FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 19821

FusionGeneSummary for LIPG_UCMA

check button Fusion gene summary
Fusion gene informationFusion gene name: LIPG_UCMA
Fusion gene ID: 19821
HgeneTgene
Gene symbol

LIPG

UCMA

Gene ID

9388

221044

Gene namelipase G, endothelial typeupper zone of growth plate and cartilage matrix associated
SynonymsEDL|EL|PRO719C10orf49|GRP|GRP/UCMA
Cytomap

18q21.1

10p13

Type of geneprotein-codingprotein-coding
Descriptionendothelial lipaseendothelial cell-derived lipaselipase, endotheliallipoprotein lipase Hunique cartilage matrix-associated proteinGla-rich protein
Modification date2018051920180519
UniProtAcc

Q9Y5X9

Q8WVF2

Ensembl transtripts involved in fusion geneENST00000577628, ENST00000261292, 
ENST00000427224, ENST00000580036, 
ENST00000378681, ENST00000463405, 
Fusion gene scores* DoF score1 X 1 X 1=12 X 2 X 2=8
# samples 12
** MAII scorelog2(1/1*10)=3.32192809488736log2(2/8*10)=1.32192809488736
Context

PubMed: LIPG [Title/Abstract] AND UCMA [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneLIPG

GO:0032376

positive regulation of cholesterol transport

19136670


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBLCATCGA-ZF-AA4T-01ALIPGchr18

47095918

+UCMAchr10

13275800

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000577628ENST00000378681LIPGchr18

47095918

+UCMAchr10

13275800

-
5CDS-intronENST00000577628ENST00000463405LIPGchr18

47095918

+UCMAchr10

13275800

-
In-frameENST00000261292ENST00000378681LIPGchr18

47095918

+UCMAchr10

13275800

-
5CDS-intronENST00000261292ENST00000463405LIPGchr18

47095918

+UCMAchr10

13275800

-
In-frameENST00000427224ENST00000378681LIPGchr18

47095918

+UCMAchr10

13275800

-
5CDS-intronENST00000427224ENST00000463405LIPGchr18

47095918

+UCMAchr10

13275800

-
In-frameENST00000580036ENST00000378681LIPGchr18

47095918

+UCMAchr10

13275800

-
5CDS-intronENST00000580036ENST00000463405LIPGchr18

47095918

+UCMAchr10

13275800

-

Top

FusionProtFeatures for LIPG_UCMA


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
LIPG

Q9Y5X9

UCMA

Q8WVF2

Has phospholipase and triglyceride lipase activities.Hydrolyzes high density lipoproteins (HDL) more efficiently thanother lipoproteins. Binds heparin. May be involved in the negative control of osteogenicdifferentiation of osteochondrogenic precursor cells in peripheralzones of fetal cartilage and at the cartilage-bone interface.{ECO:0000250}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneLIPGchr18:47095918chr10:13275800ENST00000261292+410118_121190501Compositional biasNote=Poly-Val
HgeneLIPGchr18:47095918chr10:13275800ENST00000580036+46118_121190355Compositional biasNote=Poly-Val
TgeneUCMAchr18:47095918chr10:13275800ENST00000378681-0590_12219139Coiled coilOntology_term=ECO:0000255

- In-frame and not-retained protein feature among the 13 regional features.
>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneLIPGchr18:47095918chr10:13275800ENST00000261292+410347_482190501DomainPLAT
HgeneLIPGchr18:47095918chr10:13275800ENST00000580036+46347_482190355DomainPLAT
HgeneLIPGchr18:47095918chr10:13275800ENST00000261292+410325_337190501RegionHeparin-binding
HgeneLIPGchr18:47095918chr10:13275800ENST00000580036+46325_337190355RegionHeparin-binding


