIA
FAYQRRTKKELASALKSALSGHLETVILGLLKTPAQTDASELKASMKVLLILTALQPSIFSVLANGGQIACSPPTSSKTRSQVMNCHLLI

>In-frame_ANXA2_ENST00000421017_chr15_60653140_-_SLC51A_ENST00000296327_chr3_195959290_+_200aa
MSTVHEILCKLSLEGDHSTPPSATGSVKATTNFDAERDALNIETAIKTKGVDEVTIVNILTNRSNAQRQDIAFAYQRRTKKELASALKSA
LSGHLETVILGLLKTPAQTDASELKASMKVLLILTALQPSIFSVLANGGQIACSPPTSSKTRSQVMNCHLLILETFLMTVLTRMYYRRKD


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ANXA2_ENST00000396024_chr15_60653140_-_SLC51A_ENST00000296327_chr3_195959290_+_600nt
ATGTCTACTGTTCACGAAATCCTGTGCAAGCTCAGCTTGGAGGGTGATCACTCTACACCCCCAAGTGCATATGGGTCTGTCAAAGCCTAT
ACTAACTTTGATGCTGAGCGGGATGCTTTGAACATTGAAACAGCCATCAAGACCAAAGGTGTGGATGAGGTCACCATTGTCAACATTTTG
ACCAACCGCAGCAATGCACAGAGACAGGATATTGCCTTCGCCTACCAGAGAAGGACCAAAAAGGAACTTGCATCAGCACTGAAGTCAGCC
TTATCTGGCCACCTGGAGACGGTGATTTTGGGCCTATTGAAGACACCTGCTCAGTATGACGCTTCTGAGCTAAAAGCTTCCATGAAGGTT
CTCCTCATCCTGACTGCCCTACAGCCCTCCATCTTCTCAGTCTTGGCCAACGGTGGGCAGATTGCTTGTTCGCCTCCCTATTCCTCTAAA
ACCAGGTCTCAAGTGATGAATTGCCACCTCCTCATACTGGAGACTTTTCTAATGACTGTGCTGACACGAATGTACTACCGAAGGAAAGAC

>In-frame_ANXA2_ENST00000451270_chr15_60653140_-_SLC51A_ENST00000296327_chr3_195959290_+_600nt
ATGTCTACTGTTCACGAAATCCTGTGCAAGCTCAGCTTGGAGGGTGATCACTCTACACCCCCAAGTGCATATGGGTCTGTCAAAGCCTAT
ACTAACTTTGATGCTGAGCGGGATGCTTTGAACATTGAAACAGCCATCAAGACCAAAGGTGTGGATGAGGTCACCATTGTCAACATTTTG
ACCAACCGCAGCAATGCACAGAGACAGGATATTGCCTTCGCCTACCAGAGAAGGACCAAAAAGGAACTTGCATCAGCACTGAAGTCAGCC
TTATCTGGCCACCTGGAGACGGTGATTTTGGGCCTATTGAAGACACCTGCTCAGTATGACGCTTCTGAGCTAAAAGCTTCCATGAAGGTT
CTCCTCATCCTGACTGCCCTACAGCCCTCCATCTTCTCAGTCTTGGCCAACGGTGGGCAGATTGCTTGTTCGCCTCCCTATTCCTCTAAA
ACCAGGTCTCAAGTGATGAATTGCCACCTCCTCATACTGGAGACTTTTCTAATGACTGTGCTGACACGAATGTACTACCGAAGGAAAGAC

>In-frame_ANXA2_ENST00000332680_chr15_60653140_-_SLC51A_ENST00000296327_chr3_195959290_+_654nt
ATGGGCCGCCAGCTAGCGGGGTGTGGAGACGCTGGGAAGAAGGCTTCCTTCAAAATGTCTACTGTTCACGAAATCCTGTGCAAGCTCAGC
TTGGAGGGTGATCACTCTACACCCCCAAGTGCATATGGGTCTGTCAAAGCCTATACTAACTTTGATGCTGAGCGGGATGCTTTGAACATT
GAAACAGCCATCAAGACCAAAGGTGTGGATGAGGTCACCATTGTCAACATTTTGACCAACCGCAGCAATGCACAGAGACAGGATATTGCC
TTCGCCTACCAGAGAAGGACCAAAAAGGAACTTGCATCAGCACTGAAGTCAGCCTTATCTGGCCACCTGGAGACGGTGATTTTGGGCCTA
TTGAAGACACCTGCTCAGTATGACGCTTCTGAGCTAAAAGCTTCCATGAAGGTTCTCCTCATCCTGACTGCCCTACAGCCCTCCATCTTC
TCAGTCTTGGCCAACGGTGGGCAGATTGCTTGTTCGCCTCCCTATTCCTCTAAAACCAGGTCTCAAGTGATGAATTGCCACCTCCTCATA
CTGGAGACTTTTCTAATGACTGTGCTGACACGAATGTACTACCGAAGGAAAGACCACAAGGTTGGGTATGAAACTTTCTCTTCTCCAGAC

>In-frame_ANXA2_ENST00000421017_chr15_60653140_-_SLC51A_ENST00000296327_chr3_195959290_+_600nt
ATGTCTACTGTTCACGAAATCCTGTGCAAGCTCAGCTTGGAGGGTGATCACTCTACACCCCCAAGTGCATATGGGTCTGTCAAAGCCTAT
ACTAACTTTGATGCTGAGCGGGATGCTTTGAACATTGAAACAGCCATCAAGACCAAAGGTGTGGATGAGGTCACCATTGTCAACATTTTG
ACCAACCGCAGCAATGCACAGAGACAGGATATTGCCTTCGCCTACCAGAGAAGGACCAAAAAGGAACTTGCATCAGCACTGAAGTCAGCC
TTATCTGGCCACCTGGAGACGGTGATTTTGGGCCTATTGAAGACACCTGCTCAGTATGACGCTTCTGAGCTAAAAGCTTCCATGAAGGTT
CTCCTCATCCTGACTGCCCTACAGCCCTCCATCTTCTCAGTCTTGGCCAACGGTGGGCAGATTGCTTGTTCGCCTCCCTATTCCTCTAAA
ACCAGGTCTCAAGTGATGAATTGCCACCTCCTCATACTGGAGACTTTTCTAATGACTGTGCTGACACGAATGTACTACCGAAGGAAAGAC


* Fusion transcript sequences (Full-length transcript).
>In-frame_ANXA2_ENST00000396024_chr15_60653140_-_SLC51A_ENST00000296327_chr3_195959290_+_991nt
GCTCAGCATTTGGGGACGCTCTCAGCTCTCGGCGCACGGCCCAGGGTGAAAATGTTTGCCATTAAACTCACATGAAGTAGGAAATATTTA
TATGGATACAAAAGGCACCTGCATGGGATAATGTCAAATTTCATAGATACTGCTTTGTGCTTCCTTCAAAATGTCTACTGTTCACGAAAT
CCTGTGCAAGCTCAGCTTGGAGGGTGATCACTCTACACCCCCAAGTGCATATGGGTCTGTCAAAGCCTATACTAACTTTGATGCTGAGCG
GGATGCTTTGAACATTGAAACAGCCATCAAGACCAAAGGTGTGGATGAGGTCACCATTGTCAACATTTTGACCAACCGCAGCAATGCACA
GAGACAGGATATTGCCTTCGCCTACCAGAGAAGGACCAAAAAGGAACTTGCATCAGCACTGAAGTCAGCCTTATCTGGCCACCTGGAGAC
GGTGATTTTGGGCCTATTGAAGACACCTGCTCAGTATGACGCTTCTGAGCTAAAAGCTTCCATGAAGGTTCTCCTCATCCTGACTGCCCT
ACAGCCCTCCATCTTCTCAGTCTTGGCCAACGGTGGGCAGATTGCTTGTTCGCCTCCCTATTCCTCTAAAACCAGGTCTCAAGTGATGAA
TTGCCACCTCCTCATACTGGAGACTTTTCTAATGACTGTGCTGACACGAATGTACTACCGAAGGAAAGACCACAAGGTTGGGTATGAAAC
TTTCTCTTCTCCAGACCTGGACTTGAACCTCAAAGCCTAAGGTGGATGGCTTGGACAATGAAAGGATGCTGTACTCATTAGAATACAAGA
TTCCTTTACTGTCCCTCAACCTTGACCAAATGGGAAGCATTCCCCCTTGTCAACACAAGCTGGCAGATACATTTGACTCTACAGATGAAG
GTGAACAATGTTAGAATAAAATTGCTTTGGATCTTGCCTGGAAGGTGTTTTAAGTTTTGTAATAAACAAGATGATGTCTGAAAATGTGTA