Top

FusionGeneSequence for LIPG_UCMA


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_LIPG_ENST00000577628_chr18_47095918_+_UCMA_ENST00000378681_chr10_13275800_-_346aa
MLSFSRDRLPSGRRVSGKCPPPPLGMAVGRGGSGCPEEGSGRKLELLESQLPAERAREEAGPSVRRPRDKLHKPKATQTEVKPSVRFNLR
TSKDPEHEGCYLSVGHSQPLEDCSFNMTAKTFFIIHGWTMSGIFENWLHKLVSALHTREKDANVVVVDWLPLAHQLYTDAVNNTRVVGHS
IARMLDWLQEKDDFSLGNVHLIGYSLGAHVAGTAGNFVKGTVGRITVLREGTSVSVGTMQMAGEEASEDAKQKIFMQESDASNFLKRRGK

>In-frame_LIPG_ENST00000261292_chr18_47095918_+_UCMA_ENST00000378681_chr10_13275800_-_310aa
MSNSVPLLCFWSLCTCFAAGSPVPFGPEGRLEDKLHKPKATQTEVKPSVRFNLRTSKDPEHEGCYLSVGHSQPLEDCSFNMTAKTFFIIH
GWTMSGIFENWLHKLVSALHTREKDANVVVVDWLPLAHQLYTDAVNNTRVVGHSIARMLDWLQEKDDFSLGNVHLIGYSLGAHVAGTAGN
FVKGTVGRITVLREGTSVSVGTMQMAGEEASEDAKQKIFMQESDASNFLKRRGKRSPKSRDEVNVENRQKLRVDELRRETYEEQRNEFEN

>In-frame_LIPG_ENST00000427224_chr18_47095918_+_UCMA_ENST00000378681_chr10_13275800_-_310aa
MSNSVPLLCFWSLCTCFAAGSPVPFGPEGRLEDKLHKPKATQTEVKPSVRFNLRTSKDPEHEGCYLSVGHSQPLEDCSFNMTAKTFFIIH
GWTMSGIFENWLHKLVSALHTREKDANVVVVDWLPLAHQLYTDAVNNTRVVGHSIARMLDWLQEKDDFSLGNVHLIGYSLGAHVAGTAGN
FVKGTVGRITVLREGTSVSVGTMQMAGEEASEDAKQKIFMQESDASNFLKRRGKRSPKSRDEVNVENRQKLRVDELRRETYEEQRNEFEN

>In-frame_LIPG_ENST00000580036_chr18_47095918_+_UCMA_ENST00000378681_chr10_13275800_-_310aa
MSNSVPLLCFWSLCTCFAAGSPVPFGPEGRLEDKLHKPKATQTEVKPSVRFNLRTSKDPEHEGCYLSVGHSQPLEDCSFNMTAKTFFIIH
GWTMSGIFENWLHKLVSALHTREKDANVVVVDWLPLAHQLYTDAVNNTRVVGHSIARMLDWLQEKDDFSLGNVHLIGYSLGAHVAGTAGN
FVKGTVGRITVLREGTSVSVGTMQMAGEEASEDAKQKIFMQESDASNFLKRRGKRSPKSRDEVNVENRQKLRVDELRRETYEEQRNEFEN


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_LIPG_ENST00000577628_chr18_47095918_+_UCMA_ENST00000378681_chr10_13275800_-_1038nt
ATGCTCTCCTTCTCCAGGGATCGCCTCCCCAGCGGACGCAGAGTTTCAGGGAAATGTCCGCCTCCGCCACTTGGGATGGCAGTGGGGAGA
GGAGGATCTGGGTGTCCGGAGGAGGGCAGTGGGAGAAAGCTGGAGCTGCTGGAGTCGCAGCTGCCTGCGGAGCGGGCCCGGGAGGAAGCG
GGGCCGAGCGTGCGGCGTCCACGCGATAAGCTCCACAAACCCAAAGCTACACAGACTGAGGTCAAACCATCTGTGAGGTTTAACCTCCGC
ACCTCCAAGGACCCAGAGCATGAAGGATGCTACCTCTCCGTCGGCCACAGCCAGCCCTTAGAAGACTGCAGTTTCAACATGACAGCTAAA
ACCTTTTTCATCATTCACGGATGGACGATGAGCGGTATCTTTGAAAACTGGCTGCACAAACTCGTGTCAGCCCTGCACACAAGAGAGAAA
GACGCCAATGTAGTTGTGGTTGACTGGCTCCCCCTGGCCCACCAGCTTTACACGGATGCGGTCAATAATACCAGGGTGGTGGGACACAGC
ATTGCCAGGATGCTCGACTGGCTGCAGGAGAAGGACGATTTTTCTCTCGGGAATGTCCACTTGATCGGCTACAGCCTCGGAGCGCACGTG
GCCGGGTATGCAGGCAACTTCGTGAAAGGAACGGTGGGCCGAATCACAGTGCTGAGAGAGGGAACCAGTGTATCTGTGGGCACCATGCAG
ATGGCGGGAGAAGAGGCGAGTGAAGATGCAAAACAGAAGATTTTCATGCAGGAATCAGATGCCTCGAATTTCCTCAAGAGGCGCGGCAAG
CGGTCCCCCAAGTCCAGAGATGAGGTCAATGTGGAAAACAGGCAGAAGCTTCGGGTTGATGAGCTGCGGAGAGAATATTACGAGGAACAA
AGGAATGAATTTGAGAACTTCGTGGAGGAACAAAACGATGAGCAGGAAGAGAGGAGCCGGGAGGCTGTGGAGCAGTGGCGCCAGTGGCAC

>In-frame_LIPG_ENST00000261292_chr18_47095918_+_UCMA_ENST00000378681_chr10_13275800_-_930nt
ATGAGCAACTCCGTTCCTCTGCTCTGTTTCTGGAGCCTCTGCTATTGCTTTGCTGCGGGGAGCCCCGTACCTTTTGGTCCAGAGGGACGG
CTGGAAGATAAGCTCCACAAACCCAAAGCTACACAGACTGAGGTCAAACCATCTGTGAGGTTTAACCTCCGCACCTCCAAGGACCCAGAG
CATGAAGGATGCTACCTCTCCGTCGGCCACAGCCAGCCCTTAGAAGACTGCAGTTTCAACATGACAGCTAAAACCTTTTTCATCATTCAC
GGATGGACGATGAGCGGTATCTTTGAAAACTGGCTGCACAAACTCGTGTCAGCCCTGCACACAAGAGAGAAAGACGCCAATGTAGTTGTG
GTTGACTGGCTCCCCCTGGCCCACCAGCTTTACACGGATGCGGTCAATAATACCAGGGTGGTGGGACACAGCATTGCCAGGATGCTCGAC
TGGCTGCAGGAGAAGGACGATTTTTCTCTCGGGAATGTCCACTTGATCGGCTACAGCCTCGGAGCGCACGTGGCCGGGTATGCAGGCAAC
TTCGTGAAAGGAACGGTGGGCCGAATCACAGTGCTGAGAGAGGGAACCAGTGTATCTGTGGGCACCATGCAGATGGCGGGAGAAGAGGCG
AGTGAAGATGCAAAACAGAAGATTTTCATGCAGGAATCAGATGCCTCGAATTTCCTCAAGAGGCGCGGCAAGCGGTCCCCCAAGTCCAGA
GATGAGGTCAATGTGGAAAACAGGCAGAAGCTTCGGGTTGATGAGCTGCGGAGAGAATATTACGAGGAACAAAGGAATGAATTTGAGAAC
TTCGTGGAGGAACAAAACGATGAGCAGGAAGAGAGGAGCCGGGAGGCTGTGGAGCAGTGGCGCCAGTGGCACTATGACGGCCTGCACCCA