>In-frame_ANXA2_ENST00000451270_chr15_60653140_-_SLC51A_ENST00000296327_chr3_195959290_+_943nt
GCCTCGCCTAGGGAGGATGTGGCGGGTATAAAAGCCCCACCCAGGCCAGCCGGCTCTGCTCAGCATTTGGGGACGCTCTCAGCTCTCGGC
GCACGGCCCAGCTTCCTTCAAAATGTCTACTGTTCACGAAATCCTGTGCAAGCTCAGCTTGGAGGGTGATCACTCTACACCCCCAAGTGC
ATATGGGTCTGTCAAAGCCTATACTAACTTTGATGCTGAGCGGGATGCTTTGAACATTGAAACAGCCATCAAGACCAAAGGTGTGGATGA
GGTCACCATTGTCAACATTTTGACCAACCGCAGCAATGCACAGAGACAGGATATTGCCTTCGCCTACCAGAGAAGGACCAAAAAGGAACT
TGCATCAGCACTGAAGTCAGCCTTATCTGGCCACCTGGAGACGGTGATTTTGGGCCTATTGAAGACACCTGCTCAGTATGACGCTTCTGA
GCTAAAAGCTTCCATGAAGGTTCTCCTCATCCTGACTGCCCTACAGCCCTCCATCTTCTCAGTCTTGGCCAACGGTGGGCAGATTGCTTG
TTCGCCTCCCTATTCCTCTAAAACCAGGTCTCAAGTGATGAATTGCCACCTCCTCATACTGGAGACTTTTCTAATGACTGTGCTGACACG
AATGTACTACCGAAGGAAAGACCACAAGGTTGGGTATGAAACTTTCTCTTCTCCAGACCTGGACTTGAACCTCAAAGCCTAAGGTGGATG
GCTTGGACAATGAAAGGATGCTGTACTCATTAGAATACAAGATTCCTTTACTGTCCCTCAACCTTGACCAAATGGGAAGCATTCCCCCTT
GTCAACACAAGCTGGCAGATACATTTGACTCTACAGATGAAGGTGAACAATGTTAGAATAAAATTGCTTTGGATCTTGCCTGGAAGGTGT

>In-frame_ANXA2_ENST00000332680_chr15_60653140_-_SLC51A_ENST00000296327_chr3_195959290_+_957nt
CTCAGCATTTGGGGACGCTCTCAGCTCTCGGCGCACGGCCCAGGTAAGCGGGGCGCGCCCTGCCCGCCCGCGATGGGCCGCCAGCTAGCG
GGGTGTGGAGACGCTGGGAAGAAGGCTTCCTTCAAAATGTCTACTGTTCACGAAATCCTGTGCAAGCTCAGCTTGGAGGGTGATCACTCT
ACACCCCCAAGTGCATATGGGTCTGTCAAAGCCTATACTAACTTTGATGCTGAGCGGGATGCTTTGAACATTGAAACAGCCATCAAGACC
AAAGGTGTGGATGAGGTCACCATTGTCAACATTTTGACCAACCGCAGCAATGCACAGAGACAGGATATTGCCTTCGCCTACCAGAGAAGG
ACCAAAAAGGAACTTGCATCAGCACTGAAGTCAGCCTTATCTGGCCACCTGGAGACGGTGATTTTGGGCCTATTGAAGACACCTGCTCAG
TATGACGCTTCTGAGCTAAAAGCTTCCATGAAGGTTCTCCTCATCCTGACTGCCCTACAGCCCTCCATCTTCTCAGTCTTGGCCAACGGT
GGGCAGATTGCTTGTTCGCCTCCCTATTCCTCTAAAACCAGGTCTCAAGTGATGAATTGCCACCTCCTCATACTGGAGACTTTTCTAATG
ACTGTGCTGACACGAATGTACTACCGAAGGAAAGACCACAAGGTTGGGTATGAAACTTTCTCTTCTCCAGACCTGGACTTGAACCTCAAA
GCCTAAGGTGGATGGCTTGGACAATGAAAGGATGCTGTACTCATTAGAATACAAGATTCCTTTACTGTCCCTCAACCTTGACCAAATGGG
AAGCATTCCCCCTTGTCAACACAAGCTGGCAGATACATTTGACTCTACAGATGAAGGTGAACAATGTTAGAATAAAATTGCTTTGGATCT