>In-frame_LIPG_ENST00000427224_chr18_47095918_+_UCMA_ENST00000378681_chr10_13275800_-_930nt
ATGAGCAACTCCGTTCCTCTGCTCTGTTTCTGGAGCCTCTGCTATTGCTTTGCTGCGGGGAGCCCCGTACCTTTTGGTCCAGAGGGACGG
CTGGAAGATAAGCTCCACAAACCCAAAGCTACACAGACTGAGGTCAAACCATCTGTGAGGTTTAACCTCCGCACCTCCAAGGACCCAGAG
CATGAAGGATGCTACCTCTCCGTCGGCCACAGCCAGCCCTTAGAAGACTGCAGTTTCAACATGACAGCTAAAACCTTTTTCATCATTCAC
GGATGGACGATGAGCGGTATCTTTGAAAACTGGCTGCACAAACTCGTGTCAGCCCTGCACACAAGAGAGAAAGACGCCAATGTAGTTGTG
GTTGACTGGCTCCCCCTGGCCCACCAGCTTTACACGGATGCGGTCAATAATACCAGGGTGGTGGGACACAGCATTGCCAGGATGCTCGAC
TGGCTGCAGGAGAAGGACGATTTTTCTCTCGGGAATGTCCACTTGATCGGCTACAGCCTCGGAGCGCACGTGGCCGGGTATGCAGGCAAC
TTCGTGAAAGGAACGGTGGGCCGAATCACAGTGCTGAGAGAGGGAACCAGTGTATCTGTGGGCACCATGCAGATGGCGGGAGAAGAGGCG
AGTGAAGATGCAAAACAGAAGATTTTCATGCAGGAATCAGATGCCTCGAATTTCCTCAAGAGGCGCGGCAAGCGGTCCCCCAAGTCCAGA
GATGAGGTCAATGTGGAAAACAGGCAGAAGCTTCGGGTTGATGAGCTGCGGAGAGAATATTACGAGGAACAAAGGAATGAATTTGAGAAC
TTCGTGGAGGAACAAAACGATGAGCAGGAAGAGAGGAGCCGGGAGGCTGTGGAGCAGTGGCGCCAGTGGCACTATGACGGCCTGCACCCA

>In-frame_LIPG_ENST00000580036_chr18_47095918_+_UCMA_ENST00000378681_chr10_13275800_-_930nt
ATGAGCAACTCCGTTCCTCTGCTCTGTTTCTGGAGCCTCTGCTATTGCTTTGCTGCGGGGAGCCCCGTACCTTTTGGTCCAGAGGGACGG
CTGGAAGATAAGCTCCACAAACCCAAAGCTACACAGACTGAGGTCAAACCATCTGTGAGGTTTAACCTCCGCACCTCCAAGGACCCAGAG
CATGAAGGATGCTACCTCTCCGTCGGCCACAGCCAGCCCTTAGAAGACTGCAGTTTCAACATGACAGCTAAAACCTTTTTCATCATTCAC
GGATGGACGATGAGCGGTATCTTTGAAAACTGGCTGCACAAACTCGTGTCAGCCCTGCACACAAGAGAGAAAGACGCCAATGTAGTTGTG
GTTGACTGGCTCCCCCTGGCCCACCAGCTTTACACGGATGCGGTCAATAATACCAGGGTGGTGGGACACAGCATTGCCAGGATGCTCGAC
TGGCTGCAGGAGAAGGACGATTTTTCTCTCGGGAATGTCCACTTGATCGGCTACAGCCTCGGAGCGCACGTGGCCGGGTATGCAGGCAAC
TTCGTGAAAGGAACGGTGGGCCGAATCACAGTGCTGAGAGAGGGAACCAGTGTATCTGTGGGCACCATGCAGATGGCGGGAGAAGAGGCG
AGTGAAGATGCAAAACAGAAGATTTTCATGCAGGAATCAGATGCCTCGAATTTCCTCAAGAGGCGCGGCAAGCGGTCCCCCAAGTCCAGA
GATGAGGTCAATGTGGAAAACAGGCAGAAGCTTCGGGTTGATGAGCTGCGGAGAGAATATTACGAGGAACAAAGGAATGAATTTGAGAAC
TTCGTGGAGGAACAAAACGATGAGCAGGAAGAGAGGAGCCGGGAGGCTGTGGAGCAGTGGCGCCAGTGGCACTATGACGGCCTGCACCCA


* Fusion transcript sequences (Full-length transcript).
>In-frame_LIPG_ENST00000577628_chr18_47095918_+_UCMA_ENST00000378681_chr10_13275800_-_2361nt
AATGAGGCGAGGTCGGAACAGGATCTGCTGGCTCCGGCTCGGTTTCCTCGCACAGGTCTCTCCAGCTGGATCCTCGACGCTAGGGAGGAA
GGGGCGCGGGACTGCTGTGGGGGTTTTCCCTCCCCAGGCAGGGGCAGGACCTGTTCCGGGCGACTGCAGGGTTAAGGGTATCGTCTTAAA
GAGCCGGATCCTCCCGGCTGGAGCGAGGCTGGATGGCGGGACGCAGCCTCTCAGCCTCTCGTACCCGCCCTGCGTCCGCAGTGGTTGTTG
GCGCAGCCGCCCCGTCGGTGTTCCGGGCTCAGTCCCCGCTCCCCAGCGCCAGACGCAGACTCCGGGCCAAGTTCTCCCTCCGCTCGCTGC
TTTCTGCCGCAGGACCCGGATCAATAAAGGGAAGGAGAGCCGGGAGGAAATGATGGAGAACAGAGAGAAAGGAGATGCTTGATTTCACTC
GCCAAGGAGTGAGTGCTCATCGGCAGACACTGGGCTCTGGCCACGCGTCTTAGACTCCAAATCTCGGCTCACTGGTCCCTTTGAGGAGGT
CGCCTGGTGTTCCCGTAGCCCTCCACCCCACCGTAGGAGAGCGCCTGCCACGAGCTCCGCGCCTCGCTAAGTGCTTTGCTACGTGAACTC
TTAGTTTTCCCAACATCCCTAAGCCGCCGATACATTATCACCCACGTATTGCGGACGAGAGAACCGCCTCGGAGAAGCTGGCTGGCTCGC
TTGGAGTTTTGCAGCTAGTGGCGGAGCGAGCATTCCGAGCAGGTACTGTGCGATCCTCCAGCGCCGGCCGCAGCTCACAGCCCCTTAGCT
CCGCCGGGTTATTGTGCGGCCGCGCCTTCTGCACCTGTTGCGGCCCTCGCTAGGCGGGAAGGGAGGGAGAAGAGGAGGACAAAGGGGATG
ACCAGGTGGCTCTCCCCCGACGGACTCCCGGCCCAGGGAGCGGATAGACCACTCCCAGAGAGAGTGTGGCTTTGAGCCTTGGAGAGGATG
CTCTCCTTCTCCAGGGATCGCCTCCCCAGCGGACGCAGAGTTTCAGGGAAATGTCCGCCTCCGCCACTTGGGATGGCAGTGGGGAGAGGA
GGATCTGGGTGTCCGGAGGAGGGCAGTGGGAGAAAGCTGGAGCTGCTGGAGTCGCAGCTGCCTGCGGAGCGGGCCCGGGAGGAAGCGGGG
CCGAGCGTGCGGCGTCCACGCGATAAGCTCCACAAACCCAAAGCTACACAGACTGAGGTCAAACCATCTGTGAGGTTTAACCTCCGCACC
TCCAAGGACCCAGAGCATGAAGGATGCTACCTCTCCGTCGGCCACAGCCAGCCCTTAGAAGACTGCAGTTTCAACATGACAGCTAAAACC
TTTTTCATCATTCACGGATGGACGATGAGCGGTATCTTTGAAAACTGGCTGCACAAACTCGTGTCAGCCCTGCACACAAGAGAGAAAGAC
GCCAATGTAGTTGTGGTTGACTGGCTCCCCCTGGCCCACCAGCTTTACACGGATGCGGTCAATAATACCAGGGTGGTGGGACACAGCATT
GCCAGGATGCTCGACTGGCTGCAGGAGAAGGACGATTTTTCTCTCGGGAATGTCCACTTGATCGGCTACAGCCTCGGAGCGCACGTGGCC
GGGTATGCAGGCAACTTCGTGAAAGGAACGGTGGGCCGAATCACAGTGCTGAGAGAGGGAACCAGTGTATCTGTGGGCACCATGCAGATG
GCGGGAGAAGAGGCGAGTGAAGATGCAAAACAGAAGATTTTCATGCAGGAATCAGATGCCTCGAATTTCCTCAAGAGGCGCGGCAAGCGG
TCCCCCAAGTCCAGAGATGAGGTCAATGTGGAAAACAGGCAGAAGCTTCGGGTTGATGAGCTGCGGAGAGAATATTACGAGGAACAAAGG
AATGAATTTGAGAACTTCGTGGAGGAACAAAACGATGAGCAGGAAGAGAGGAGCCGGGAGGCTGTGGAGCAGTGGCGCCAGTGGCACTAT
GACGGCCTGCACCCATCCTATCTCTACAACCGCCACCACACCTGATCCCATCCTGAAGCCGGCCAAGAAGACAAAGCTTGTAGCACCATT
GGCATCCCCGTGTTCCAGCAATCTTTCCCATGCAAACCGGCCCTTCAGAGGGTCTCAGCTTGGGGTCTGCAGTGGCCAGCAGCTCTTGAA
AAGACGCATGCCTTTCCTTCCAGTGTGTGAAAGTGTCCTGACTTTCACCTCTTTGCAGACCATCTTCTGAGGTGAGCAACTGCCTGCAGG
GCCTCCTAGTACCAAACCTACAGTGGCTTCCCCTGGCTTCGTTCCCAAGCAAAAGAATCAGTCAAGAATCACATGTTTGCTTATGGCTTA