>In-frame_ANXA2_ENST00000421017_chr15_60653140_-_SLC51A_ENST00000296327_chr3_195959290_+_967nt
GCTCAGCATTTGGGGACGCTCTCAGCTCTCGGCGCACGGCCCAGGTTATCTTGTAGCATAGCAACTTCGGATTTCACTCTACCCGGAGAG
TTTCCCGCTTGGTTGAACACATTGGCCTCAGGAAGCTTCCTTCAAAATGTCTACTGTTCACGAAATCCTGTGCAAGCTCAGCTTGGAGGG
TGATCACTCTACACCCCCAAGTGCATATGGGTCTGTCAAAGCCTATACTAACTTTGATGCTGAGCGGGATGCTTTGAACATTGAAACAGC
CATCAAGACCAAAGGTGTGGATGAGGTCACCATTGTCAACATTTTGACCAACCGCAGCAATGCACAGAGACAGGATATTGCCTTCGCCTA
CCAGAGAAGGACCAAAAAGGAACTTGCATCAGCACTGAAGTCAGCCTTATCTGGCCACCTGGAGACGGTGATTTTGGGCCTATTGAAGAC
ACCTGCTCAGTATGACGCTTCTGAGCTAAAAGCTTCCATGAAGGTTCTCCTCATCCTGACTGCCCTACAGCCCTCCATCTTCTCAGTCTT
GGCCAACGGTGGGCAGATTGCTTGTTCGCCTCCCTATTCCTCTAAAACCAGGTCTCAAGTGATGAATTGCCACCTCCTCATACTGGAGAC
TTTTCTAATGACTGTGCTGACACGAATGTACTACCGAAGGAAAGACCACAAGGTTGGGTATGAAACTTTCTCTTCTCCAGACCTGGACTT
GAACCTCAAAGCCTAAGGTGGATGGCTTGGACAATGAAAGGATGCTGTACTCATTAGAATACAAGATTCCTTTACTGTCCCTCAACCTTG
ACCAAATGGGAAGCATTCCCCCTTGTCAACACAAGCTGGCAGATACATTTGACTCTACAGATGAAGGTGAACAATGTTAGAATAAAATTG


Top

FusionGenePPI for ANXA2_SLC51A


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ANXA2PPM1B, CEACAM1, TRPV5, PHB, CTSB, PLAT, SOS1, GRB2, PCNA, S100A10, APOH, STAT6, MGMT, H2AFX, CD4, CDK7, NCOA3, EP300, UBE3A, ARRB1, ARRB2, SP1, ISG15, TERF1, POT1, CUL2, CDK2, PPP2R1A, MID1, CD99, MYOC, CDK9, SHC1, APP, GNB2L1, RPS13, RPL11, ESR1, HNF1A, VCP, MYC, FN1, VCAM1, IQCB1, MLH1, ITGA4, TP53, NPM1, HMGA1, TERT, BAG3, ATP4A, YWHAQ, PARK2, DNAJC8, LOC100128588, RPA3, RPA2, RPA1, WWOX, ASB9, SPRTN, PLA2G4A, CUL7, OBSL1, CCDC8, SIRT6, ANXA13, MAP1S, RPS6KB2, HNRNPA1, ANXA11, CACYBP, FUBP1, LGALS1, NCKAP1L, PRDX2, RAB7A, EWSR1, PCBP2, PDCD6, NTRK1, PTEN, DBN1, FLNA, MYH9, PPP1CB, IQGAP1, SYNPO, LIMA1, MYO19, MYO18A, FBXL12, MCM2, MCM5, ERBB3, ERRFI1, ESRRB, U2AF2, RAB14, CDC73, CDH1, AHNAK2, KLHL42, CYLD, DLST, HSD17B10, PDHA1, SOAT1, STAT3, TRIM25, UBE2A, RSC1A1, DCAF4L2SLC51AATXN1, ANO6, TMEM63A, UBB, FAM8A1, KIAA1715


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ANXA2_SLC51A


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
HgeneANXA2P07355DB00031TenecteplaseAnnexin A2biotechapproved
HgeneANXA2P07355DB11638ArtenimolAnnexin A2small moleculeapproved|investigational

Top

RelatedDiseases for ANXA2_SLC51A


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneANXA2C0007137Squamous cell carcinoma1CTD_human
HgeneANXA2C0023467Leukemia, Myelocytic, Acute1CTD_human
HgeneANXA2C0023893Liver Cirrhosis, Experimental1CTD_human
HgeneANXA2C0023903Liver neoplasms1CTD_human
HgeneANXA2C0024121Lung Neoplasms1CTD_human
HgeneANXA2C0024667Animal Mammary Neoplasms1CTD_human
HgeneANXA2C0026640Mouth Neoplasms1CTD_human
HgeneANXA2C0027626Neoplasm Invasiveness1CTD_human
HgeneANXA2C0029456Osteoporosis1CTD_human
HgeneANXA2C0043094Weight Gain1CTD_human
HgeneANXA2C0345967Malignant mesothelioma1CTD_human
HgeneANXA2C4277682Chemical and Drug Induced Liver Injury1CTD_human
TgeneSLC51AC0008370Cholestasis2CTD_human
TgeneSLC51AC0023892Biliary cirrhosis1CTD_human