>In-frame_LIPG_ENST00000261292_chr18_47095918_+_UCMA_ENST00000378681_chr10_13275800_-_1544nt
AAAAACTACCTCTATAGGAGCGTGACAGCAGCGAGTCCTTGCCTCCCGGCGGCTCAGGACGAGGGCAGATCTCGTTCTGGGGCAAGCCGT
TGACACTCGCTCCCTGCCACCGCCCGGGCTCCGTGCCGCCAAGTTTTCATTTTCCACCTTCTCTGCCTCCAGTCCCCCAGCCCCTGGCCG
AGAGAAGGGTCTTACCGGCCGGGATTGCTGGAAACACCAAGAGGTGGTTTTTGTTTTTTAAAACTTCTGTTTCTTGGGAGGGGGTGTGGC
GGGGCAGGATGAGCAACTCCGTTCCTCTGCTCTGTTTCTGGAGCCTCTGCTATTGCTTTGCTGCGGGGAGCCCCGTACCTTTTGGTCCAG
AGGGACGGCTGGAAGATAAGCTCCACAAACCCAAAGCTACACAGACTGAGGTCAAACCATCTGTGAGGTTTAACCTCCGCACCTCCAAGG
ACCCAGAGCATGAAGGATGCTACCTCTCCGTCGGCCACAGCCAGCCCTTAGAAGACTGCAGTTTCAACATGACAGCTAAAACCTTTTTCA
TCATTCACGGATGGACGATGAGCGGTATCTTTGAAAACTGGCTGCACAAACTCGTGTCAGCCCTGCACACAAGAGAGAAAGACGCCAATG
TAGTTGTGGTTGACTGGCTCCCCCTGGCCCACCAGCTTTACACGGATGCGGTCAATAATACCAGGGTGGTGGGACACAGCATTGCCAGGA
TGCTCGACTGGCTGCAGGAGAAGGACGATTTTTCTCTCGGGAATGTCCACTTGATCGGCTACAGCCTCGGAGCGCACGTGGCCGGGTATG
CAGGCAACTTCGTGAAAGGAACGGTGGGCCGAATCACAGTGCTGAGAGAGGGAACCAGTGTATCTGTGGGCACCATGCAGATGGCGGGAG
AAGAGGCGAGTGAAGATGCAAAACAGAAGATTTTCATGCAGGAATCAGATGCCTCGAATTTCCTCAAGAGGCGCGGCAAGCGGTCCCCCA
AGTCCAGAGATGAGGTCAATGTGGAAAACAGGCAGAAGCTTCGGGTTGATGAGCTGCGGAGAGAATATTACGAGGAACAAAGGAATGAAT
TTGAGAACTTCGTGGAGGAACAAAACGATGAGCAGGAAGAGAGGAGCCGGGAGGCTGTGGAGCAGTGGCGCCAGTGGCACTATGACGGCC
TGCACCCATCCTATCTCTACAACCGCCACCACACCTGATCCCATCCTGAAGCCGGCCAAGAAGACAAAGCTTGTAGCACCATTGGCATCC
CCGTGTTCCAGCAATCTTTCCCATGCAAACCGGCCCTTCAGAGGGTCTCAGCTTGGGGTCTGCAGTGGCCAGCAGCTCTTGAAAAGACGC
ATGCCTTTCCTTCCAGTGTGTGAAAGTGTCCTGACTTTCACCTCTTTGCAGACCATCTTCTGAGGTGAGCAACTGCCTGCAGGGCCTCCT
AGTACCAAACCTACAGTGGCTTCCCCTGGCTTCGTTCCCAAGCAAAAGAATCAGTCAAGAATCACATGTTTGCTTATGGCTTACAAATAA

>In-frame_LIPG_ENST00000427224_chr18_47095918_+_UCMA_ENST00000378681_chr10_13275800_-_1515nt
AGCGAGTCCTTGCCTCCCGGCGGCTCAGGACGAGGGCAGATCTCGTTCTGGGGCAAGCCGTTGACACTCGCTCCCTGCCACCGCCCGGGC
TCCGTGCCGCCAAGTTTTCATTTTCCACCTTCTCTGCCTCCAGTCCCCCAGCCCCTGGCCGAGAGAAGGGTCTTACCGGCCGGGATTGCT
GGAAACACCAAGAGGTGGTTTTTGTTTTTTAAAACTTCTGTTTCTTGGGAGGGGGTGTGGCGGGGCAGGATGAGCAACTCCGTTCCTCTG
CTCTGTTTCTGGAGCCTCTGCTATTGCTTTGCTGCGGGGAGCCCCGTACCTTTTGGTCCAGAGGGACGGCTGGAAGATAAGCTCCACAAA
CCCAAAGCTACACAGACTGAGGTCAAACCATCTGTGAGGTTTAACCTCCGCACCTCCAAGGACCCAGAGCATGAAGGATGCTACCTCTCC
GTCGGCCACAGCCAGCCCTTAGAAGACTGCAGTTTCAACATGACAGCTAAAACCTTTTTCATCATTCACGGATGGACGATGAGCGGTATC
TTTGAAAACTGGCTGCACAAACTCGTGTCAGCCCTGCACACAAGAGAGAAAGACGCCAATGTAGTTGTGGTTGACTGGCTCCCCCTGGCC
CACCAGCTTTACACGGATGCGGTCAATAATACCAGGGTGGTGGGACACAGCATTGCCAGGATGCTCGACTGGCTGCAGGAGAAGGACGAT
TTTTCTCTCGGGAATGTCCACTTGATCGGCTACAGCCTCGGAGCGCACGTGGCCGGGTATGCAGGCAACTTCGTGAAAGGAACGGTGGGC
CGAATCACAGTGCTGAGAGAGGGAACCAGTGTATCTGTGGGCACCATGCAGATGGCGGGAGAAGAGGCGAGTGAAGATGCAAAACAGAAG
ATTTTCATGCAGGAATCAGATGCCTCGAATTTCCTCAAGAGGCGCGGCAAGCGGTCCCCCAAGTCCAGAGATGAGGTCAATGTGGAAAAC
AGGCAGAAGCTTCGGGTTGATGAGCTGCGGAGAGAATATTACGAGGAACAAAGGAATGAATTTGAGAACTTCGTGGAGGAACAAAACGAT
GAGCAGGAAGAGAGGAGCCGGGAGGCTGTGGAGCAGTGGCGCCAGTGGCACTATGACGGCCTGCACCCATCCTATCTCTACAACCGCCAC
CACACCTGATCCCATCCTGAAGCCGGCCAAGAAGACAAAGCTTGTAGCACCATTGGCATCCCCGTGTTCCAGCAATCTTTCCCATGCAAA
CCGGCCCTTCAGAGGGTCTCAGCTTGGGGTCTGCAGTGGCCAGCAGCTCTTGAAAAGACGCATGCCTTTCCTTCCAGTGTGTGAAAGTGT
CCTGACTTTCACCTCTTTGCAGACCATCTTCTGAGGTGAGCAACTGCCTGCAGGGCCTCCTAGTACCAAACCTACAGTGGCTTCCCCTGG

>In-frame_LIPG_ENST00000580036_chr18_47095918_+_UCMA_ENST00000378681_chr10_13275800_-_1488nt
GGACGAGGGCAGATCTCGTTCTGGGGCAAGCCGTTGACACTCGCTCCCTGCCACCGCCCGGGCTCCGTGCCGCCAAGTTTTCATTTTCCA
CCTTCTCTGCCTCCAGTCCCCCAGCCCCTGGCCGAGAGAAGGGTCTTACCGGCCGGGATTGCTGGAAACACCAAGAGGTGGTTTTTGTTT
TTTAAAACTTCTGTTTCTTGGGAGGGGGTGTGGCGGGGCAGGATGAGCAACTCCGTTCCTCTGCTCTGTTTCTGGAGCCTCTGCTATTGC
TTTGCTGCGGGGAGCCCCGTACCTTTTGGTCCAGAGGGACGGCTGGAAGATAAGCTCCACAAACCCAAAGCTACACAGACTGAGGTCAAA
CCATCTGTGAGGTTTAACCTCCGCACCTCCAAGGACCCAGAGCATGAAGGATGCTACCTCTCCGTCGGCCACAGCCAGCCCTTAGAAGAC
TGCAGTTTCAACATGACAGCTAAAACCTTTTTCATCATTCACGGATGGACGATGAGCGGTATCTTTGAAAACTGGCTGCACAAACTCGTG
TCAGCCCTGCACACAAGAGAGAAAGACGCCAATGTAGTTGTGGTTGACTGGCTCCCCCTGGCCCACCAGCTTTACACGGATGCGGTCAAT
AATACCAGGGTGGTGGGACACAGCATTGCCAGGATGCTCGACTGGCTGCAGGAGAAGGACGATTTTTCTCTCGGGAATGTCCACTTGATC
GGCTACAGCCTCGGAGCGCACGTGGCCGGGTATGCAGGCAACTTCGTGAAAGGAACGGTGGGCCGAATCACAGTGCTGAGAGAGGGAACC
AGTGTATCTGTGGGCACCATGCAGATGGCGGGAGAAGAGGCGAGTGAAGATGCAAAACAGAAGATTTTCATGCAGGAATCAGATGCCTCG
AATTTCCTCAAGAGGCGCGGCAAGCGGTCCCCCAAGTCCAGAGATGAGGTCAATGTGGAAAACAGGCAGAAGCTTCGGGTTGATGAGCTG
CGGAGAGAATATTACGAGGAACAAAGGAATGAATTTGAGAACTTCGTGGAGGAACAAAACGATGAGCAGGAAGAGAGGAGCCGGGAGGCT
GTGGAGCAGTGGCGCCAGTGGCACTATGACGGCCTGCACCCATCCTATCTCTACAACCGCCACCACACCTGATCCCATCCTGAAGCCGGC
CAAGAAGACAAAGCTTGTAGCACCATTGGCATCCCCGTGTTCCAGCAATCTTTCCCATGCAAACCGGCCCTTCAGAGGGTCTCAGCTTGG
GGTCTGCAGTGGCCAGCAGCTCTTGAAAAGACGCATGCCTTTCCTTCCAGTGTGTGAAAGTGTCCTGACTTTCACCTCTTTGCAGACCAT
CTTCTGAGGTGAGCAACTGCCTGCAGGGCCTCCTAGTACCAAACCTACAGTGGCTTCCCCTGGCTTCGTTCCCAAGCAAAAGAATCAGTC


Top

FusionGenePPI for LIPG_UCMA


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
LIPGFANCA, EXOSC5, LIPG, DNAJC13, TMED4, TUBB1, TMED9, TMED5, TRMT1, PLS1, PTPRS, NRP1, TMED10, TMED2, CANX, ITIH2, SDC2, HLA-C, MAPK14, ARL8A, ABHD14A, GPC3UCMAKRT40


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for LIPG_UCMA


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for LIPG_UCMA


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource