FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 19637

FusionGeneSummary for LETMD1_LARP4

check button Fusion gene summary
Fusion gene informationFusion gene name: LETMD1_LARP4
Fusion gene ID: 19637
HgeneTgene
Gene symbol

LETMD1

LARP4

Gene ID

25875

113251

Gene nameLETM1 domain containing 1La ribonucleoprotein domain family member 4
Synonyms1110019O13Rik|HCCR|HCCR-1|HCCR-2|HCCR1|HCCR2|HCRR-2|SLC55A3PP13296
Cytomap

12q13.12

12q13.12

Type of geneprotein-codingprotein-coding
DescriptionLETM1 domain-containing protein 1cervical cancer 1 proto-oncogene protein p40cervical cancer proto-oncogene 2 proteinhuman cervical cancer oncogeneregulator of TP53la-related protein 4c-Mpl binding protein
Modification date2018052320180527
UniProtAcc

Q6P1Q0

Q71RC2

Ensembl transtripts involved in fusion geneENST00000550929, ENST00000262055, 
ENST00000380123, ENST00000418425, 
ENST00000547008, ENST00000552739, 
ENST00000548516, 
ENST00000293618, 
ENST00000429001, ENST00000398473, 
ENST00000518444, ENST00000347328, 
ENST00000522085, ENST00000518561, 
Fusion gene scores* DoF score1 X 1 X 1=16 X 7 X 5=210
# samples 18
** MAII scorelog2(1/1*10)=3.32192809488736log2(8/210*10)=-1.39231742277876
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: LETMD1 [Title/Abstract] AND LARP4 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBLCATCGA-UY-A9PH-01ALETMD1chr12

51445990

+LARP4chr12

50847243

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000550929ENST00000293618LETMD1chr12

51445990

+LARP4chr12

50847243

+
In-frameENST00000550929ENST00000429001LETMD1chr12

51445990

+LARP4chr12

50847243

+
In-frameENST00000550929ENST00000398473LETMD1chr12

51445990

+LARP4chr12

50847243

+
In-frameENST00000550929ENST00000518444LETMD1chr12

51445990

+LARP4chr12

50847243

+
5CDS-intronENST00000550929ENST00000347328LETMD1chr12

51445990

+LARP4chr12

50847243

+
5CDS-intronENST00000550929ENST00000522085LETMD1chr12

51445990

+LARP4chr12

50847243

+
5CDS-intronENST00000550929ENST00000518561LETMD1chr12

51445990

+LARP4chr12

50847243

+
In-frameENST00000262055ENST00000293618LETMD1chr12

51445990

+LARP4chr12

50847243

+
In-frameENST00000262055ENST00000429001LETMD1chr12

51445990

+LARP4chr12

50847243

+
In-frameENST00000262055ENST00000398473LETMD1chr12

51445990

+LARP4chr12

50847243

+
In-frameENST00000262055ENST00000518444LETMD1chr12

51445990

+LARP4chr12

50847243

+
5CDS-intronENST00000262055ENST00000347328LETMD1chr12

51445990

+LARP4chr12

50847243

+
5CDS-intronENST00000262055ENST00000522085LETMD1chr12

51445990

+LARP4chr12

50847243

+
5CDS-intronENST00000262055ENST00000518561LETMD1chr12

51445990

+LARP4chr12

50847243

+
intron-3CDSENST00000380123ENST00000293618LETMD1chr12

51445990

+LARP4chr12

50847243

+
intron-3CDSENST00000380123ENST00000429001LETMD1chr12

51445990

+LARP4chr12

50847243

+
intron-3CDSENST00000380123ENST00000398473LETMD1chr12

51445990

+LARP4chr12

50847243

+
intron-3CDSENST00000380123ENST00000518444LETMD1chr12

51445990

+LARP4chr12

50847243

+
intron-intronENST00000380123ENST00000347328LETMD1chr12

51445990

+LARP4chr12

50847243

+
intron-intronENST00000380123ENST00000522085LETMD1chr12

51445990

+LARP4chr12

50847243

+
intron-intronENST00000380123ENST00000518561LETMD1chr12

51445990

+LARP4chr12

50847243

+
In-frameENST00000418425ENST00000293618LETMD1chr12

51445990

+LARP4chr12

50847243

+
In-frameENST00000418425ENST00000429001LETMD1chr12

51445990

+LARP4chr12

50847243

+
In-frameENST00000418425ENST00000398473LETMD1chr12

51445990

+LARP4chr12

50847243

+
In-frameENST00000418425ENST00000518444LETMD1chr12

51445990

+LARP4chr12

50847243

+
5CDS-intronENST00000418425ENST00000347328LETMD1chr12

51445990

+LARP4chr12

50847243

+
5CDS-intronENST00000418425ENST00000522085LETMD1chr12

51445990

+LARP4chr12

50847243

+
5CDS-intronENST00000418425ENST00000518561LETMD1chr12

51445990

+LARP4chr12

50847243

+
In-frameENST00000547008ENST00000293618LETMD1chr12

51445990

+LARP4chr12

50847243

+
In-frameENST00000547008ENST00000429001LETMD1chr12

51445990

+LARP4chr12

50847243

+
In-frameENST00000547008ENST00000398473LETMD1chr12

51445990

+LARP4chr12

50847243

+
In-frameENST00000547008ENST00000518444LETMD1chr12

51445990

+LARP4chr12

50847243

+
5CDS-intronENST00000547008ENST00000347328LETMD1chr12

51445990

+LARP4chr12

50847243

+
5CDS-intronENST00000547008ENST00000522085LETMD1chr12

51445990

+LARP4chr12

50847243

+
5CDS-intronENST00000547008ENST00000518561LETMD1chr12

51445990

+LARP4chr12

50847243

+
intron-3CDSENST00000552739ENST00000293618LETMD1chr12

51445990

+LARP4chr12

50847243

+
intron-3CDSENST00000552739ENST00000429001LETMD1chr12

51445990

+LARP4chr12

50847243

+
intron-3CDSENST00000552739ENST00000398473LETMD1chr12

51445990

+LARP4chr12

50847243

+
intron-3CDSENST00000552739ENST00000518444LETMD1chr12

51445990

+LARP4chr12

50847243

+
intron-intronENST00000552739ENST00000347328LETMD1chr12

51445990

+LARP4chr12

50847243

+
intron-intronENST00000552739ENST00000522085LETMD1chr12

51445990

+LARP4chr12

50847243

+
intron-intronENST00000552739ENST00000518561LETMD1chr12

51445990

+LARP4chr12

50847243

+
intron-3CDSENST00000548516ENST00000293618LETMD1chr12

51445990

+LARP4chr12

50847243

+
intron-3CDSENST00000548516ENST00000429001LETMD1chr12

51445990

+LARP4chr12

50847243

+
intron-3CDSENST00000548516ENST00000398473LETMD1chr12

51445990

+LARP4chr12

50847243

+
intron-3CDSENST00000548516ENST00000518444LETMD1chr12

51445990

+LARP4chr12

50847243

+
intron-intronENST00000548516ENST00000347328LETMD1chr12

51445990

+LARP4chr12

50847243

+
intron-intronENST00000548516ENST00000522085LETMD1chr12

51445990

+LARP4chr12

50847243

+
intron-intronENST00000548516ENST00000518561LETMD1chr12

51445990

+LARP4chr12

50847243

+

Top

FusionProtFeatures for LETMD1_LARP4


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
LETMD1

Q6P1Q0

LARP4

Q71RC2

RNA binding protein that binds to the poly-A tract ofmRNA molecules (PubMed:21098120). Associates with the 40Sribosomal subunit and with polysomes (PubMed:21098120). Plays arole in the regulation of mRNA translation (PubMed:21098120).Plays a role in the regulation of cell morphology and cytoskeletalorganization (PubMed:21834987, PubMed:27615744).{ECO:0000269|PubMed:21098120, ECO:0000269|PubMed:21834987,ECO:0000269|PubMed:27615744}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneLETMD1chr12:51445990chr12:50847243ENST00000262055+391_110130361RegionNote=Required and sufficient for mitochondrial import
TgeneLARP4chr12:51445990chr12:50847243ENST00000347328+015113_202-9654DomainHTH La-type RNA-binding
TgeneLARP4chr12:51445990chr12:50847243ENST00000347328+015203_281-9654DomainNote=RRM

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneLETMD1chr12:51445990chr12:50847243ENST00000262055+39186_360130361DomainLetm1 RBD
HgeneLETMD1chr12:51445990chr12:50847243ENST00000380123+17186_360-10372DomainLetm1 RBD
HgeneLETMD1chr12:51445990chr12:50847243ENST00000418425+19186_360-7374DomainLetm1 RBD
HgeneLETMD1chr12:51445990chr12:50847243ENST00000550929+39186_36074305DomainLetm1 RBD
HgeneLETMD1chr12:51445990chr12:50847243ENST00000380123+171_110-10372RegionNote=Required and sufficient for mitochondrial import
HgeneLETMD1chr12:51445990chr12:50847243ENST00000418425+191_110-7374RegionNote=Required and sufficient for mitochondrial import
HgeneLETMD1chr12:51445990chr12:50847243ENST00000550929+391_11074305RegionNote=Required and sufficient for mitochondrial import
HgeneLETMD1chr12:51445990chr12:50847243ENST00000262055+39159_360130361Topological domainMitochondrial intermembrane
HgeneLETMD1chr12:51445990chr12:50847243ENST00000262055+391_137130361Topological domainCytoplasmic
HgeneLETMD1chr12:51445990chr12:50847243ENST00000380123+17159_360-10372Topological domainMitochondrial intermembrane
HgeneLETMD1chr12:51445990chr12:50847243ENST00000380123+171_137-10372Topological domainCytoplasmic
HgeneLETMD1chr12:51445990chr12:50847243ENST00000418425+19159_360-7374Topological domainMitochondrial intermembrane
HgeneLETMD1chr12:51445990chr12:50847243ENST00000418425+191_137-7374Topological domainCytoplasmic
HgeneLETMD1chr12:51445990chr12:50847243ENST00000550929+39159_36074305Topological domainMitochondrial intermembrane
HgeneLETMD1chr12:51445990chr12:50847243ENST00000550929+391_13774305Topological domainCytoplasmic
HgeneLETMD1chr12:51445990chr12:50847243ENST00000262055+39138_158130361TransmembraneHelical
HgeneLETMD1chr12:51445990chr12:50847243ENST00000380123+17138_158-10372TransmembraneHelical
HgeneLETMD1chr12:51445990chr12:50847243ENST00000418425+19138_158-7374TransmembraneHelical
HgeneLETMD1chr12:51445990chr12:50847243ENST00000550929+39138_15874305TransmembraneHelical
TgeneLARP4chr12:51445990chr12:50847243ENST00000293618+715113_202268654DomainHTH La-type RNA-binding
TgeneLARP4chr12:51445990chr12:50847243ENST00000293618+715203_281268654DomainNote=RRM
TgeneLARP4chr12:51445990chr12:50847243ENST00000398473+716113_202268725DomainHTH La-type RNA-binding
TgeneLARP4chr12:51445990chr12:50847243ENST00000398473+716203_281268725DomainNote=RRM
TgeneLARP4chr12:51445990chr12:50847243ENST00000429001+716113_202274731DomainHTH La-type RNA-binding
TgeneLARP4chr12:51445990chr12:50847243ENST00000429001+716203_281274731DomainNote=RRM
TgeneLARP4chr12:51445990chr12:50847243ENST00000518444+716113_202267724DomainHTH La-type RNA-binding
TgeneLARP4chr12:51445990chr12:50847243ENST00000518444+716203_281267724DomainNote=RRM
TgeneLARP4chr12:51445990chr12:50847243ENST00000522085+711113_202268446DomainHTH La-type RNA-binding
TgeneLARP4chr12:51445990chr12:50847243ENST00000522085+711203_281268446DomainNote=RRM


Top

FusionGeneSequence for LETMD1_LARP4


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_LETMD1_ENST00000550929_chr12_51445990_+_LARP4_ENST00000293618_chr12_50847243_+_460aa
MSYVVTKTKAINGKYHRFLGRHFPRFYVLYTIFMKGLQMLWADAKKARRIKTNMWKHNIKFHQLPYREMEHLRQARIKAINTFFAKNGYR
LMDSSIYSHPIQTQAQYASPVFMQPVYNPHQQYSVYSIVPQSWSPNPTPYFETPLAPFPNGSFVNGFNSPGSYKTNAAAMNMGRPFQKNR
RTLFRGRRRREDDRISRPHPSTAESKAPTPKFDLLASNFPPLPGSSSRMPGELVLENRMSDVVKGVYKEKDNEELTISCPVPADEQTECT
SAQQLNMSTSSPCAAELTALSTTQQEKDLIEDSSVQKDGLNQTTIPVSPPSTTKPSRASTASPCNNNINAATAVALQEPRKLSYAEVCQK
PPKEPSSVLVQPLRELRSNVVSPTKNEDNGAPENSVEKPHEKPEARASKDYSGFRGNIIPRGAAGKIREQRRQFSHRAIPQGVTRRNGKE

>In-frame_LETMD1_ENST00000550929_chr12_51445990_+_LARP4_ENST00000429001_chr12_50847243_+_531aa
MSYVVTKTKAINGKYHRFLGRHFPRFYVLYTIFMKGLQMLWADAKKARRIKTNMWKHNIKFHQLPYREMEHLRQARIKAINTFFAKNGYR
LMDSSIYSHPIQTQAQYASPVFMQPVYNPHQQYSVYSIVPQSWSPNPTPYFETPLAPFPNGSFVNGFNSPGSYKTNAAAMNMGRPFQKNR
VKPQFRSSGGSEHSTEGSVSLGDGQLNRYSSRNFPAERHNPTVTGHQEQTYLQKETSTLQVEQNGDYGRGRRTLFRGRRRREDDRISRPH
PSTAESKAPTPKFDLLASNFPPLPGSSSRMPGELVLENRMSDVVKGVYKEKDNEELTISCPVPADEQTECTSAQQLNMSTSSPCAAELTA
LSTTQQEKDLIEDSSVQKDGLNQTTIPVSPPSTTKPSRASTASPCNNNINAATAVALQEPRKLSYAEVCQKPPKEPSSVLVQPLRELRSN

>In-frame_LETMD1_ENST00000550929_chr12_51445990_+_LARP4_ENST00000398473_chr12_50847243_+_531aa
MSYVVTKTKAINGKYHRFLGRHFPRFYVLYTIFMKGLQMLWADAKKARRIKTNMWKHNIKFHQLPYREMEHLRQARIKAINTFFAKNGYR
LMDSSIYSHPIQTQAQYASPVFMQPVYNPHQQYSVYSIVPQSWSPNPTPYFETPLAPFPNGSFVNGFNSPGSYKTNAAAMNMGRPFQKNR
VKPQFRSSGGSEHSTEGSVSLGDGQLNRYSSRNFPAERHNPTVTGHQEQTYLQKETSTLQVEQNGDYGRGRRTLFRGRRRREDDRISRPH
PSTAESKAPTPKFDLLASNFPPLPGSSSRMPGELVLENRMSDVVKGVYKEKDNEELTISCPVPADEQTECTSAQQLNMSTSSPCAAELTA
LSTTQQEKDLIEDSSVQKDGLNQTTIPVSPPSTTKPSRASTASPCNNNINAATAVALQEPRKLSYAEVCQKPPKEPSSVLVQPLRELRSN

>In-frame_LETMD1_ENST00000550929_chr12_51445990_+_LARP4_ENST00000518444_chr12_50847243_+_531aa
MSYVVTKTKAINGKYHRFLGRHFPRFYVLYTIFMKGLQMLWADAKKARRIKTNMWKHNIKFHQLPYREMEHLRQARIKAINTFFAKNGYR
LMDSSIYSHPIQTQAQYASPVFMQPVYNPHQQYSVYSIVPQSWSPNPTPYFETPLAPFPNGSFVNGFNSPGSYKTNAAAMNMGRPFQKNR
VKPQFRSSGGSEHSTEGSVSLGDGQLNRYSSRNFPAERHNPTVTGHQEQTYLQKETSTLQVEQNGDYGRGRRTLFRGRRRREDDRISRPH
PSTAESKAPTPKFDLLASNFPPLPGSSSRMPGELVLENRMSDVVKGVYKEKDNEELTISCPVPADEQTECTSAQQLNMSTSSPCAAELTA
LSTTQQEKDLIEDSSVQKDGLNQTTIPVSPPSTTKPSRASTASPCNNNINAATAVALQEPRKLSYAEVCQKPPKEPSSVLVQPLRELRSN

>In-frame_LETMD1_ENST00000262055_chr12_51445990_+_LARP4_ENST00000293618_chr12_50847243_+_516aa
MALSRVCWARSAVWGSAVTPGHFVTRRLQLGRSGLAWGAPRSSKLHLSPKADVKNLMSYVVTKTKAINGKYHRFLGRHFPRFYVLYTIFM
KGLQMLWADAKKARRIKTNMWKHNIKFHQLPYREMEHLRQARIKAINTFFAKNGYRLMDSSIYSHPIQTQAQYASPVFMQPVYNPHQQYS
VYSIVPQSWSPNPTPYFETPLAPFPNGSFVNGFNSPGSYKTNAAAMNMGRPFQKNRRTLFRGRRRREDDRISRPHPSTAESKAPTPKFDL
LASNFPPLPGSSSRMPGELVLENRMSDVVKGVYKEKDNEELTISCPVPADEQTECTSAQQLNMSTSSPCAAELTALSTTQQEKDLIEDSS
VQKDGLNQTTIPVSPPSTTKPSRASTASPCNNNINAATAVALQEPRKLSYAEVCQKPPKEPSSVLVQPLRELRSNVVSPTKNEDNGAPEN

>In-frame_LETMD1_ENST00000262055_chr12_51445990_+_LARP4_ENST00000429001_chr12_50847243_+_587aa
MALSRVCWARSAVWGSAVTPGHFVTRRLQLGRSGLAWGAPRSSKLHLSPKADVKNLMSYVVTKTKAINGKYHRFLGRHFPRFYVLYTIFM
KGLQMLWADAKKARRIKTNMWKHNIKFHQLPYREMEHLRQARIKAINTFFAKNGYRLMDSSIYSHPIQTQAQYASPVFMQPVYNPHQQYS
VYSIVPQSWSPNPTPYFETPLAPFPNGSFVNGFNSPGSYKTNAAAMNMGRPFQKNRVKPQFRSSGGSEHSTEGSVSLGDGQLNRYSSRNF
PAERHNPTVTGHQEQTYLQKETSTLQVEQNGDYGRGRRTLFRGRRRREDDRISRPHPSTAESKAPTPKFDLLASNFPPLPGSSSRMPGEL
VLENRMSDVVKGVYKEKDNEELTISCPVPADEQTECTSAQQLNMSTSSPCAAELTALSTTQQEKDLIEDSSVQKDGLNQTTIPVSPPSTT
KPSRASTASPCNNNINAATAVALQEPRKLSYAEVCQKPPKEPSSVLVQPLRELRSNVVSPTKNEDNGAPENSVEKPHEKPEARASKDYSG

>In-frame_LETMD1_ENST00000262055_chr12_51445990_+_LARP4_ENST00000398473_chr12_50847243_+_587aa
MALSRVCWARSAVWGSAVTPGHFVTRRLQLGRSGLAWGAPRSSKLHLSPKADVKNLMSYVVTKTKAINGKYHRFLGRHFPRFYVLYTIFM
KGLQMLWADAKKARRIKTNMWKHNIKFHQLPYREMEHLRQARIKAINTFFAKNGYRLMDSSIYSHPIQTQAQYASPVFMQPVYNPHQQYS
VYSIVPQSWSPNPTPYFETPLAPFPNGSFVNGFNSPGSYKTNAAAMNMGRPFQKNRVKPQFRSSGGSEHSTEGSVSLGDGQLNRYSSRNF
PAERHNPTVTGHQEQTYLQKETSTLQVEQNGDYGRGRRTLFRGRRRREDDRISRPHPSTAESKAPTPKFDLLASNFPPLPGSSSRMPGEL
VLENRMSDVVKGVYKEKDNEELTISCPVPADEQTECTSAQQLNMSTSSPCAAELTALSTTQQEKDLIEDSSVQKDGLNQTTIPVSPPSTT
KPSRASTASPCNNNINAATAVALQEPRKLSYAEVCQKPPKEPSSVLVQPLRELRSNVVSPTKNEDNGAPENSVEKPHEKPEARASKDYSG

>In-frame_LETMD1_ENST00000262055_chr12_51445990_+_LARP4_ENST00000518444_chr12_50847243_+_587aa
MALSRVCWARSAVWGSAVTPGHFVTRRLQLGRSGLAWGAPRSSKLHLSPKADVKNLMSYVVTKTKAINGKYHRFLGRHFPRFYVLYTIFM
KGLQMLWADAKKARRIKTNMWKHNIKFHQLPYREMEHLRQARIKAINTFFAKNGYRLMDSSIYSHPIQTQAQYASPVFMQPVYNPHQQYS
VYSIVPQSWSPNPTPYFETPLAPFPNGSFVNGFNSPGSYKTNAAAMNMGRPFQKNRVKPQFRSSGGSEHSTEGSVSLGDGQLNRYSSRNF
PAERHNPTVTGHQEQTYLQKETSTLQVEQNGDYGRGRRTLFRGRRRREDDRISRPHPSTAESKAPTPKFDLLASNFPPLPGSSSRMPGEL
VLENRMSDVVKGVYKEKDNEELTISCPVPADEQTECTSAQQLNMSTSSPCAAELTALSTTQQEKDLIEDSSVQKDGLNQTTIPVSPPSTT
KPSRASTASPCNNNINAATAVALQEPRKLSYAEVCQKPPKEPSSVLVQPLRELRSNVVSPTKNEDNGAPENSVEKPHEKPEARASKDYSG

>In-frame_LETMD1_ENST00000418425_chr12_51445990_+_LARP4_ENST00000293618_chr12_50847243_+_529aa
MALSRVCWARSAVWGSAVTPGHFVTRRLQLGRSGLAWGAPRSSKLHLSPKADVKNLMSYVVTKTKAINGKYHRFLGRHFPRFYVLYTIFM
KGLQMLWADAKKARRIKTNMWKHNIKFHQLPYREMEHLRQVWARGRYPEVHGEARIKAINTFFAKNGYRLMDSSIYSHPIQTQAQYASPV
FMQPVYNPHQQYSVYSIVPQSWSPNPTPYFETPLAPFPNGSFVNGFNSPGSYKTNAAAMNMGRPFQKNRRTLFRGRRRREDDRISRPHPS
TAESKAPTPKFDLLASNFPPLPGSSSRMPGELVLENRMSDVVKGVYKEKDNEELTISCPVPADEQTECTSAQQLNMSTSSPCAAELTALS
TTQQEKDLIEDSSVQKDGLNQTTIPVSPPSTTKPSRASTASPCNNNINAATAVALQEPRKLSYAEVCQKPPKEPSSVLVQPLRELRSNVV

>In-frame_LETMD1_ENST00000418425_chr12_51445990_+_LARP4_ENST00000429001_chr12_50847243_+_600aa
MALSRVCWARSAVWGSAVTPGHFVTRRLQLGRSGLAWGAPRSSKLHLSPKADVKNLMSYVVTKTKAINGKYHRFLGRHFPRFYVLYTIFM
KGLQMLWADAKKARRIKTNMWKHNIKFHQLPYREMEHLRQVWARGRYPEVHGEARIKAINTFFAKNGYRLMDSSIYSHPIQTQAQYASPV
FMQPVYNPHQQYSVYSIVPQSWSPNPTPYFETPLAPFPNGSFVNGFNSPGSYKTNAAAMNMGRPFQKNRVKPQFRSSGGSEHSTEGSVSL
GDGQLNRYSSRNFPAERHNPTVTGHQEQTYLQKETSTLQVEQNGDYGRGRRTLFRGRRRREDDRISRPHPSTAESKAPTPKFDLLASNFP
PLPGSSSRMPGELVLENRMSDVVKGVYKEKDNEELTISCPVPADEQTECTSAQQLNMSTSSPCAAELTALSTTQQEKDLIEDSSVQKDGL
NQTTIPVSPPSTTKPSRASTASPCNNNINAATAVALQEPRKLSYAEVCQKPPKEPSSVLVQPLRELRSNVVSPTKNEDNGAPENSVEKPH

>In-frame_LETMD1_ENST00000418425_chr12_51445990_+_LARP4_ENST00000398473_chr12_50847243_+_600aa
MALSRVCWARSAVWGSAVTPGHFVTRRLQLGRSGLAWGAPRSSKLHLSPKADVKNLMSYVVTKTKAINGKYHRFLGRHFPRFYVLYTIFM
KGLQMLWADAKKARRIKTNMWKHNIKFHQLPYREMEHLRQVWARGRYPEVHGEARIKAINTFFAKNGYRLMDSSIYSHPIQTQAQYASPV
FMQPVYNPHQQYSVYSIVPQSWSPNPTPYFETPLAPFPNGSFVNGFNSPGSYKTNAAAMNMGRPFQKNRVKPQFRSSGGSEHSTEGSVSL
GDGQLNRYSSRNFPAERHNPTVTGHQEQTYLQKETSTLQVEQNGDYGRGRRTLFRGRRRREDDRISRPHPSTAESKAPTPKFDLLASNFP
PLPGSSSRMPGELVLENRMSDVVKGVYKEKDNEELTISCPVPADEQTECTSAQQLNMSTSSPCAAELTALSTTQQEKDLIEDSSVQKDGL
NQTTIPVSPPSTTKPSRASTASPCNNNINAATAVALQEPRKLSYAEVCQKPPKEPSSVLVQPLRELRSNVVSPTKNEDNGAPENSVEKPH

>In-frame_LETMD1_ENST00000418425_chr12_51445990_+_LARP4_ENST00000518444_chr12_50847243_+_600aa
MALSRVCWARSAVWGSAVTPGHFVTRRLQLGRSGLAWGAPRSSKLHLSPKADVKNLMSYVVTKTKAINGKYHRFLGRHFPRFYVLYTIFM
KGLQMLWADAKKARRIKTNMWKHNIKFHQLPYREMEHLRQVWARGRYPEVHGEARIKAINTFFAKNGYRLMDSSIYSHPIQTQAQYASPV
FMQPVYNPHQQYSVYSIVPQSWSPNPTPYFETPLAPFPNGSFVNGFNSPGSYKTNAAAMNMGRPFQKNRVKPQFRSSGGSEHSTEGSVSL
GDGQLNRYSSRNFPAERHNPTVTGHQEQTYLQKETSTLQVEQNGDYGRGRRTLFRGRRRREDDRISRPHPSTAESKAPTPKFDLLASNFP
PLPGSSSRMPGELVLENRMSDVVKGVYKEKDNEELTISCPVPADEQTECTSAQQLNMSTSSPCAAELTALSTTQQEKDLIEDSSVQKDGL
NQTTIPVSPPSTTKPSRASTASPCNNNINAATAVALQEPRKLSYAEVCQKPPKEPSSVLVQPLRELRSNVVSPTKNEDNGAPENSVEKPH

>In-frame_LETMD1_ENST00000547008_chr12_51445990_+_LARP4_ENST00000293618_chr12_50847243_+_516aa
MALSRVCWARSAVWGSAVTPGHFVTRRLQLGRSGLAWGAPRSSKLHLSPKADVKNLMSYVVTKTKAINGKYHRFLGRHFPRFYVLYTIFM
KGLQMLWADAKKARRIKTNMWKHNIKFHQLPYREMEHLRQARIKAINTFFAKNGYRLMDSSIYSHPIQTQAQYASPVFMQPVYNPHQQYS
VYSIVPQSWSPNPTPYFETPLAPFPNGSFVNGFNSPGSYKTNAAAMNMGRPFQKNRRTLFRGRRRREDDRISRPHPSTAESKAPTPKFDL
LASNFPPLPGSSSRMPGELVLENRMSDVVKGVYKEKDNEELTISCPVPADEQTECTSAQQLNMSTSSPCAAELTALSTTQQEKDLIEDSS
VQKDGLNQTTIPVSPPSTTKPSRASTASPCNNNINAATAVALQEPRKLSYAEVCQKPPKEPSSVLVQPLRELRSNVVSPTKNEDNGAPEN

>In-frame_LETMD1_ENST00000547008_chr12_51445990_+_LARP4_ENST00000429001_chr12_50847243_+_587aa
MALSRVCWARSAVWGSAVTPGHFVTRRLQLGRSGLAWGAPRSSKLHLSPKADVKNLMSYVVTKTKAINGKYHRFLGRHFPRFYVLYTIFM
KGLQMLWADAKKARRIKTNMWKHNIKFHQLPYREMEHLRQARIKAINTFFAKNGYRLMDSSIYSHPIQTQAQYASPVFMQPVYNPHQQYS
VYSIVPQSWSPNPTPYFETPLAPFPNGSFVNGFNSPGSYKTNAAAMNMGRPFQKNRVKPQFRSSGGSEHSTEGSVSLGDGQLNRYSSRNF
PAERHNPTVTGHQEQTYLQKETSTLQVEQNGDYGRGRRTLFRGRRRREDDRISRPHPSTAESKAPTPKFDLLASNFPPLPGSSSRMPGEL
VLENRMSDVVKGVYKEKDNEELTISCPVPADEQTECTSAQQLNMSTSSPCAAELTALSTTQQEKDLIEDSSVQKDGLNQTTIPVSPPSTT
KPSRASTASPCNNNINAATAVALQEPRKLSYAEVCQKPPKEPSSVLVQPLRELRSNVVSPTKNEDNGAPENSVEKPHEKPEARASKDYSG

>In-frame_LETMD1_ENST00000547008_chr12_51445990_+_LARP4_ENST00000398473_chr12_50847243_+_587aa
MALSRVCWARSAVWGSAVTPGHFVTRRLQLGRSGLAWGAPRSSKLHLSPKADVKNLMSYVVTKTKAINGKYHRFLGRHFPRFYVLYTIFM
KGLQMLWADAKKARRIKTNMWKHNIKFHQLPYREMEHLRQARIKAINTFFAKNGYRLMDSSIYSHPIQTQAQYASPVFMQPVYNPHQQYS
VYSIVPQSWSPNPTPYFETPLAPFPNGSFVNGFNSPGSYKTNAAAMNMGRPFQKNRVKPQFRSSGGSEHSTEGSVSLGDGQLNRYSSRNF
PAERHNPTVTGHQEQTYLQKETSTLQVEQNGDYGRGRRTLFRGRRRREDDRISRPHPSTAESKAPTPKFDLLASNFPPLPGSSSRMPGEL
VLENRMSDVVKGVYKEKDNEELTISCPVPADEQTECTSAQQLNMSTSSPCAAELTALSTTQQEKDLIEDSSVQKDGLNQTTIPVSPPSTT
KPSRASTASPCNNNINAATAVALQEPRKLSYAEVCQKPPKEPSSVLVQPLRELRSNVVSPTKNEDNGAPENSVEKPHEKPEARASKDYSG

>In-frame_LETMD1_ENST00000547008_chr12_51445990_+_LARP4_ENST00000518444_chr12_50847243_+_587aa
MALSRVCWARSAVWGSAVTPGHFVTRRLQLGRSGLAWGAPRSSKLHLSPKADVKNLMSYVVTKTKAINGKYHRFLGRHFPRFYVLYTIFM
KGLQMLWADAKKARRIKTNMWKHNIKFHQLPYREMEHLRQARIKAINTFFAKNGYRLMDSSIYSHPIQTQAQYASPVFMQPVYNPHQQYS
VYSIVPQSWSPNPTPYFETPLAPFPNGSFVNGFNSPGSYKTNAAAMNMGRPFQKNRVKPQFRSSGGSEHSTEGSVSLGDGQLNRYSSRNF
PAERHNPTVTGHQEQTYLQKETSTLQVEQNGDYGRGRRTLFRGRRRREDDRISRPHPSTAESKAPTPKFDLLASNFPPLPGSSSRMPGEL
VLENRMSDVVKGVYKEKDNEELTISCPVPADEQTECTSAQQLNMSTSSPCAAELTALSTTQQEKDLIEDSSVQKDGLNQTTIPVSPPSTT
KPSRASTASPCNNNINAATAVALQEPRKLSYAEVCQKPPKEPSSVLVQPLRELRSNVVSPTKNEDNGAPENSVEKPHEKPEARASKDYSG


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_LETMD1_ENST00000550929_chr12_51445990_+_LARP4_ENST00000293618_chr12_50847243_+_1380nt
ATGTCTTATGTGGTAACCAAGACAAAAGCGATTAATGGGAAATACCATCGTTTCTTGGGTCGTCATTTCCCCCGCTTCTATGTCCTGTAC
ACAATCTTCATGAAAGGATTGCAGATGTTATGGGCTGATGCCAAAAAGGCTAGAAGAATAAAGACAAATATGTGGAAGCACAATATAAAG
TTTCATCAACTTCCATACCGGGAGATGGAGCATTTGAGACAGGCAAGGATAAAAGCCATCAATACATTTTTTGCTAAGAATGGTTATCGA
TTAATGGATTCTAGTATCTATAGTCACCCCATTCAAACTCAAGCACAGTATGCCTCCCCAGTCTTTATGCAGCCTGTATATAATCCTCAC
CAACAGTACTCGGTCTATAGTATTGTGCCTCAGTCTTGGTCTCCAAATCCTACACCTTACTTTGAAACACCACTGGCTCCCTTTCCCAAT
GGTAGTTTTGTGAATGGCTTTAATTCGCCAGGATCTTATAAAACAAATGCTGCTGCTATGAATATGGGTCGACCATTCCAAAAAAATCGG
AGAACTCTCTTCAGAGGTCGAAGACGACGAGAAGATGACAGGATCTCAAGACCTCATCCTTCAACAGCTGAATCAAAGGCTCCAACACCA
AAGTTTGACTTATTAGCCTCAAATTTTCCACCTTTACCTGGAAGTTCATCAAGAATGCCAGGTGAACTCGTTTTGGAGAATAGGATGTCT
GATGTTGTTAAAGGTGTCTACAAAGAAAAGGATAATGAAGAGTTGACAATTAGTTGCCCAGTGCCTGCAGATGAGCAGACAGAATGCACT
TCTGCCCAGCAACTCAATATGAGTACCAGTTCTCCATGTGCTGCTGAGCTTACTGCATTAAGCACAACTCAGCAAGAAAAGGATCTAATA
GAAGATTCCTCTGTTCAGAAGGATGGTCTCAATCAGACAACTATACCAGTTTCTCCTCCAAGTACTACAAAGCCATCGAGGGCAAGTACT
GCTTCACCATGTAATAATAACATAAATGCAGCTACAGCTGTGGCTCTACAGGAACCCCGAAAGTTAAGTTATGCTGAAGTGTGCCAGAAG
CCCCCTAAAGAGCCATCTTCAGTTCTTGTGCAGCCACTACGGGAACTTCGCTCCAATGTGGTGTCTCCCACCAAAAATGAAGACAATGGA
GCTCCTGAGAACTCCGTTGAGAAACCACATGAGAAGCCAGAAGCAAGGGCTAGTAAGGATTATTCTGGCTTCCGAGGCAATATAATCCCC
AGGGGAGCAGCAGGAAAAATCAGGGAACAGAGACGCCAGTTTAGCCATAGGGCTATACCTCAGGGAGTGACTCGACGTAATGGCAAAGAG

>In-frame_LETMD1_ENST00000550929_chr12_51445990_+_LARP4_ENST00000429001_chr12_50847243_+_1593nt
ATGTCTTATGTGGTAACCAAGACAAAAGCGATTAATGGGAAATACCATCGTTTCTTGGGTCGTCATTTCCCCCGCTTCTATGTCCTGTAC
ACAATCTTCATGAAAGGATTGCAGATGTTATGGGCTGATGCCAAAAAGGCTAGAAGAATAAAGACAAATATGTGGAAGCACAATATAAAG
TTTCATCAACTTCCATACCGGGAGATGGAGCATTTGAGACAGGCAAGGATAAAAGCCATCAATACATTTTTTGCTAAGAATGGTTATCGA
TTAATGGATTCTAGTATCTATAGTCACCCCATTCAAACTCAAGCACAGTATGCCTCCCCAGTCTTTATGCAGCCTGTATATAATCCTCAC
CAACAGTACTCGGTCTATAGTATTGTGCCTCAGTCTTGGTCTCCAAATCCTACACCTTACTTTGAAACACCACTGGCTCCCTTTCCCAAT
GGTAGTTTTGTGAATGGCTTTAATTCGCCAGGATCTTATAAAACAAATGCTGCTGCTATGAATATGGGTCGACCATTCCAAAAAAATCGT
GTGAAGCCTCAGTTTAGGTCATCTGGTGGTTCAGAACACTCAACAGAGGGCTCTGTATCCTTGGGGGATGGACAGTTGAACAGATATAGT
TCAAGAAACTTTCCAGCTGAACGGCATAACCCCACAGTAACTGGGCATCAGGAGCAAACTTACCTTCAGAAGGAGACTTCCACTTTGCAG
GTGGAACAGAATGGGGACTATGGTAGGGGCAGGAGAACTCTCTTCAGAGGTCGAAGACGACGAGAAGATGACAGGATCTCAAGACCTCAT
CCTTCAACAGCTGAATCAAAGGCTCCAACACCAAAGTTTGACTTATTAGCCTCAAATTTTCCACCTTTACCTGGAAGTTCATCAAGAATG
CCAGGTGAACTCGTTTTGGAGAATAGGATGTCTGATGTTGTTAAAGGTGTCTACAAAGAAAAGGATAATGAAGAGTTGACAATTAGTTGC
CCAGTGCCTGCAGATGAGCAGACAGAATGCACTTCTGCCCAGCAACTCAATATGAGTACCAGTTCTCCATGTGCTGCTGAGCTTACTGCA
TTAAGCACAACTCAGCAAGAAAAGGATCTAATAGAAGATTCCTCTGTTCAGAAGGATGGTCTCAATCAGACAACTATACCAGTTTCTCCT
CCAAGTACTACAAAGCCATCGAGGGCAAGTACTGCTTCACCATGTAATAATAACATAAATGCAGCTACAGCTGTGGCTCTACAGGAACCC
CGAAAGTTAAGTTATGCTGAAGTGTGCCAGAAGCCCCCTAAAGAGCCATCTTCAGTTCTTGTGCAGCCACTACGGGAACTTCGCTCCAAT
GTGGTGTCTCCCACCAAAAATGAAGACAATGGAGCTCCTGAGAACTCCGTTGAGAAACCACATGAGAAGCCAGAAGCAAGGGCTAGTAAG
GATTATTCTGGCTTCCGAGGCAATATAATCCCCAGGGGAGCAGCAGGAAAAATCAGGGAACAGAGACGCCAGTTTAGCCATAGGGCTATA

>In-frame_LETMD1_ENST00000550929_chr12_51445990_+_LARP4_ENST00000398473_chr12_50847243_+_1593nt
ATGTCTTATGTGGTAACCAAGACAAAAGCGATTAATGGGAAATACCATCGTTTCTTGGGTCGTCATTTCCCCCGCTTCTATGTCCTGTAC
ACAATCTTCATGAAAGGATTGCAGATGTTATGGGCTGATGCCAAAAAGGCTAGAAGAATAAAGACAAATATGTGGAAGCACAATATAAAG
TTTCATCAACTTCCATACCGGGAGATGGAGCATTTGAGACAGGCAAGGATAAAAGCCATCAATACATTTTTTGCTAAGAATGGTTATCGA
TTAATGGATTCTAGTATCTATAGTCACCCCATTCAAACTCAAGCACAGTATGCCTCCCCAGTCTTTATGCAGCCTGTATATAATCCTCAC
CAACAGTACTCGGTCTATAGTATTGTGCCTCAGTCTTGGTCTCCAAATCCTACACCTTACTTTGAAACACCACTGGCTCCCTTTCCCAAT
GGTAGTTTTGTGAATGGCTTTAATTCGCCAGGATCTTATAAAACAAATGCTGCTGCTATGAATATGGGTCGACCATTCCAAAAAAATCGT
GTGAAGCCTCAGTTTAGGTCATCTGGTGGTTCAGAACACTCAACAGAGGGCTCTGTATCCTTGGGGGATGGACAGTTGAACAGATATAGT
TCAAGAAACTTTCCAGCTGAACGGCATAACCCCACAGTAACTGGGCATCAGGAGCAAACTTACCTTCAGAAGGAGACTTCCACTTTGCAG
GTGGAACAGAATGGGGACTATGGTAGGGGCAGGAGAACTCTCTTCAGAGGTCGAAGACGACGAGAAGATGACAGGATCTCAAGACCTCAT
CCTTCAACAGCTGAATCAAAGGCTCCAACACCAAAGTTTGACTTATTAGCCTCAAATTTTCCACCTTTACCTGGAAGTTCATCAAGAATG
CCAGGTGAACTCGTTTTGGAGAATAGGATGTCTGATGTTGTTAAAGGTGTCTACAAAGAAAAGGATAATGAAGAGTTGACAATTAGTTGC
CCAGTGCCTGCAGATGAGCAGACAGAATGCACTTCTGCCCAGCAACTCAATATGAGTACCAGTTCTCCATGTGCTGCTGAGCTTACTGCA
TTAAGCACAACTCAGCAAGAAAAGGATCTAATAGAAGATTCCTCTGTTCAGAAGGATGGTCTCAATCAGACAACTATACCAGTTTCTCCT
CCAAGTACTACAAAGCCATCGAGGGCAAGTACTGCTTCACCATGTAATAATAACATAAATGCAGCTACAGCTGTGGCTCTACAGGAACCC
CGAAAGTTAAGTTATGCTGAAGTGTGCCAGAAGCCCCCTAAAGAGCCATCTTCAGTTCTTGTGCAGCCACTACGGGAACTTCGCTCCAAT
GTGGTGTCTCCCACCAAAAATGAAGACAATGGAGCTCCTGAGAACTCCGTTGAGAAACCACATGAGAAGCCAGAAGCAAGGGCTAGTAAG
GATTATTCTGGCTTCCGAGGCAATATAATCCCCAGGGGAGCAGCAGGAAAAATCAGGGAACAGAGACGCCAGTTTAGCCATAGGGCTATA

>In-frame_LETMD1_ENST00000550929_chr12_51445990_+_LARP4_ENST00000518444_chr12_50847243_+_1593nt
ATGTCTTATGTGGTAACCAAGACAAAAGCGATTAATGGGAAATACCATCGTTTCTTGGGTCGTCATTTCCCCCGCTTCTATGTCCTGTAC
ACAATCTTCATGAAAGGATTGCAGATGTTATGGGCTGATGCCAAAAAGGCTAGAAGAATAAAGACAAATATGTGGAAGCACAATATAAAG
TTTCATCAACTTCCATACCGGGAGATGGAGCATTTGAGACAGGCAAGGATAAAAGCCATCAATACATTTTTTGCTAAGAATGGTTATCGA
TTAATGGATTCTAGTATCTATAGTCACCCCATTCAAACTCAAGCACAGTATGCCTCCCCAGTCTTTATGCAGCCTGTATATAATCCTCAC
CAACAGTACTCGGTCTATAGTATTGTGCCTCAGTCTTGGTCTCCAAATCCTACACCTTACTTTGAAACACCACTGGCTCCCTTTCCCAAT
GGTAGTTTTGTGAATGGCTTTAATTCGCCAGGATCTTATAAAACAAATGCTGCTGCTATGAATATGGGTCGACCATTCCAAAAAAATCGT
GTGAAGCCTCAGTTTAGGTCATCTGGTGGTTCAGAACACTCAACAGAGGGCTCTGTATCCTTGGGGGATGGACAGTTGAACAGATATAGT
TCAAGAAACTTTCCAGCTGAACGGCATAACCCCACAGTAACTGGGCATCAGGAGCAAACTTACCTTCAGAAGGAGACTTCCACTTTGCAG
GTGGAACAGAATGGGGACTATGGTAGGGGCAGGAGAACTCTCTTCAGAGGTCGAAGACGACGAGAAGATGACAGGATCTCAAGACCTCAT
CCTTCAACAGCTGAATCAAAGGCTCCAACACCAAAGTTTGACTTATTAGCCTCAAATTTTCCACCTTTACCTGGAAGTTCATCAAGAATG
CCAGGTGAACTCGTTTTGGAGAATAGGATGTCTGATGTTGTTAAAGGTGTCTACAAAGAAAAGGATAATGAAGAGTTGACAATTAGTTGC
CCAGTGCCTGCAGATGAGCAGACAGAATGCACTTCTGCCCAGCAACTCAATATGAGTACCAGTTCTCCATGTGCTGCTGAGCTTACTGCA
TTAAGCACAACTCAGCAAGAAAAGGATCTAATAGAAGATTCCTCTGTTCAGAAGGATGGTCTCAATCAGACAACTATACCAGTTTCTCCT
CCAAGTACTACAAAGCCATCGAGGGCAAGTACTGCTTCACCATGTAATAATAACATAAATGCAGCTACAGCTGTGGCTCTACAGGAACCC
CGAAAGTTAAGTTATGCTGAAGTGTGCCAGAAGCCCCCTAAAGAGCCATCTTCAGTTCTTGTGCAGCCACTACGGGAACTTCGCTCCAAT
GTGGTGTCTCCCACCAAAAATGAAGACAATGGAGCTCCTGAGAACTCCGTTGAGAAACCACATGAGAAGCCAGAAGCAAGGGCTAGTAAG
GATTATTCTGGCTTCCGAGGCAATATAATCCCCAGGGGAGCAGCAGGAAAAATCAGGGAACAGAGACGCCAGTTTAGCCATAGGGCTATA

>In-frame_LETMD1_ENST00000262055_chr12_51445990_+_LARP4_ENST00000293618_chr12_50847243_+_1548nt
ATGGCGCTCTCCAGGGTGTGCTGGGCTCGGTCGGCTGTGTGGGGCTCGGCAGTCACCCCTGGACATTTTGTCACCCGGAGGCTGCAACTT
GGTCGCTCTGGCCTGGCTTGGGGGGCCCCTCGGTCTTCAAAGCTTCACCTTTCTCCAAAGGCAGATGTGAAGAACTTGATGTCTTATGTG
GTAACCAAGACAAAAGCGATTAATGGGAAATACCATCGTTTCTTGGGTCGTCATTTCCCCCGCTTCTATGTCCTGTACACAATCTTCATG
AAAGGATTGCAGATGTTATGGGCTGATGCCAAAAAGGCTAGAAGAATAAAGACAAATATGTGGAAGCACAATATAAAGTTTCATCAACTT
CCATACCGGGAGATGGAGCATTTGAGACAGGCAAGGATAAAAGCCATCAATACATTTTTTGCTAAGAATGGTTATCGATTAATGGATTCT
AGTATCTATAGTCACCCCATTCAAACTCAAGCACAGTATGCCTCCCCAGTCTTTATGCAGCCTGTATATAATCCTCACCAACAGTACTCG
GTCTATAGTATTGTGCCTCAGTCTTGGTCTCCAAATCCTACACCTTACTTTGAAACACCACTGGCTCCCTTTCCCAATGGTAGTTTTGTG
AATGGCTTTAATTCGCCAGGATCTTATAAAACAAATGCTGCTGCTATGAATATGGGTCGACCATTCCAAAAAAATCGGAGAACTCTCTTC
AGAGGTCGAAGACGACGAGAAGATGACAGGATCTCAAGACCTCATCCTTCAACAGCTGAATCAAAGGCTCCAACACCAAAGTTTGACTTA
TTAGCCTCAAATTTTCCACCTTTACCTGGAAGTTCATCAAGAATGCCAGGTGAACTCGTTTTGGAGAATAGGATGTCTGATGTTGTTAAA
GGTGTCTACAAAGAAAAGGATAATGAAGAGTTGACAATTAGTTGCCCAGTGCCTGCAGATGAGCAGACAGAATGCACTTCTGCCCAGCAA
CTCAATATGAGTACCAGTTCTCCATGTGCTGCTGAGCTTACTGCATTAAGCACAACTCAGCAAGAAAAGGATCTAATAGAAGATTCCTCT
GTTCAGAAGGATGGTCTCAATCAGACAACTATACCAGTTTCTCCTCCAAGTACTACAAAGCCATCGAGGGCAAGTACTGCTTCACCATGT
AATAATAACATAAATGCAGCTACAGCTGTGGCTCTACAGGAACCCCGAAAGTTAAGTTATGCTGAAGTGTGCCAGAAGCCCCCTAAAGAG
CCATCTTCAGTTCTTGTGCAGCCACTACGGGAACTTCGCTCCAATGTGGTGTCTCCCACCAAAAATGAAGACAATGGAGCTCCTGAGAAC
TCCGTTGAGAAACCACATGAGAAGCCAGAAGCAAGGGCTAGTAAGGATTATTCTGGCTTCCGAGGCAATATAATCCCCAGGGGAGCAGCA
GGAAAAATCAGGGAACAGAGACGCCAGTTTAGCCATAGGGCTATACCTCAGGGAGTGACTCGACGTAATGGCAAAGAGCAATATGTGCCA

>In-frame_LETMD1_ENST00000262055_chr12_51445990_+_LARP4_ENST00000429001_chr12_50847243_+_1761nt
ATGGCGCTCTCCAGGGTGTGCTGGGCTCGGTCGGCTGTGTGGGGCTCGGCAGTCACCCCTGGACATTTTGTCACCCGGAGGCTGCAACTT
GGTCGCTCTGGCCTGGCTTGGGGGGCCCCTCGGTCTTCAAAGCTTCACCTTTCTCCAAAGGCAGATGTGAAGAACTTGATGTCTTATGTG
GTAACCAAGACAAAAGCGATTAATGGGAAATACCATCGTTTCTTGGGTCGTCATTTCCCCCGCTTCTATGTCCTGTACACAATCTTCATG
AAAGGATTGCAGATGTTATGGGCTGATGCCAAAAAGGCTAGAAGAATAAAGACAAATATGTGGAAGCACAATATAAAGTTTCATCAACTT
CCATACCGGGAGATGGAGCATTTGAGACAGGCAAGGATAAAAGCCATCAATACATTTTTTGCTAAGAATGGTTATCGATTAATGGATTCT
AGTATCTATAGTCACCCCATTCAAACTCAAGCACAGTATGCCTCCCCAGTCTTTATGCAGCCTGTATATAATCCTCACCAACAGTACTCG
GTCTATAGTATTGTGCCTCAGTCTTGGTCTCCAAATCCTACACCTTACTTTGAAACACCACTGGCTCCCTTTCCCAATGGTAGTTTTGTG
AATGGCTTTAATTCGCCAGGATCTTATAAAACAAATGCTGCTGCTATGAATATGGGTCGACCATTCCAAAAAAATCGTGTGAAGCCTCAG
TTTAGGTCATCTGGTGGTTCAGAACACTCAACAGAGGGCTCTGTATCCTTGGGGGATGGACAGTTGAACAGATATAGTTCAAGAAACTTT
CCAGCTGAACGGCATAACCCCACAGTAACTGGGCATCAGGAGCAAACTTACCTTCAGAAGGAGACTTCCACTTTGCAGGTGGAACAGAAT
GGGGACTATGGTAGGGGCAGGAGAACTCTCTTCAGAGGTCGAAGACGACGAGAAGATGACAGGATCTCAAGACCTCATCCTTCAACAGCT
GAATCAAAGGCTCCAACACCAAAGTTTGACTTATTAGCCTCAAATTTTCCACCTTTACCTGGAAGTTCATCAAGAATGCCAGGTGAACTC
GTTTTGGAGAATAGGATGTCTGATGTTGTTAAAGGTGTCTACAAAGAAAAGGATAATGAAGAGTTGACAATTAGTTGCCCAGTGCCTGCA
GATGAGCAGACAGAATGCACTTCTGCCCAGCAACTCAATATGAGTACCAGTTCTCCATGTGCTGCTGAGCTTACTGCATTAAGCACAACT
CAGCAAGAAAAGGATCTAATAGAAGATTCCTCTGTTCAGAAGGATGGTCTCAATCAGACAACTATACCAGTTTCTCCTCCAAGTACTACA
AAGCCATCGAGGGCAAGTACTGCTTCACCATGTAATAATAACATAAATGCAGCTACAGCTGTGGCTCTACAGGAACCCCGAAAGTTAAGT
TATGCTGAAGTGTGCCAGAAGCCCCCTAAAGAGCCATCTTCAGTTCTTGTGCAGCCACTACGGGAACTTCGCTCCAATGTGGTGTCTCCC
ACCAAAAATGAAGACAATGGAGCTCCTGAGAACTCCGTTGAGAAACCACATGAGAAGCCAGAAGCAAGGGCTAGTAAGGATTATTCTGGC
TTCCGAGGCAATATAATCCCCAGGGGAGCAGCAGGAAAAATCAGGGAACAGAGACGCCAGTTTAGCCATAGGGCTATACCTCAGGGAGTG

>In-frame_LETMD1_ENST00000262055_chr12_51445990_+_LARP4_ENST00000398473_chr12_50847243_+_1761nt
ATGGCGCTCTCCAGGGTGTGCTGGGCTCGGTCGGCTGTGTGGGGCTCGGCAGTCACCCCTGGACATTTTGTCACCCGGAGGCTGCAACTT
GGTCGCTCTGGCCTGGCTTGGGGGGCCCCTCGGTCTTCAAAGCTTCACCTTTCTCCAAAGGCAGATGTGAAGAACTTGATGTCTTATGTG
GTAACCAAGACAAAAGCGATTAATGGGAAATACCATCGTTTCTTGGGTCGTCATTTCCCCCGCTTCTATGTCCTGTACACAATCTTCATG
AAAGGATTGCAGATGTTATGGGCTGATGCCAAAAAGGCTAGAAGAATAAAGACAAATATGTGGAAGCACAATATAAAGTTTCATCAACTT
CCATACCGGGAGATGGAGCATTTGAGACAGGCAAGGATAAAAGCCATCAATACATTTTTTGCTAAGAATGGTTATCGATTAATGGATTCT
AGTATCTATAGTCACCCCATTCAAACTCAAGCACAGTATGCCTCCCCAGTCTTTATGCAGCCTGTATATAATCCTCACCAACAGTACTCG
GTCTATAGTATTGTGCCTCAGTCTTGGTCTCCAAATCCTACACCTTACTTTGAAACACCACTGGCTCCCTTTCCCAATGGTAGTTTTGTG
AATGGCTTTAATTCGCCAGGATCTTATAAAACAAATGCTGCTGCTATGAATATGGGTCGACCATTCCAAAAAAATCGTGTGAAGCCTCAG
TTTAGGTCATCTGGTGGTTCAGAACACTCAACAGAGGGCTCTGTATCCTTGGGGGATGGACAGTTGAACAGATATAGTTCAAGAAACTTT
CCAGCTGAACGGCATAACCCCACAGTAACTGGGCATCAGGAGCAAACTTACCTTCAGAAGGAGACTTCCACTTTGCAGGTGGAACAGAAT
GGGGACTATGGTAGGGGCAGGAGAACTCTCTTCAGAGGTCGAAGACGACGAGAAGATGACAGGATCTCAAGACCTCATCCTTCAACAGCT
GAATCAAAGGCTCCAACACCAAAGTTTGACTTATTAGCCTCAAATTTTCCACCTTTACCTGGAAGTTCATCAAGAATGCCAGGTGAACTC
GTTTTGGAGAATAGGATGTCTGATGTTGTTAAAGGTGTCTACAAAGAAAAGGATAATGAAGAGTTGACAATTAGTTGCCCAGTGCCTGCA
GATGAGCAGACAGAATGCACTTCTGCCCAGCAACTCAATATGAGTACCAGTTCTCCATGTGCTGCTGAGCTTACTGCATTAAGCACAACT
CAGCAAGAAAAGGATCTAATAGAAGATTCCTCTGTTCAGAAGGATGGTCTCAATCAGACAACTATACCAGTTTCTCCTCCAAGTACTACA
AAGCCATCGAGGGCAAGTACTGCTTCACCATGTAATAATAACATAAATGCAGCTACAGCTGTGGCTCTACAGGAACCCCGAAAGTTAAGT
TATGCTGAAGTGTGCCAGAAGCCCCCTAAAGAGCCATCTTCAGTTCTTGTGCAGCCACTACGGGAACTTCGCTCCAATGTGGTGTCTCCC
ACCAAAAATGAAGACAATGGAGCTCCTGAGAACTCCGTTGAGAAACCACATGAGAAGCCAGAAGCAAGGGCTAGTAAGGATTATTCTGGC
TTCCGAGGCAATATAATCCCCAGGGGAGCAGCAGGAAAAATCAGGGAACAGAGACGCCAGTTTAGCCATAGGGCTATACCTCAGGGAGTG

>In-frame_LETMD1_ENST00000262055_chr12_51445990_+_LARP4_ENST00000518444_chr12_50847243_+_1761nt
ATGGCGCTCTCCAGGGTGTGCTGGGCTCGGTCGGCTGTGTGGGGCTCGGCAGTCACCCCTGGACATTTTGTCACCCGGAGGCTGCAACTT
GGTCGCTCTGGCCTGGCTTGGGGGGCCCCTCGGTCTTCAAAGCTTCACCTTTCTCCAAAGGCAGATGTGAAGAACTTGATGTCTTATGTG
GTAACCAAGACAAAAGCGATTAATGGGAAATACCATCGTTTCTTGGGTCGTCATTTCCCCCGCTTCTATGTCCTGTACACAATCTTCATG
AAAGGATTGCAGATGTTATGGGCTGATGCCAAAAAGGCTAGAAGAATAAAGACAAATATGTGGAAGCACAATATAAAGTTTCATCAACTT
CCATACCGGGAGATGGAGCATTTGAGACAGGCAAGGATAAAAGCCATCAATACATTTTTTGCTAAGAATGGTTATCGATTAATGGATTCT
AGTATCTATAGTCACCCCATTCAAACTCAAGCACAGTATGCCTCCCCAGTCTTTATGCAGCCTGTATATAATCCTCACCAACAGTACTCG
GTCTATAGTATTGTGCCTCAGTCTTGGTCTCCAAATCCTACACCTTACTTTGAAACACCACTGGCTCCCTTTCCCAATGGTAGTTTTGTG
AATGGCTTTAATTCGCCAGGATCTTATAAAACAAATGCTGCTGCTATGAATATGGGTCGACCATTCCAAAAAAATCGTGTGAAGCCTCAG
TTTAGGTCATCTGGTGGTTCAGAACACTCAACAGAGGGCTCTGTATCCTTGGGGGATGGACAGTTGAACAGATATAGTTCAAGAAACTTT
CCAGCTGAACGGCATAACCCCACAGTAACTGGGCATCAGGAGCAAACTTACCTTCAGAAGGAGACTTCCACTTTGCAGGTGGAACAGAAT
GGGGACTATGGTAGGGGCAGGAGAACTCTCTTCAGAGGTCGAAGACGACGAGAAGATGACAGGATCTCAAGACCTCATCCTTCAACAGCT
GAATCAAAGGCTCCAACACCAAAGTTTGACTTATTAGCCTCAAATTTTCCACCTTTACCTGGAAGTTCATCAAGAATGCCAGGTGAACTC
GTTTTGGAGAATAGGATGTCTGATGTTGTTAAAGGTGTCTACAAAGAAAAGGATAATGAAGAGTTGACAATTAGTTGCCCAGTGCCTGCA
GATGAGCAGACAGAATGCACTTCTGCCCAGCAACTCAATATGAGTACCAGTTCTCCATGTGCTGCTGAGCTTACTGCATTAAGCACAACT
CAGCAAGAAAAGGATCTAATAGAAGATTCCTCTGTTCAGAAGGATGGTCTCAATCAGACAACTATACCAGTTTCTCCTCCAAGTACTACA
AAGCCATCGAGGGCAAGTACTGCTTCACCATGTAATAATAACATAAATGCAGCTACAGCTGTGGCTCTACAGGAACCCCGAAAGTTAAGT
TATGCTGAAGTGTGCCAGAAGCCCCCTAAAGAGCCATCTTCAGTTCTTGTGCAGCCACTACGGGAACTTCGCTCCAATGTGGTGTCTCCC
ACCAAAAATGAAGACAATGGAGCTCCTGAGAACTCCGTTGAGAAACCACATGAGAAGCCAGAAGCAAGGGCTAGTAAGGATTATTCTGGC
TTCCGAGGCAATATAATCCCCAGGGGAGCAGCAGGAAAAATCAGGGAACAGAGACGCCAGTTTAGCCATAGGGCTATACCTCAGGGAGTG

>In-frame_LETMD1_ENST00000418425_chr12_51445990_+_LARP4_ENST00000293618_chr12_50847243_+_1587nt
ATGGCGCTCTCCAGGGTGTGCTGGGCTCGGTCGGCTGTGTGGGGCTCGGCAGTCACCCCTGGACATTTTGTCACCCGGAGGCTGCAACTT
GGTCGCTCTGGCCTGGCTTGGGGGGCCCCTCGGTCTTCAAAGCTTCACCTTTCTCCAAAGGCAGATGTGAAGAACTTGATGTCTTATGTG
GTAACCAAGACAAAAGCGATTAATGGGAAATACCATCGTTTCTTGGGTCGTCATTTCCCCCGCTTCTATGTCCTGTACACAATCTTCATG
AAAGGATTGCAGATGTTATGGGCTGATGCCAAAAAGGCTAGAAGAATAAAGACAAATATGTGGAAGCACAATATAAAGTTTCATCAACTT
CCATACCGGGAGATGGAGCATTTGAGACAGGTATGGGCCAGGGGCAGATATCCAGAAGTTCATGGTGAGGCAAGGATAAAAGCCATCAAT
ACATTTTTTGCTAAGAATGGTTATCGATTAATGGATTCTAGTATCTATAGTCACCCCATTCAAACTCAAGCACAGTATGCCTCCCCAGTC
TTTATGCAGCCTGTATATAATCCTCACCAACAGTACTCGGTCTATAGTATTGTGCCTCAGTCTTGGTCTCCAAATCCTACACCTTACTTT
GAAACACCACTGGCTCCCTTTCCCAATGGTAGTTTTGTGAATGGCTTTAATTCGCCAGGATCTTATAAAACAAATGCTGCTGCTATGAAT
ATGGGTCGACCATTCCAAAAAAATCGGAGAACTCTCTTCAGAGGTCGAAGACGACGAGAAGATGACAGGATCTCAAGACCTCATCCTTCA
ACAGCTGAATCAAAGGCTCCAACACCAAAGTTTGACTTATTAGCCTCAAATTTTCCACCTTTACCTGGAAGTTCATCAAGAATGCCAGGT
GAACTCGTTTTGGAGAATAGGATGTCTGATGTTGTTAAAGGTGTCTACAAAGAAAAGGATAATGAAGAGTTGACAATTAGTTGCCCAGTG
CCTGCAGATGAGCAGACAGAATGCACTTCTGCCCAGCAACTCAATATGAGTACCAGTTCTCCATGTGCTGCTGAGCTTACTGCATTAAGC
ACAACTCAGCAAGAAAAGGATCTAATAGAAGATTCCTCTGTTCAGAAGGATGGTCTCAATCAGACAACTATACCAGTTTCTCCTCCAAGT
ACTACAAAGCCATCGAGGGCAAGTACTGCTTCACCATGTAATAATAACATAAATGCAGCTACAGCTGTGGCTCTACAGGAACCCCGAAAG
TTAAGTTATGCTGAAGTGTGCCAGAAGCCCCCTAAAGAGCCATCTTCAGTTCTTGTGCAGCCACTACGGGAACTTCGCTCCAATGTGGTG
TCTCCCACCAAAAATGAAGACAATGGAGCTCCTGAGAACTCCGTTGAGAAACCACATGAGAAGCCAGAAGCAAGGGCTAGTAAGGATTAT
TCTGGCTTCCGAGGCAATATAATCCCCAGGGGAGCAGCAGGAAAAATCAGGGAACAGAGACGCCAGTTTAGCCATAGGGCTATACCTCAG

>In-frame_LETMD1_ENST00000418425_chr12_51445990_+_LARP4_ENST00000429001_chr12_50847243_+_1800nt
ATGGCGCTCTCCAGGGTGTGCTGGGCTCGGTCGGCTGTGTGGGGCTCGGCAGTCACCCCTGGACATTTTGTCACCCGGAGGCTGCAACTT
GGTCGCTCTGGCCTGGCTTGGGGGGCCCCTCGGTCTTCAAAGCTTCACCTTTCTCCAAAGGCAGATGTGAAGAACTTGATGTCTTATGTG
GTAACCAAGACAAAAGCGATTAATGGGAAATACCATCGTTTCTTGGGTCGTCATTTCCCCCGCTTCTATGTCCTGTACACAATCTTCATG
AAAGGATTGCAGATGTTATGGGCTGATGCCAAAAAGGCTAGAAGAATAAAGACAAATATGTGGAAGCACAATATAAAGTTTCATCAACTT
CCATACCGGGAGATGGAGCATTTGAGACAGGTATGGGCCAGGGGCAGATATCCAGAAGTTCATGGTGAGGCAAGGATAAAAGCCATCAAT
ACATTTTTTGCTAAGAATGGTTATCGATTAATGGATTCTAGTATCTATAGTCACCCCATTCAAACTCAAGCACAGTATGCCTCCCCAGTC
TTTATGCAGCCTGTATATAATCCTCACCAACAGTACTCGGTCTATAGTATTGTGCCTCAGTCTTGGTCTCCAAATCCTACACCTTACTTT
GAAACACCACTGGCTCCCTTTCCCAATGGTAGTTTTGTGAATGGCTTTAATTCGCCAGGATCTTATAAAACAAATGCTGCTGCTATGAAT
ATGGGTCGACCATTCCAAAAAAATCGTGTGAAGCCTCAGTTTAGGTCATCTGGTGGTTCAGAACACTCAACAGAGGGCTCTGTATCCTTG
GGGGATGGACAGTTGAACAGATATAGTTCAAGAAACTTTCCAGCTGAACGGCATAACCCCACAGTAACTGGGCATCAGGAGCAAACTTAC
CTTCAGAAGGAGACTTCCACTTTGCAGGTGGAACAGAATGGGGACTATGGTAGGGGCAGGAGAACTCTCTTCAGAGGTCGAAGACGACGA
GAAGATGACAGGATCTCAAGACCTCATCCTTCAACAGCTGAATCAAAGGCTCCAACACCAAAGTTTGACTTATTAGCCTCAAATTTTCCA
CCTTTACCTGGAAGTTCATCAAGAATGCCAGGTGAACTCGTTTTGGAGAATAGGATGTCTGATGTTGTTAAAGGTGTCTACAAAGAAAAG
GATAATGAAGAGTTGACAATTAGTTGCCCAGTGCCTGCAGATGAGCAGACAGAATGCACTTCTGCCCAGCAACTCAATATGAGTACCAGT
TCTCCATGTGCTGCTGAGCTTACTGCATTAAGCACAACTCAGCAAGAAAAGGATCTAATAGAAGATTCCTCTGTTCAGAAGGATGGTCTC
AATCAGACAACTATACCAGTTTCTCCTCCAAGTACTACAAAGCCATCGAGGGCAAGTACTGCTTCACCATGTAATAATAACATAAATGCA
GCTACAGCTGTGGCTCTACAGGAACCCCGAAAGTTAAGTTATGCTGAAGTGTGCCAGAAGCCCCCTAAAGAGCCATCTTCAGTTCTTGTG
CAGCCACTACGGGAACTTCGCTCCAATGTGGTGTCTCCCACCAAAAATGAAGACAATGGAGCTCCTGAGAACTCCGTTGAGAAACCACAT
GAGAAGCCAGAAGCAAGGGCTAGTAAGGATTATTCTGGCTTCCGAGGCAATATAATCCCCAGGGGAGCAGCAGGAAAAATCAGGGAACAG
AGACGCCAGTTTAGCCATAGGGCTATACCTCAGGGAGTGACTCGACGTAATGGCAAAGAGCAATATGTGCCACCCAGATCACCAAAGTAA

>In-frame_LETMD1_ENST00000418425_chr12_51445990_+_LARP4_ENST00000398473_chr12_50847243_+_1800nt
ATGGCGCTCTCCAGGGTGTGCTGGGCTCGGTCGGCTGTGTGGGGCTCGGCAGTCACCCCTGGACATTTTGTCACCCGGAGGCTGCAACTT
GGTCGCTCTGGCCTGGCTTGGGGGGCCCCTCGGTCTTCAAAGCTTCACCTTTCTCCAAAGGCAGATGTGAAGAACTTGATGTCTTATGTG
GTAACCAAGACAAAAGCGATTAATGGGAAATACCATCGTTTCTTGGGTCGTCATTTCCCCCGCTTCTATGTCCTGTACACAATCTTCATG
AAAGGATTGCAGATGTTATGGGCTGATGCCAAAAAGGCTAGAAGAATAAAGACAAATATGTGGAAGCACAATATAAAGTTTCATCAACTT
CCATACCGGGAGATGGAGCATTTGAGACAGGTATGGGCCAGGGGCAGATATCCAGAAGTTCATGGTGAGGCAAGGATAAAAGCCATCAAT
ACATTTTTTGCTAAGAATGGTTATCGATTAATGGATTCTAGTATCTATAGTCACCCCATTCAAACTCAAGCACAGTATGCCTCCCCAGTC
TTTATGCAGCCTGTATATAATCCTCACCAACAGTACTCGGTCTATAGTATTGTGCCTCAGTCTTGGTCTCCAAATCCTACACCTTACTTT
GAAACACCACTGGCTCCCTTTCCCAATGGTAGTTTTGTGAATGGCTTTAATTCGCCAGGATCTTATAAAACAAATGCTGCTGCTATGAAT
ATGGGTCGACCATTCCAAAAAAATCGTGTGAAGCCTCAGTTTAGGTCATCTGGTGGTTCAGAACACTCAACAGAGGGCTCTGTATCCTTG
GGGGATGGACAGTTGAACAGATATAGTTCAAGAAACTTTCCAGCTGAACGGCATAACCCCACAGTAACTGGGCATCAGGAGCAAACTTAC
CTTCAGAAGGAGACTTCCACTTTGCAGGTGGAACAGAATGGGGACTATGGTAGGGGCAGGAGAACTCTCTTCAGAGGTCGAAGACGACGA
GAAGATGACAGGATCTCAAGACCTCATCCTTCAACAGCTGAATCAAAGGCTCCAACACCAAAGTTTGACTTATTAGCCTCAAATTTTCCA
CCTTTACCTGGAAGTTCATCAAGAATGCCAGGTGAACTCGTTTTGGAGAATAGGATGTCTGATGTTGTTAAAGGTGTCTACAAAGAAAAG
GATAATGAAGAGTTGACAATTAGTTGCCCAGTGCCTGCAGATGAGCAGACAGAATGCACTTCTGCCCAGCAACTCAATATGAGTACCAGT
TCTCCATGTGCTGCTGAGCTTACTGCATTAAGCACAACTCAGCAAGAAAAGGATCTAATAGAAGATTCCTCTGTTCAGAAGGATGGTCTC
AATCAGACAACTATACCAGTTTCTCCTCCAAGTACTACAAAGCCATCGAGGGCAAGTACTGCTTCACCATGTAATAATAACATAAATGCA
GCTACAGCTGTGGCTCTACAGGAACCCCGAAAGTTAAGTTATGCTGAAGTGTGCCAGAAGCCCCCTAAAGAGCCATCTTCAGTTCTTGTG
CAGCCACTACGGGAACTTCGCTCCAATGTGGTGTCTCCCACCAAAAATGAAGACAATGGAGCTCCTGAGAACTCCGTTGAGAAACCACAT
GAGAAGCCAGAAGCAAGGGCTAGTAAGGATTATTCTGGCTTCCGAGGCAATATAATCCCCAGGGGAGCAGCAGGAAAAATCAGGGAACAG
AGACGCCAGTTTAGCCATAGGGCTATACCTCAGGGAGTGACTCGACGTAATGGCAAAGAGCAATATGTGCCACCCAGATCACCAAAGTAA

>In-frame_LETMD1_ENST00000418425_chr12_51445990_+_LARP4_ENST00000518444_chr12_50847243_+_1800nt
ATGGCGCTCTCCAGGGTGTGCTGGGCTCGGTCGGCTGTGTGGGGCTCGGCAGTCACCCCTGGACATTTTGTCACCCGGAGGCTGCAACTT
GGTCGCTCTGGCCTGGCTTGGGGGGCCCCTCGGTCTTCAAAGCTTCACCTTTCTCCAAAGGCAGATGTGAAGAACTTGATGTCTTATGTG
GTAACCAAGACAAAAGCGATTAATGGGAAATACCATCGTTTCTTGGGTCGTCATTTCCCCCGCTTCTATGTCCTGTACACAATCTTCATG
AAAGGATTGCAGATGTTATGGGCTGATGCCAAAAAGGCTAGAAGAATAAAGACAAATATGTGGAAGCACAATATAAAGTTTCATCAACTT
CCATACCGGGAGATGGAGCATTTGAGACAGGTATGGGCCAGGGGCAGATATCCAGAAGTTCATGGTGAGGCAAGGATAAAAGCCATCAAT
ACATTTTTTGCTAAGAATGGTTATCGATTAATGGATTCTAGTATCTATAGTCACCCCATTCAAACTCAAGCACAGTATGCCTCCCCAGTC
TTTATGCAGCCTGTATATAATCCTCACCAACAGTACTCGGTCTATAGTATTGTGCCTCAGTCTTGGTCTCCAAATCCTACACCTTACTTT
GAAACACCACTGGCTCCCTTTCCCAATGGTAGTTTTGTGAATGGCTTTAATTCGCCAGGATCTTATAAAACAAATGCTGCTGCTATGAAT
ATGGGTCGACCATTCCAAAAAAATCGTGTGAAGCCTCAGTTTAGGTCATCTGGTGGTTCAGAACACTCAACAGAGGGCTCTGTATCCTTG
GGGGATGGACAGTTGAACAGATATAGTTCAAGAAACTTTCCAGCTGAACGGCATAACCCCACAGTAACTGGGCATCAGGAGCAAACTTAC
CTTCAGAAGGAGACTTCCACTTTGCAGGTGGAACAGAATGGGGACTATGGTAGGGGCAGGAGAACTCTCTTCAGAGGTCGAAGACGACGA
GAAGATGACAGGATCTCAAGACCTCATCCTTCAACAGCTGAATCAAAGGCTCCAACACCAAAGTTTGACTTATTAGCCTCAAATTTTCCA
CCTTTACCTGGAAGTTCATCAAGAATGCCAGGTGAACTCGTTTTGGAGAATAGGATGTCTGATGTTGTTAAAGGTGTCTACAAAGAAAAG
GATAATGAAGAGTTGACAATTAGTTGCCCAGTGCCTGCAGATGAGCAGACAGAATGCACTTCTGCCCAGCAACTCAATATGAGTACCAGT
TCTCCATGTGCTGCTGAGCTTACTGCATTAAGCACAACTCAGCAAGAAAAGGATCTAATAGAAGATTCCTCTGTTCAGAAGGATGGTCTC
AATCAGACAACTATACCAGTTTCTCCTCCAAGTACTACAAAGCCATCGAGGGCAAGTACTGCTTCACCATGTAATAATAACATAAATGCA
GCTACAGCTGTGGCTCTACAGGAACCCCGAAAGTTAAGTTATGCTGAAGTGTGCCAGAAGCCCCCTAAAGAGCCATCTTCAGTTCTTGTG
CAGCCACTACGGGAACTTCGCTCCAATGTGGTGTCTCCCACCAAAAATGAAGACAATGGAGCTCCTGAGAACTCCGTTGAGAAACCACAT
GAGAAGCCAGAAGCAAGGGCTAGTAAGGATTATTCTGGCTTCCGAGGCAATATAATCCCCAGGGGAGCAGCAGGAAAAATCAGGGAACAG
AGACGCCAGTTTAGCCATAGGGCTATACCTCAGGGAGTGACTCGACGTAATGGCAAAGAGCAATATGTGCCACCCAGATCACCAAAGTAA

>In-frame_LETMD1_ENST00000547008_chr12_51445990_+_LARP4_ENST00000293618_chr12_50847243_+_1548nt
ATGGCGCTCTCCAGGGTGTGCTGGGCTCGGTCGGCTGTGTGGGGCTCGGCAGTCACCCCTGGACATTTTGTCACCCGGAGGCTGCAACTT
GGTCGCTCTGGCCTGGCTTGGGGGGCCCCTCGGTCTTCAAAGCTTCACCTTTCTCCAAAGGCAGATGTGAAGAACTTGATGTCTTATGTG
GTAACCAAGACAAAAGCGATTAATGGGAAATACCATCGTTTCTTGGGTCGTCATTTCCCCCGCTTCTATGTCCTGTACACAATCTTCATG
AAAGGATTGCAGATGTTATGGGCTGATGCCAAAAAGGCTAGAAGAATAAAGACAAATATGTGGAAGCACAATATAAAGTTTCATCAACTT
CCATACCGGGAGATGGAGCATTTGAGACAGGCAAGGATAAAAGCCATCAATACATTTTTTGCTAAGAATGGTTATCGATTAATGGATTCT
AGTATCTATAGTCACCCCATTCAAACTCAAGCACAGTATGCCTCCCCAGTCTTTATGCAGCCTGTATATAATCCTCACCAACAGTACTCG
GTCTATAGTATTGTGCCTCAGTCTTGGTCTCCAAATCCTACACCTTACTTTGAAACACCACTGGCTCCCTTTCCCAATGGTAGTTTTGTG
AATGGCTTTAATTCGCCAGGATCTTATAAAACAAATGCTGCTGCTATGAATATGGGTCGACCATTCCAAAAAAATCGGAGAACTCTCTTC
AGAGGTCGAAGACGACGAGAAGATGACAGGATCTCAAGACCTCATCCTTCAACAGCTGAATCAAAGGCTCCAACACCAAAGTTTGACTTA
TTAGCCTCAAATTTTCCACCTTTACCTGGAAGTTCATCAAGAATGCCAGGTGAACTCGTTTTGGAGAATAGGATGTCTGATGTTGTTAAA
GGTGTCTACAAAGAAAAGGATAATGAAGAGTTGACAATTAGTTGCCCAGTGCCTGCAGATGAGCAGACAGAATGCACTTCTGCCCAGCAA
CTCAATATGAGTACCAGTTCTCCATGTGCTGCTGAGCTTACTGCATTAAGCACAACTCAGCAAGAAAAGGATCTAATAGAAGATTCCTCT
GTTCAGAAGGATGGTCTCAATCAGACAACTATACCAGTTTCTCCTCCAAGTACTACAAAGCCATCGAGGGCAAGTACTGCTTCACCATGT
AATAATAACATAAATGCAGCTACAGCTGTGGCTCTACAGGAACCCCGAAAGTTAAGTTATGCTGAAGTGTGCCAGAAGCCCCCTAAAGAG
CCATCTTCAGTTCTTGTGCAGCCACTACGGGAACTTCGCTCCAATGTGGTGTCTCCCACCAAAAATGAAGACAATGGAGCTCCTGAGAAC
TCCGTTGAGAAACCACATGAGAAGCCAGAAGCAAGGGCTAGTAAGGATTATTCTGGCTTCCGAGGCAATATAATCCCCAGGGGAGCAGCA
GGAAAAATCAGGGAACAGAGACGCCAGTTTAGCCATAGGGCTATACCTCAGGGAGTGACTCGACGTAATGGCAAAGAGCAATATGTGCCA

>In-frame_LETMD1_ENST00000547008_chr12_51445990_+_LARP4_ENST00000429001_chr12_50847243_+_1761nt
ATGGCGCTCTCCAGGGTGTGCTGGGCTCGGTCGGCTGTGTGGGGCTCGGCAGTCACCCCTGGACATTTTGTCACCCGGAGGCTGCAACTT
GGTCGCTCTGGCCTGGCTTGGGGGGCCCCTCGGTCTTCAAAGCTTCACCTTTCTCCAAAGGCAGATGTGAAGAACTTGATGTCTTATGTG
GTAACCAAGACAAAAGCGATTAATGGGAAATACCATCGTTTCTTGGGTCGTCATTTCCCCCGCTTCTATGTCCTGTACACAATCTTCATG
AAAGGATTGCAGATGTTATGGGCTGATGCCAAAAAGGCTAGAAGAATAAAGACAAATATGTGGAAGCACAATATAAAGTTTCATCAACTT
CCATACCGGGAGATGGAGCATTTGAGACAGGCAAGGATAAAAGCCATCAATACATTTTTTGCTAAGAATGGTTATCGATTAATGGATTCT
AGTATCTATAGTCACCCCATTCAAACTCAAGCACAGTATGCCTCCCCAGTCTTTATGCAGCCTGTATATAATCCTCACCAACAGTACTCG
GTCTATAGTATTGTGCCTCAGTCTTGGTCTCCAAATCCTACACCTTACTTTGAAACACCACTGGCTCCCTTTCCCAATGGTAGTTTTGTG
AATGGCTTTAATTCGCCAGGATCTTATAAAACAAATGCTGCTGCTATGAATATGGGTCGACCATTCCAAAAAAATCGTGTGAAGCCTCAG
TTTAGGTCATCTGGTGGTTCAGAACACTCAACAGAGGGCTCTGTATCCTTGGGGGATGGACAGTTGAACAGATATAGTTCAAGAAACTTT
CCAGCTGAACGGCATAACCCCACAGTAACTGGGCATCAGGAGCAAACTTACCTTCAGAAGGAGACTTCCACTTTGCAGGTGGAACAGAAT
GGGGACTATGGTAGGGGCAGGAGAACTCTCTTCAGAGGTCGAAGACGACGAGAAGATGACAGGATCTCAAGACCTCATCCTTCAACAGCT
GAATCAAAGGCTCCAACACCAAAGTTTGACTTATTAGCCTCAAATTTTCCACCTTTACCTGGAAGTTCATCAAGAATGCCAGGTGAACTC
GTTTTGGAGAATAGGATGTCTGATGTTGTTAAAGGTGTCTACAAAGAAAAGGATAATGAAGAGTTGACAATTAGTTGCCCAGTGCCTGCA
GATGAGCAGACAGAATGCACTTCTGCCCAGCAACTCAATATGAGTACCAGTTCTCCATGTGCTGCTGAGCTTACTGCATTAAGCACAACT
CAGCAAGAAAAGGATCTAATAGAAGATTCCTCTGTTCAGAAGGATGGTCTCAATCAGACAACTATACCAGTTTCTCCTCCAAGTACTACA
AAGCCATCGAGGGCAAGTACTGCTTCACCATGTAATAATAACATAAATGCAGCTACAGCTGTGGCTCTACAGGAACCCCGAAAGTTAAGT
TATGCTGAAGTGTGCCAGAAGCCCCCTAAAGAGCCATCTTCAGTTCTTGTGCAGCCACTACGGGAACTTCGCTCCAATGTGGTGTCTCCC
ACCAAAAATGAAGACAATGGAGCTCCTGAGAACTCCGTTGAGAAACCACATGAGAAGCCAGAAGCAAGGGCTAGTAAGGATTATTCTGGC
TTCCGAGGCAATATAATCCCCAGGGGAGCAGCAGGAAAAATCAGGGAACAGAGACGCCAGTTTAGCCATAGGGCTATACCTCAGGGAGTG

>In-frame_LETMD1_ENST00000547008_chr12_51445990_+_LARP4_ENST00000398473_chr12_50847243_+_1761nt
ATGGCGCTCTCCAGGGTGTGCTGGGCTCGGTCGGCTGTGTGGGGCTCGGCAGTCACCCCTGGACATTTTGTCACCCGGAGGCTGCAACTT
GGTCGCTCTGGCCTGGCTTGGGGGGCCCCTCGGTCTTCAAAGCTTCACCTTTCTCCAAAGGCAGATGTGAAGAACTTGATGTCTTATGTG
GTAACCAAGACAAAAGCGATTAATGGGAAATACCATCGTTTCTTGGGTCGTCATTTCCCCCGCTTCTATGTCCTGTACACAATCTTCATG
AAAGGATTGCAGATGTTATGGGCTGATGCCAAAAAGGCTAGAAGAATAAAGACAAATATGTGGAAGCACAATATAAAGTTTCATCAACTT
CCATACCGGGAGATGGAGCATTTGAGACAGGCAAGGATAAAAGCCATCAATACATTTTTTGCTAAGAATGGTTATCGATTAATGGATTCT
AGTATCTATAGTCACCCCATTCAAACTCAAGCACAGTATGCCTCCCCAGTCTTTATGCAGCCTGTATATAATCCTCACCAACAGTACTCG
GTCTATAGTATTGTGCCTCAGTCTTGGTCTCCAAATCCTACACCTTACTTTGAAACACCACTGGCTCCCTTTCCCAATGGTAGTTTTGTG
AATGGCTTTAATTCGCCAGGATCTTATAAAACAAATGCTGCTGCTATGAATATGGGTCGACCATTCCAAAAAAATCGTGTGAAGCCTCAG
TTTAGGTCATCTGGTGGTTCAGAACACTCAACAGAGGGCTCTGTATCCTTGGGGGATGGACAGTTGAACAGATATAGTTCAAGAAACTTT
CCAGCTGAACGGCATAACCCCACAGTAACTGGGCATCAGGAGCAAACTTACCTTCAGAAGGAGACTTCCACTTTGCAGGTGGAACAGAAT
GGGGACTATGGTAGGGGCAGGAGAACTCTCTTCAGAGGTCGAAGACGACGAGAAGATGACAGGATCTCAAGACCTCATCCTTCAACAGCT
GAATCAAAGGCTCCAACACCAAAGTTTGACTTATTAGCCTCAAATTTTCCACCTTTACCTGGAAGTTCATCAAGAATGCCAGGTGAACTC
GTTTTGGAGAATAGGATGTCTGATGTTGTTAAAGGTGTCTACAAAGAAAAGGATAATGAAGAGTTGACAATTAGTTGCCCAGTGCCTGCA
GATGAGCAGACAGAATGCACTTCTGCCCAGCAACTCAATATGAGTACCAGTTCTCCATGTGCTGCTGAGCTTACTGCATTAAGCACAACT
CAGCAAGAAAAGGATCTAATAGAAGATTCCTCTGTTCAGAAGGATGGTCTCAATCAGACAACTATACCAGTTTCTCCTCCAAGTACTACA
AAGCCATCGAGGGCAAGTACTGCTTCACCATGTAATAATAACATAAATGCAGCTACAGCTGTGGCTCTACAGGAACCCCGAAAGTTAAGT
TATGCTGAAGTGTGCCAGAAGCCCCCTAAAGAGCCATCTTCAGTTCTTGTGCAGCCACTACGGGAACTTCGCTCCAATGTGGTGTCTCCC
ACCAAAAATGAAGACAATGGAGCTCCTGAGAACTCCGTTGAGAAACCACATGAGAAGCCAGAAGCAAGGGCTAGTAAGGATTATTCTGGC
TTCCGAGGCAATATAATCCCCAGGGGAGCAGCAGGAAAAATCAGGGAACAGAGACGCCAGTTTAGCCATAGGGCTATACCTCAGGGAGTG

>In-frame_LETMD1_ENST00000547008_chr12_51445990_+_LARP4_ENST00000518444_chr12_50847243_+_1761nt
ATGGCGCTCTCCAGGGTGTGCTGGGCTCGGTCGGCTGTGTGGGGCTCGGCAGTCACCCCTGGACATTTTGTCACCCGGAGGCTGCAACTT
GGTCGCTCTGGCCTGGCTTGGGGGGCCCCTCGGTCTTCAAAGCTTCACCTTTCTCCAAAGGCAGATGTGAAGAACTTGATGTCTTATGTG
GTAACCAAGACAAAAGCGATTAATGGGAAATACCATCGTTTCTTGGGTCGTCATTTCCCCCGCTTCTATGTCCTGTACACAATCTTCATG
AAAGGATTGCAGATGTTATGGGCTGATGCCAAAAAGGCTAGAAGAATAAAGACAAATATGTGGAAGCACAATATAAAGTTTCATCAACTT
CCATACCGGGAGATGGAGCATTTGAGACAGGCAAGGATAAAAGCCATCAATACATTTTTTGCTAAGAATGGTTATCGATTAATGGATTCT
AGTATCTATAGTCACCCCATTCAAACTCAAGCACAGTATGCCTCCCCAGTCTTTATGCAGCCTGTATATAATCCTCACCAACAGTACTCG
GTCTATAGTATTGTGCCTCAGTCTTGGTCTCCAAATCCTACACCTTACTTTGAAACACCACTGGCTCCCTTTCCCAATGGTAGTTTTGTG
AATGGCTTTAATTCGCCAGGATCTTATAAAACAAATGCTGCTGCTATGAATATGGGTCGACCATTCCAAAAAAATCGTGTGAAGCCTCAG
TTTAGGTCATCTGGTGGTTCAGAACACTCAACAGAGGGCTCTGTATCCTTGGGGGATGGACAGTTGAACAGATATAGTTCAAGAAACTTT
CCAGCTGAACGGCATAACCCCACAGTAACTGGGCATCAGGAGCAAACTTACCTTCAGAAGGAGACTTCCACTTTGCAGGTGGAACAGAAT
GGGGACTATGGTAGGGGCAGGAGAACTCTCTTCAGAGGTCGAAGACGACGAGAAGATGACAGGATCTCAAGACCTCATCCTTCAACAGCT
GAATCAAAGGCTCCAACACCAAAGTTTGACTTATTAGCCTCAAATTTTCCACCTTTACCTGGAAGTTCATCAAGAATGCCAGGTGAACTC
GTTTTGGAGAATAGGATGTCTGATGTTGTTAAAGGTGTCTACAAAGAAAAGGATAATGAAGAGTTGACAATTAGTTGCCCAGTGCCTGCA
GATGAGCAGACAGAATGCACTTCTGCCCAGCAACTCAATATGAGTACCAGTTCTCCATGTGCTGCTGAGCTTACTGCATTAAGCACAACT
CAGCAAGAAAAGGATCTAATAGAAGATTCCTCTGTTCAGAAGGATGGTCTCAATCAGACAACTATACCAGTTTCTCCTCCAAGTACTACA
AAGCCATCGAGGGCAAGTACTGCTTCACCATGTAATAATAACATAAATGCAGCTACAGCTGTGGCTCTACAGGAACCCCGAAAGTTAAGT
TATGCTGAAGTGTGCCAGAAGCCCCCTAAAGAGCCATCTTCAGTTCTTGTGCAGCCACTACGGGAACTTCGCTCCAATGTGGTGTCTCCC
ACCAAAAATGAAGACAATGGAGCTCCTGAGAACTCCGTTGAGAAACCACATGAGAAGCCAGAAGCAAGGGCTAGTAAGGATTATTCTGGC
TTCCGAGGCAATATAATCCCCAGGGGAGCAGCAGGAAAAATCAGGGAACAGAGACGCCAGTTTAGCCATAGGGCTATACCTCAGGGAGTG


* Fusion transcript sequences (Full-length transcript).
>In-frame_LETMD1_ENST00000550929_chr12_51445990_+_LARP4_ENST00000293618_chr12_50847243_+_5612nt
AAAGACAACCTCTTCTCTCCCGCTTCTCTCGCTGTGAAGATGGCGCTCTCCAGGGTCTTCAAAGCTTCACCTTTCTCCAAAGGCAGATGT
GAAGAACTTGATGTCTTATGTGGTAACCAAGACAAAAGCGATTAATGGGAAATACCATCGTTTCTTGGGTCGTCATTTCCCCCGCTTCTA
TGTCCTGTACACAATCTTCATGAAAGGATTGCAGATGTTATGGGCTGATGCCAAAAAGGCTAGAAGAATAAAGACAAATATGTGGAAGCA
CAATATAAAGTTTCATCAACTTCCATACCGGGAGATGGAGCATTTGAGACAGGCAAGGATAAAAGCCATCAATACATTTTTTGCTAAGAA
TGGTTATCGATTAATGGATTCTAGTATCTATAGTCACCCCATTCAAACTCAAGCACAGTATGCCTCCCCAGTCTTTATGCAGCCTGTATA
TAATCCTCACCAACAGTACTCGGTCTATAGTATTGTGCCTCAGTCTTGGTCTCCAAATCCTACACCTTACTTTGAAACACCACTGGCTCC
CTTTCCCAATGGTAGTTTTGTGAATGGCTTTAATTCGCCAGGATCTTATAAAACAAATGCTGCTGCTATGAATATGGGTCGACCATTCCA
AAAAAATCGGAGAACTCTCTTCAGAGGTCGAAGACGACGAGAAGATGACAGGATCTCAAGACCTCATCCTTCAACAGCTGAATCAAAGGC
TCCAACACCAAAGTTTGACTTATTAGCCTCAAATTTTCCACCTTTACCTGGAAGTTCATCAAGAATGCCAGGTGAACTCGTTTTGGAGAA
TAGGATGTCTGATGTTGTTAAAGGTGTCTACAAAGAAAAGGATAATGAAGAGTTGACAATTAGTTGCCCAGTGCCTGCAGATGAGCAGAC
AGAATGCACTTCTGCCCAGCAACTCAATATGAGTACCAGTTCTCCATGTGCTGCTGAGCTTACTGCATTAAGCACAACTCAGCAAGAAAA
GGATCTAATAGAAGATTCCTCTGTTCAGAAGGATGGTCTCAATCAGACAACTATACCAGTTTCTCCTCCAAGTACTACAAAGCCATCGAG
GGCAAGTACTGCTTCACCATGTAATAATAACATAAATGCAGCTACAGCTGTGGCTCTACAGGAACCCCGAAAGTTAAGTTATGCTGAAGT
GTGCCAGAAGCCCCCTAAAGAGCCATCTTCAGTTCTTGTGCAGCCACTACGGGAACTTCGCTCCAATGTGGTGTCTCCCACCAAAAATGA
AGACAATGGAGCTCCTGAGAACTCCGTTGAGAAACCACATGAGAAGCCAGAAGCAAGGGCTAGTAAGGATTATTCTGGCTTCCGAGGCAA
TATAATCCCCAGGGGAGCAGCAGGAAAAATCAGGGAACAGAGACGCCAGTTTAGCCATAGGGCTATACCTCAGGGAGTGACTCGACGTAA
TGGCAAAGAGCAATATGTGCCACCCAGATCACCAAAGTAAAAAACAACAAAACTATTCAAAAACTTCACTCTCTTCCCATTAAACTTGAA
CTGTGGCTATATTGAACTGTTTTGGAGGGGAGGGGGTAGCCAGGAAGGAAACAAGAGAAAGTACGTCCATTTCATTATGGATTTTGGAGT
TGTGAGTGATAGGATCCCAAAATTCATCTCTAATGTGGTTTTTAAATGCTGGAGGATTCCAATCAATATAAATATATATATATATATACA
CACACATATATAAAAAGTATAATTTTTCTATTTTTGTTTTTGGTTTTAATTTGCAGAGATTTGCTGCCAGGAATCAATTTTGAGGGTTCA
GATTTAGCTTGGAAGAAAAAAAAGAAACATACATCCTTCAGTATAGGAGATGAGGGAATGAGAGAAAATATTTTTTGAAGAAGCATTTCT
GTAAAATTAGAAATTACTTTTTTTAATCTATTTAAAGTTTGGCTTGAAGAATGCCATCTCTGACTATATGGCCTTGTATTGCAAAGCGGA
TCAGTGGCTGGGGTGCCTGTTGTGGGTGTGAGTGTGTACAAGAGCGATTGAAGCCAAATCTGTTGTCATGTTAGTAAATGATTTGAAAAC
TGAATGTAATACTTGAGTAGATTTTTTTTTCTAGTTTGAAATTTAGTCTGTCTTTTTGACCTTACTAATATTTCATTTAACAAGTTGTAA
AACTCTGATTGTACTTAGAGATGTGACTACCAATCAGTTTGATACTCAAGGAAAGGGGGTTATTCAAGAAATTGAAAATTTCATCTTGGA
CCTCAGTGCATAGGTCAAATGGATTTCAGAGGTTTAAACTTCCCTGTGATTCCCCCGAATACCCCCAAAATGAGAAACAAAATTTTTTTT
CTTACTCCATTTGTTACTCTCTGTTCTTTGACTGCCCACCCACAGAAAAGCAAAATAACCAACTACCTACTCAATTGTGTGTTTGTAATT
GCTTTGAGCAGTCTAGTCAAATCATATAAATTGTTCTAAATTTCAGAATTGAACATTGAAGTATTAACTCTTCTGTTCACACATTTAGAA
TTTTAGCTCCCAAGATGGTAGGGCAGACTGACCGTACAGTAATTTATTTGTCGTTAGTGTTAAAGATTAAGCATAGTAACTGACTCTTAA
GTGTTAAATAATGTAGAAGTAAAAAAATTTTTTTTAAAGGCTTAATTTGGGAGGGGGGACTTATTTCTGTTTACAGTGTATTACCTTCCT
TCCCTCCTCTTCTCCCCCCACACCCAACAAAATACAGTTTGGAATTCACTGAAACAGTACCAGCAAGTCATGAGATTTTTTAGTAAAGAT
GAGAAAGATGGTTGAAGAAAATTAGTGCATAATTTCTCAGTGAATAAAGTTGTAGCTCTCATATACTAAATAGACAAGTTTACATGCTGT
TATTTAGAAAATGACTAAAATATTAAAAACCGTGTTGTGTTAATCTGTTTTAAGTCATACCATGTTCAGAGTTCTATGTAAGGTGGGTTT
TATTTTTCTTTTAAGGGATAGTTTGTAATAGTAAGAACTGTCCCATATGTTAGTAAATTACATATGTACAAATTGAAACTGTAAATTGTG
AACACTGGAAAGCACCATTGTGACATAGAGTAAACATCTTAGTAATATATTAAAGTGAATGTAAATGGTGGTTAAAATTACATTACTGTG
AAATTCATCTTCCAACTCTAAGTTAAGCTTTGGAGATACATGTTAGTGGTTAACTGTTAAGAGCTTTGAAAACACTGCACATATCTGTAC
AAGCCAGAATTACTATTTCTTTGACTTATTATTAGCTTGGCAGTTGCTTTTGATTTGATTGTTTTATGACATGGTATACTACTATATTTA
CTCAGTTTGAAACTATTCATTTCTACACACTATTTTTAAAAATTGCCTACTAGGTGAAACATAACAATAAAACTACCTGTGCTGAAATTT
GGGGGAAGTTTAGGTCCTTTAAAAAAACATATTAATCATTGACTACATCTATGATAAAAGTGCTTATTTTGGTTTACTAAGATAATGCAG
TTGGTGGAAATGATAAACGTTTTAAGTGTTAACATCCTTTGAATGCGTTGGATTTCAGAGAATAAACATTTTGTAAAAATCACTTGGTAA
GGATTATAAACTTAATTACTGCACTTAAAATGAAACATTACTTTTTTTAAACAATGTGTCACAAATGTAGGTCTGTATTACTTGTATGCT
TGTGTGACTTACTGTTAGTCCAGCTCTAAAAATTTAAAGGTTGTAATTGAAATACAAGAAAAGAGCCTTCTTTTAGAAGAAAGCAAGTAT
ATTTTTGCTTTTACTTCAAATGTTATTTAAAGTAGAAATTTAATTTGTAGATATAACCTTTAAAAATTTTCTCATTAAGACAATGTTTTT
AATTTAATTTGCCTCATTACATCTAATAGTTCCCATTTGATGGCATGTATAGGGAAGAGTGAGAGAGTGTGTGTGTGTGTATGTGTGTGT
AATATTTATATATATTCACAGTATGTATTTAGCATTTATTTTATTACAGCAGATTTAAAGTTTGTATCTAAATAATGCCTATGAGTTGTG
TGAAGCTCTTGGCTTTTTTCCAACGTTACTTTGTAACTAATGAGGGTGGATGTTCATTGTAGTTTATTTATTTGGTTCTTTAGATGGAGG
AATTTAAAAAATCAAATTTTTCTCTTCACCTTTATGACTTGACATTTCCTTGATCTGTTGGAGGCTAAAAGTAGGTATAAATGATATTGA
ATGTTGGGTATAGTGATACTCTGCCATAGTTCTTACTGCATGAAGAGAACAAGAGTCACACAAGTTCACCACTTTGCACTTCATAGAGAA
GGTACATAGAGACATTGCAAAACCTGTCTCCATTTGCTATCCTGATAATTAAGGTTTTCATAATACCTAGGGCCTGTCTCTGAGTAATTT
TAATTTTGCCAAATACACTGACATTTAAAATAGTGATCCATCTAAATTTTTTTCAGCTGGGTTTTGAGGAATATAAGAGCTTTCAATGAT
AAAGGTTTGTTGTAGTTGTCTTATGTGCTGAATTTGCAGATGATCAGATGCTGTGCAGAATTCTGATTTATTTTTGTTTCCTAAAATTAA
GATAGCTTGAATATTATTTCACATTCCTTTTTCTTTTTTAAATAAACAGGTTTGCTTTGGAAAGGCTTAATGATGGAATGTTAGCATCTT
CACTAGGGTAAAGAAGAACAAAAAGAATGTTGCTGGAACGTAAAATAGTATTTAAAAGTTAATGAACACTTCTCTAGTTTTCTTAGTTAT
GGCCTTAATAATTAGTCTCTTGGCTTAAATGTCCACTGGTTTTACTTTGACACAGTTGAACAACACTGGGGTTAAGTCTCTGGTATTTAG
GCTGGCAATATATATATTAACCATATTTTAAAAGTACCAATTTTGTTTTTACAGAAAAGATAAAACTCAAAAGAGAACAGTGTATTCCTT
CTGAGGGGCTTTTATAAATTATTAACTATAATATATGATGGATTTTTTCCTAATTTTTTATATTTCCTTACAATTTTGGTGGCCATTAAT
TTAACTTTAGGCTTTTGGGCATATGCTAGTCTGAGCTTCCGAAAAGATACATATATGTTTCCCTTTTCATTAGCTGAATGAGGATATTTT
AAGAAGTTGAAAGAGAATTTATTTTCAAGTTGTGAGTAAATCCTCCTTTGAAATTCACCTGATTATTAGATAACTTAAAGTTTATTTTTA
AAAGCTGACAACTTTTTATGAATCTTCGAGTTGACAGTTCCTAAAAGCGTAACTCAGATATTAATGGGCTGTGTATTAAATGGTTTTATT
TTCAGTTTTGCAGCACAGAACACTGTTGAAATATCCATATCAACTTGATTTTTTTAACCTAATTCAGGTGTCCTTTGCATCTCTTAAATG
TTGGGGGTGGGGGTCAGAGCCAGTTATCCGGCTTCTGTTTTGTCGATTGCTTAGATTTGTTCCTGTTGTCAAAACTGTTACCCCCAAAAT
TGGTGTGACACATGCTCATGCATAAAATGTTAAAATGAGTACATCCTTGTATTTGTATTTGTTTTCAACATCGCCAAGGTGCTATGGGAA

>In-frame_LETMD1_ENST00000550929_chr12_51445990_+_LARP4_ENST00000429001_chr12_50847243_+_3346nt
AAAGACAACCTCTTCTCTCCCGCTTCTCTCGCTGTGAAGATGGCGCTCTCCAGGGTCTTCAAAGCTTCACCTTTCTCCAAAGGCAGATGT
GAAGAACTTGATGTCTTATGTGGTAACCAAGACAAAAGCGATTAATGGGAAATACCATCGTTTCTTGGGTCGTCATTTCCCCCGCTTCTA
TGTCCTGTACACAATCTTCATGAAAGGATTGCAGATGTTATGGGCTGATGCCAAAAAGGCTAGAAGAATAAAGACAAATATGTGGAAGCA
CAATATAAAGTTTCATCAACTTCCATACCGGGAGATGGAGCATTTGAGACAGGCAAGGATAAAAGCCATCAATACATTTTTTGCTAAGAA
TGGTTATCGATTAATGGATTCTAGTATCTATAGTCACCCCATTCAAACTCAAGCACAGTATGCCTCCCCAGTCTTTATGCAGCCTGTATA
TAATCCTCACCAACAGTACTCGGTCTATAGTATTGTGCCTCAGTCTTGGTCTCCAAATCCTACACCTTACTTTGAAACACCACTGGCTCC
CTTTCCCAATGGTAGTTTTGTGAATGGCTTTAATTCGCCAGGATCTTATAAAACAAATGCTGCTGCTATGAATATGGGTCGACCATTCCA
AAAAAATCGTGTGAAGCCTCAGTTTAGGTCATCTGGTGGTTCAGAACACTCAACAGAGGGCTCTGTATCCTTGGGGGATGGACAGTTGAA
CAGATATAGTTCAAGAAACTTTCCAGCTGAACGGCATAACCCCACAGTAACTGGGCATCAGGAGCAAACTTACCTTCAGAAGGAGACTTC
CACTTTGCAGGTGGAACAGAATGGGGACTATGGTAGGGGCAGGAGAACTCTCTTCAGAGGTCGAAGACGACGAGAAGATGACAGGATCTC
AAGACCTCATCCTTCAACAGCTGAATCAAAGGCTCCAACACCAAAGTTTGACTTATTAGCCTCAAATTTTCCACCTTTACCTGGAAGTTC
ATCAAGAATGCCAGGTGAACTCGTTTTGGAGAATAGGATGTCTGATGTTGTTAAAGGTGTCTACAAAGAAAAGGATAATGAAGAGTTGAC
AATTAGTTGCCCAGTGCCTGCAGATGAGCAGACAGAATGCACTTCTGCCCAGCAACTCAATATGAGTACCAGTTCTCCATGTGCTGCTGA
GCTTACTGCATTAAGCACAACTCAGCAAGAAAAGGATCTAATAGAAGATTCCTCTGTTCAGAAGGATGGTCTCAATCAGACAACTATACC
AGTTTCTCCTCCAAGTACTACAAAGCCATCGAGGGCAAGTACTGCTTCACCATGTAATAATAACATAAATGCAGCTACAGCTGTGGCTCT
ACAGGAACCCCGAAAGTTAAGTTATGCTGAAGTGTGCCAGAAGCCCCCTAAAGAGCCATCTTCAGTTCTTGTGCAGCCACTACGGGAACT
TCGCTCCAATGTGGTGTCTCCCACCAAAAATGAAGACAATGGAGCTCCTGAGAACTCCGTTGAGAAACCACATGAGAAGCCAGAAGCAAG
GGCTAGTAAGGATTATTCTGGCTTCCGAGGCAATATAATCCCCAGGGGAGCAGCAGGAAAAATCAGGGAACAGAGACGCCAGTTTAGCCA
TAGGGCTATACCTCAGGGAGTGACTCGACGTAATGGCAAAGAGCAATATGTGCCACCCAGATCACCAAAGTAAAAAACAACAAAACTATT
CAAAAACTTCACTCTCTTCCCATTAAACTTGAACTGTGGCTATATTGAACTGTTTTGGAGGGGAGGGGGTAGCCAGGAAGGAAACAAGAG
AAAGTACGTCCATTTCATTATGGATTTTGGAGTTGTGAGTGATAGGATCCCAAAATTCATCTCTAATGTGGTTTTTAAATGCTGGAGGAT
TCCAATCAATATAAATATATATATATATATACACACACATATATAAAAAGTATAATTTTTCTATTTTTGTTTTTGGTTTTAATTTGCAGA
GATTTGCTGCCAGGAATCAATTTTGAGGGTTCAGATTTAGCTTGGAAGAAAAAAAAGAAACATACATCCTTCAGTATAGGAGATGAGGGA
ATGAGAGAAAATATTTTTTGAAGAAGCATTTCTGTAAAATTAGAAATTACTTTTTTTAATCTATTTAAAGTTTGGCTTGAAGAATGCCAT
CTCTGACTATATGGCCTTGTATTGCAAAGCGGATCAGTGGCTGGGGTGCCTGTTGTGGGTGTGAGTGTGTACAAGAGCGATTGAAGCCAA
ATCTGTTGTCATGTTAGTAAATGATTTGAAAACTGAATGTAATACTTGAGTAGATTTTTTTTTCTAGTTTGAAATTTAGTCTGTCTTTTT
GACCTTACTAATATTTCATTTAACAAGTTGTAAAACTCTGATTGTACTTAGAGATGTGACTACCAATCAGTTTGATACTCAAGGAAAGGG
GGTTATTCAAGAAATTGAAAATTTCATCTTGGACCTCAGTGCATAGGTCAAATGGATTTCAGAGGTTTAAACTTCCCTGTGATTCCCCCG
AATACCCCCAAAATGAGAAACAAAATTTTTTTTCTTACTCCATTTGTTACTCTCTGTTCTTTGACTGCCCACCCACAGAAAAGCAAAATA
ACCAACTACCTACTCAATTGTGTGTTTGTAATTGCTTTGAGCAGTCTAGTCAAATCATATAAATTGTTCTAAATTTCAGAATTGAACATT
GAAGTATTAACTCTTCTGTTCACACATTTAGAATTTTAGCTCCCAAGATGGTAGGGCAGACTGACCGTACAGTAATTTATTTGTCGTTAG
TGTTAAAGATTAAGCATAGTAACTGACTCTTAAGTGTTAAATAATGTAGAAGTAAAAAAATTTTTTTTAAAGGCTTAATTTGGGAGGGGG
GACTTATTTCTGTTTACAGTGTATTACCTTCCTTCCCTCCTCTTCTCCCCCCACACCCAACAAAATACAGTTTGGAATTCACTGAAACAG
TACCAGCAAGTCATGAGATTTTTTAGTAAAGATGAGAAAGATGGTTGAAGAAAATTAGTGCATAATTTCTCAGTGAATAAAGTTGTAGCT
CTCATATACTAAATAGACAAGTTTACATGCTGTTATTTAGAAAATGACTAAAATATTAAAAACCGTGTTGTGTTAATCTGTTTTAAGTCA
TACCATGTTCAGAGTTCTATGTAAGGTGGGTTTTATTTTTCTTTTAAGGGATAGTTTGTAATAGTAAGAACTGTCCCATATGTTAGTAAA
TTACATATGTACAAATTGAAACTGTAAATTGTGAACACTGGAAAGCACCATTGTGACATAGAGTAAACATCTTAGTAATATATTAAAGTG

>In-frame_LETMD1_ENST00000550929_chr12_51445990_+_LARP4_ENST00000398473_chr12_50847243_+_5833nt
AAAGACAACCTCTTCTCTCCCGCTTCTCTCGCTGTGAAGATGGCGCTCTCCAGGGTCTTCAAAGCTTCACCTTTCTCCAAAGGCAGATGT
GAAGAACTTGATGTCTTATGTGGTAACCAAGACAAAAGCGATTAATGGGAAATACCATCGTTTCTTGGGTCGTCATTTCCCCCGCTTCTA
TGTCCTGTACACAATCTTCATGAAAGGATTGCAGATGTTATGGGCTGATGCCAAAAAGGCTAGAAGAATAAAGACAAATATGTGGAAGCA
CAATATAAAGTTTCATCAACTTCCATACCGGGAGATGGAGCATTTGAGACAGGCAAGGATAAAAGCCATCAATACATTTTTTGCTAAGAA
TGGTTATCGATTAATGGATTCTAGTATCTATAGTCACCCCATTCAAACTCAAGCACAGTATGCCTCCCCAGTCTTTATGCAGCCTGTATA
TAATCCTCACCAACAGTACTCGGTCTATAGTATTGTGCCTCAGTCTTGGTCTCCAAATCCTACACCTTACTTTGAAACACCACTGGCTCC
CTTTCCCAATGGTAGTTTTGTGAATGGCTTTAATTCGCCAGGATCTTATAAAACAAATGCTGCTGCTATGAATATGGGTCGACCATTCCA
AAAAAATCGTGTGAAGCCTCAGTTTAGGTCATCTGGTGGTTCAGAACACTCAACAGAGGGCTCTGTATCCTTGGGGGATGGACAGTTGAA
CAGATATAGTTCAAGAAACTTTCCAGCTGAACGGCATAACCCCACAGTAACTGGGCATCAGGAGCAAACTTACCTTCAGAAGGAGACTTC
CACTTTGCAGGTGGAACAGAATGGGGACTATGGTAGGGGCAGGAGAACTCTCTTCAGAGGTCGAAGACGACGAGAAGATGACAGGATCTC
AAGACCTCATCCTTCAACAGCTGAATCAAAGGCTCCAACACCAAAGTTTGACTTATTAGCCTCAAATTTTCCACCTTTACCTGGAAGTTC
ATCAAGAATGCCAGGTGAACTCGTTTTGGAGAATAGGATGTCTGATGTTGTTAAAGGTGTCTACAAAGAAAAGGATAATGAAGAGTTGAC
AATTAGTTGCCCAGTGCCTGCAGATGAGCAGACAGAATGCACTTCTGCCCAGCAACTCAATATGAGTACCAGTTCTCCATGTGCTGCTGA
GCTTACTGCATTAAGCACAACTCAGCAAGAAAAGGATCTAATAGAAGATTCCTCTGTTCAGAAGGATGGTCTCAATCAGACAACTATACC
AGTTTCTCCTCCAAGTACTACAAAGCCATCGAGGGCAAGTACTGCTTCACCATGTAATAATAACATAAATGCAGCTACAGCTGTGGCTCT
ACAGGAACCCCGAAAGTTAAGTTATGCTGAAGTGTGCCAGAAGCCCCCTAAAGAGCCATCTTCAGTTCTTGTGCAGCCACTACGGGAACT
TCGCTCCAATGTGGTGTCTCCCACCAAAAATGAAGACAATGGAGCTCCTGAGAACTCCGTTGAGAAACCACATGAGAAGCCAGAAGCAAG
GGCTAGTAAGGATTATTCTGGCTTCCGAGGCAATATAATCCCCAGGGGAGCAGCAGGAAAAATCAGGGAACAGAGACGCCAGTTTAGCCA
TAGGGCTATACCTCAGGGAGTGACTCGACGTAATGGCAAAGAGCAATATGTGCCACCCAGATCACCAAAGTAAAAAACAACAAAACTATT
CAAAAACTTCACTCTCTTCCCATTAAACTTGAACTGTGGCTATATTGAACTGTTTTGGAGGGGAGGGGGTAGCCAGGAAGGAAACAAGAG
AAAGTACGTCCATTTCATTATGGATTTTGGAGTTGTGAGTGATAGGATCCCAAAATTCATCTCTAATGTGGTTTTTAAATGCTGGAGGAT
TCCAATCAATATAAATATATATATATATATACACACACATATATAAAAAGTATAATTTTTCTATTTTTGTTTTTGGTTTTAATTTGCAGA
GATTTGCTGCCAGGAATCAATTTTGAGGGTTCAGATTTAGCTTGGAAGAAAAAAAAGAAACATACATCCTTCAGTATAGGAGATGAGGGA
ATGAGAGAAAATATTTTTTGAAGAAGCATTTCTGTAAAATTAGAAATTACTTTTTTTAATCTATTTAAAGTTTGGCTTGAAGAATGCCAT
CTCTGACTATATGGCCTTGTATTGCAAAGCGGATCAGTGGCTGGGGTGCCTGTTGTGGGTGTGAGTGTGTACAAGAGCGATTGAAGCCAA
ATCTGTTGTCATGTTAGTAAATGATTTGAAAACTGAATGTAATACTTGAGTAGATTTTTTTTTCTAGTTTGAAATTTAGTCTGTCTTTTT
GACCTTACTAATATTTCATTTAACAAGTTGTAAAACTCTGATTGTACTTAGAGATGTGACTACCAATCAGTTTGATACTCAAGGAAAGGG
GGTTATTCAAGAAATTGAAAATTTCATCTTGGACCTCAGTGCATAGGTCAAATGGATTTCAGAGGTTTAAACTTCCCTGTGATTCCCCCG
AATACCCCCAAAATGAGAAACAAAATTTTTTTTCTTACTCCATTTGTTACTCTCTGTTCTTTGACTGCCCACCCACAGAAAAGCAAAATA
ACCAACTACCTACTCAATTGTGTGTTTGTAATTGCTTTGAGCAGTCTAGTCAAATCATATAAATTGTTCTAAATTTCAGAATTGAACATT
GAAGTATTAACTCTTCTGTTCACACATTTAGAATTTTAGCTCCCAAGATGGTAGGGCAGACTGACCGTACAGTAATTTATTTGTCGTTAG
TGTTAAAGATTAAGCATAGTAACTGACTCTTAAGTGTTAAATAATGTAGAAGTAAAAAAATTTTTTTTAAAGGCTTAATTTGGGAGGGGG
GACTTATTTCTGTTTACAGTGTATTACCTTCCTTCCCTCCTCTTCTCCCCCCACACCCAACAAAATACAGTTTGGAATTCACTGAAACAG
TACCAGCAAGTCATGAGATTTTTTAGTAAAGATGAGAAAGATGGTTGAAGAAAATTAGTGCATAATTTCTCAGTGAATAAAGTTGTAGCT
CTCATATACTAAATAGACAAGTTTACATGCTGTTATTTAGAAAATGACTAAAATATTAAAAACCGTGTTGTGTTAATCTGTTTTAAGTCA
TACCATGTTCAGAGTTCTATGTAAGGTGGGTTTTATTTTTCTTTTAAGGGATAGTTTGTAATAGTAAGAACTGTCCCATATGTTAGTAAA
TTACATATGTACAAATTGAAACTGTAAATTGTGAACACTGGAAAGCACCATTGTGACATAGAGTAAACATCTTAGTAATATATTAAAGTG
AATGTAAATGGTGGTTAAAATTACATTACTGTGAAATTCATCTTCCAACTCTAAGTTAAGCTTTGGAGATACATGTTAGTGGTTAACTGT
TAAGAGCTTTGAAAACACTGCACATATCTGTACAAGCCAGAATTACTATTTCTTTGACTTATTATTAGCTTGGCAGTTGCTTTTGATTTG
ATTGTTTTATGACATGGTATACTACTATATTTACTCAGTTTGAAACTATTCATTTCTACACACTATTTTTAAAAATTGCCTACTAGGTGA
AACATAACAATAAAACTACCTGTGCTGAAATTTGGGGGAAGTTTAGGTCCTTTAAAAAAACATATTAATCATTGACTACATCTATGATAA
AAGTGCTTATTTTGGTTTACTAAGATAATGCAGTTGGTGGAAATGATAAACGTTTTAAGTGTTAACATCCTTTGAATGCGTTGGATTTCA
GAGAATAAACATTTTGTAAAAATCACTTGGTAAGGATTATAAACTTAATTACTGCACTTAAAATGAAACATTACTTTTTTTAAACAATGT
GTCACAAATGTAGGTCTGTATTACTTGTATGCTTGTGTGACTTACTGTTAGTCCAGCTCTAAAAATTTAAAGGTTGTAATTGAAATACAA
GAAAAGAGCCTTCTTTTAGAAGAAAGCAAGTATATTTTTGCTTTTACTTCAAATGTTATTTAAAGTAGAAATTTAATTTGTAGATATAAC
CTTTAAAAATTTTCTCATTAAGACAATGTTTTTAATTTAATTTGCCTCATTACATCTAATAGTTCCCATTTGATGGCATGTATAGGGAAG
AGTGAGAGAGTGTGTGTGTGTGTATGTGTGTGTAATATTTATATATATTCACAGTATGTATTTAGCATTTATTTTATTACAGCAGATTTA
AAGTTTGTATCTAAATAATGCCTATGAGTTGTGTGAAGCTCTTGGCTTTTTTCCAACGTTACTTTGTAACTAATGAGGGTGGATGTTCAT
TGTAGTTTATTTATTTGGTTCTTTAGATGGAGGAATTTAAAAAATCAAATTTTTCTCTTCACCTTTATGACTTGACATTTCCTTGATCTG
TTGGAGGCTAAAAGTAGGTATAAATGATATTGAATGTTGGGTATAGTGATACTCTGCCATAGTTCTTACTGCATGAAGAGAACAAGAGTC
ACACAAGTTCACCACTTTGCACTTCATAGAGAAGGTACATAGAGACATTGCAAAACCTGTCTCCATTTGCTATCCTGATAATTAAGGTTT
TCATAATACCTAGGGCCTGTCTCTGAGTAATTTTAATTTTGCCAAATACACTGACATTTAAAATAGTGATCCATCTAAATTTTTTTCAGC
TGGGTTTTGAGGAATATAAGAGCTTTCAATGATAAAGGTTTGTTGTAGTTGTCTTATGTGCTGAATTTGCAGATGATCAGATGCTGTGCA
GAATTCTGATTTATTTTTGTTTCCTAAAATTAAGATAGCTTGAATATTATTTCACATTCCTTTTTCTTTTTTAAATAAACAGGTTTGCTT
TGGAAAGGCTTAATGATGGAATGTTAGCATCTTCACTAGGGTAAAGAAGAACAAAAAGAATGTTGCTGGAACGTAAAATAGTATTTAAAA
GTTAATGAACACTTCTCTAGTTTTCTTAGTTATGGCCTTAATAATTAGTCTCTTGGCTTAAATGTCCACTGGTTTTACTTTGACACAGTT
GAACAACACTGGGGTTAAGTCTCTGGTATTTAGGCTGGCAATATATATATTAACCATATTTTAAAAGTACCAATTTTGTTTTTACAGAAA
AGATAAAACTCAAAAGAGAACAGTGTATTCCTTCTGAGGGGCTTTTATAAATTATTAACTATAATATATGATGGATTTTTTCCTAATTTT
TTATATTTCCTTACAATTTTGGTGGCCATTAATTTAACTTTAGGCTTTTGGGCATATGCTAGTCTGAGCTTCCGAAAAGATACATATATG
TTTCCCTTTTCATTAGCTGAATGAGGATATTTTAAGAAGTTGAAAGAGAATTTATTTTCAAGTTGTGAGTAAATCCTCCTTTGAAATTCA
CCTGATTATTAGATAACTTAAAGTTTATTTTTAAAAGCTGACAACTTTTTATGAATCTTCGAGTTGACAGTTCCTAAAAGCGTAACTCAG
ATATTAATGGGCTGTGTATTAAATGGTTTTATTTTCAGTTTTGCAGCACAGAACACTGTTGAAATATCCATATCAACTTGATTTTTTTAA
CCTAATTCAGGTGTCCTTTGCATCTCTTAAATGTTGGGGGTGGGGGTCAGAGCCAGTTATCCGGCTTCTGTTTTGTCGATTGCTTAGATT
TGTTCCTGTTGTCAAAACTGTTACCCCCAAAATTGGTGTGACACATGCTCATGCATAAAATGTTAAAATGAGTACATCCTTGTATTTGTA

>In-frame_LETMD1_ENST00000550929_chr12_51445990_+_LARP4_ENST00000518444_chr12_50847243_+_2292nt
AAAGACAACCTCTTCTCTCCCGCTTCTCTCGCTGTGAAGATGGCGCTCTCCAGGGTCTTCAAAGCTTCACCTTTCTCCAAAGGCAGATGT
GAAGAACTTGATGTCTTATGTGGTAACCAAGACAAAAGCGATTAATGGGAAATACCATCGTTTCTTGGGTCGTCATTTCCCCCGCTTCTA
TGTCCTGTACACAATCTTCATGAAAGGATTGCAGATGTTATGGGCTGATGCCAAAAAGGCTAGAAGAATAAAGACAAATATGTGGAAGCA
CAATATAAAGTTTCATCAACTTCCATACCGGGAGATGGAGCATTTGAGACAGGCAAGGATAAAAGCCATCAATACATTTTTTGCTAAGAA
TGGTTATCGATTAATGGATTCTAGTATCTATAGTCACCCCATTCAAACTCAAGCACAGTATGCCTCCCCAGTCTTTATGCAGCCTGTATA
TAATCCTCACCAACAGTACTCGGTCTATAGTATTGTGCCTCAGTCTTGGTCTCCAAATCCTACACCTTACTTTGAAACACCACTGGCTCC
CTTTCCCAATGGTAGTTTTGTGAATGGCTTTAATTCGCCAGGATCTTATAAAACAAATGCTGCTGCTATGAATATGGGTCGACCATTCCA
AAAAAATCGTGTGAAGCCTCAGTTTAGGTCATCTGGTGGTTCAGAACACTCAACAGAGGGCTCTGTATCCTTGGGGGATGGACAGTTGAA
CAGATATAGTTCAAGAAACTTTCCAGCTGAACGGCATAACCCCACAGTAACTGGGCATCAGGAGCAAACTTACCTTCAGAAGGAGACTTC
CACTTTGCAGGTGGAACAGAATGGGGACTATGGTAGGGGCAGGAGAACTCTCTTCAGAGGTCGAAGACGACGAGAAGATGACAGGATCTC
AAGACCTCATCCTTCAACAGCTGAATCAAAGGCTCCAACACCAAAGTTTGACTTATTAGCCTCAAATTTTCCACCTTTACCTGGAAGTTC
ATCAAGAATGCCAGGTGAACTCGTTTTGGAGAATAGGATGTCTGATGTTGTTAAAGGTGTCTACAAAGAAAAGGATAATGAAGAGTTGAC
AATTAGTTGCCCAGTGCCTGCAGATGAGCAGACAGAATGCACTTCTGCCCAGCAACTCAATATGAGTACCAGTTCTCCATGTGCTGCTGA
GCTTACTGCATTAAGCACAACTCAGCAAGAAAAGGATCTAATAGAAGATTCCTCTGTTCAGAAGGATGGTCTCAATCAGACAACTATACC
AGTTTCTCCTCCAAGTACTACAAAGCCATCGAGGGCAAGTACTGCTTCACCATGTAATAATAACATAAATGCAGCTACAGCTGTGGCTCT
ACAGGAACCCCGAAAGTTAAGTTATGCTGAAGTGTGCCAGAAGCCCCCTAAAGAGCCATCTTCAGTTCTTGTGCAGCCACTACGGGAACT
TCGCTCCAATGTGGTGTCTCCCACCAAAAATGAAGACAATGGAGCTCCTGAGAACTCCGTTGAGAAACCACATGAGAAGCCAGAAGCAAG
GGCTAGTAAGGATTATTCTGGCTTCCGAGGCAATATAATCCCCAGGGGAGCAGCAGGAAAAATCAGGGAACAGAGACGCCAGTTTAGCCA
TAGGGCTATACCTCAGGGAGTGACTCGACGTAATGGCAAAGAGCAATATGTGCCACCCAGATCACCAAAGTAAAAAACAACAAAACTATT
CAAAAACTTCACTCTCTTCCCATTAAACTTGAACTGTGGCTATATTGAACTGTTTTGGAGGGGAGGGGGTAGCCAGGAAGGAAACAAGAG
AAAGTACGTCCATTTCATTATGGATTTTGGAGTTGTGAGTGATAGGATCCCAAAATTCATCTCTAATGTGGTTTTTAAATGCTGGAGGAT
TCCAATCAATATAAATATATATATATATATACACACACATATATAAAAAGTATAATTTTTCTATTTTTGTTTTTGGTTTTAATTTGCAGA
GATTTGCTGCCAGGAATCAATTTTGAGGGTTCAGATTTAGCTTGGAAGAAAAAAAAGAAACATACATCCTTCAGTATAGGAGATGAGGGA
ATGAGAGAAAATATTTTTTGAAGAAGCATTTCTGTAAAATTAGAAATTACTTTTTTTAATCTATTTAAAGTTTGGCTTGAAGAATGCCAT
CTCTGACTATATGGCCTTGTATTGCAAAGCGGATCAGTGGCTGGGGTGCCTGTTGTGGGTGTGAGTGTGTACAAGAGCGATTGAAGCCAA

>In-frame_LETMD1_ENST00000262055_chr12_51445990_+_LARP4_ENST00000293618_chr12_50847243_+_5719nt
AAAGACAACCTCTTCTCTCCCGCTTCTCTCGCTGTGAAGATGGCGCTCTCCAGGGTGTGCTGGGCTCGGTCGGCTGTGTGGGGCTCGGCA
GTCACCCCTGGACATTTTGTCACCCGGAGGCTGCAACTTGGTCGCTCTGGCCTGGCTTGGGGGGCCCCTCGGTCTTCAAAGCTTCACCTT
TCTCCAAAGGCAGATGTGAAGAACTTGATGTCTTATGTGGTAACCAAGACAAAAGCGATTAATGGGAAATACCATCGTTTCTTGGGTCGT
CATTTCCCCCGCTTCTATGTCCTGTACACAATCTTCATGAAAGGATTGCAGATGTTATGGGCTGATGCCAAAAAGGCTAGAAGAATAAAG
ACAAATATGTGGAAGCACAATATAAAGTTTCATCAACTTCCATACCGGGAGATGGAGCATTTGAGACAGGCAAGGATAAAAGCCATCAAT
ACATTTTTTGCTAAGAATGGTTATCGATTAATGGATTCTAGTATCTATAGTCACCCCATTCAAACTCAAGCACAGTATGCCTCCCCAGTC
TTTATGCAGCCTGTATATAATCCTCACCAACAGTACTCGGTCTATAGTATTGTGCCTCAGTCTTGGTCTCCAAATCCTACACCTTACTTT
GAAACACCACTGGCTCCCTTTCCCAATGGTAGTTTTGTGAATGGCTTTAATTCGCCAGGATCTTATAAAACAAATGCTGCTGCTATGAAT
ATGGGTCGACCATTCCAAAAAAATCGGAGAACTCTCTTCAGAGGTCGAAGACGACGAGAAGATGACAGGATCTCAAGACCTCATCCTTCA
ACAGCTGAATCAAAGGCTCCAACACCAAAGTTTGACTTATTAGCCTCAAATTTTCCACCTTTACCTGGAAGTTCATCAAGAATGCCAGGT
GAACTCGTTTTGGAGAATAGGATGTCTGATGTTGTTAAAGGTGTCTACAAAGAAAAGGATAATGAAGAGTTGACAATTAGTTGCCCAGTG
CCTGCAGATGAGCAGACAGAATGCACTTCTGCCCAGCAACTCAATATGAGTACCAGTTCTCCATGTGCTGCTGAGCTTACTGCATTAAGC
ACAACTCAGCAAGAAAAGGATCTAATAGAAGATTCCTCTGTTCAGAAGGATGGTCTCAATCAGACAACTATACCAGTTTCTCCTCCAAGT
ACTACAAAGCCATCGAGGGCAAGTACTGCTTCACCATGTAATAATAACATAAATGCAGCTACAGCTGTGGCTCTACAGGAACCCCGAAAG
TTAAGTTATGCTGAAGTGTGCCAGAAGCCCCCTAAAGAGCCATCTTCAGTTCTTGTGCAGCCACTACGGGAACTTCGCTCCAATGTGGTG
TCTCCCACCAAAAATGAAGACAATGGAGCTCCTGAGAACTCCGTTGAGAAACCACATGAGAAGCCAGAAGCAAGGGCTAGTAAGGATTAT
TCTGGCTTCCGAGGCAATATAATCCCCAGGGGAGCAGCAGGAAAAATCAGGGAACAGAGACGCCAGTTTAGCCATAGGGCTATACCTCAG
GGAGTGACTCGACGTAATGGCAAAGAGCAATATGTGCCACCCAGATCACCAAAGTAAAAAACAACAAAACTATTCAAAAACTTCACTCTC
TTCCCATTAAACTTGAACTGTGGCTATATTGAACTGTTTTGGAGGGGAGGGGGTAGCCAGGAAGGAAACAAGAGAAAGTACGTCCATTTC
ATTATGGATTTTGGAGTTGTGAGTGATAGGATCCCAAAATTCATCTCTAATGTGGTTTTTAAATGCTGGAGGATTCCAATCAATATAAAT
ATATATATATATATACACACACATATATAAAAAGTATAATTTTTCTATTTTTGTTTTTGGTTTTAATTTGCAGAGATTTGCTGCCAGGAA
TCAATTTTGAGGGTTCAGATTTAGCTTGGAAGAAAAAAAAGAAACATACATCCTTCAGTATAGGAGATGAGGGAATGAGAGAAAATATTT
TTTGAAGAAGCATTTCTGTAAAATTAGAAATTACTTTTTTTAATCTATTTAAAGTTTGGCTTGAAGAATGCCATCTCTGACTATATGGCC
TTGTATTGCAAAGCGGATCAGTGGCTGGGGTGCCTGTTGTGGGTGTGAGTGTGTACAAGAGCGATTGAAGCCAAATCTGTTGTCATGTTA
GTAAATGATTTGAAAACTGAATGTAATACTTGAGTAGATTTTTTTTTCTAGTTTGAAATTTAGTCTGTCTTTTTGACCTTACTAATATTT
CATTTAACAAGTTGTAAAACTCTGATTGTACTTAGAGATGTGACTACCAATCAGTTTGATACTCAAGGAAAGGGGGTTATTCAAGAAATT
GAAAATTTCATCTTGGACCTCAGTGCATAGGTCAAATGGATTTCAGAGGTTTAAACTTCCCTGTGATTCCCCCGAATACCCCCAAAATGA
GAAACAAAATTTTTTTTCTTACTCCATTTGTTACTCTCTGTTCTTTGACTGCCCACCCACAGAAAAGCAAAATAACCAACTACCTACTCA
ATTGTGTGTTTGTAATTGCTTTGAGCAGTCTAGTCAAATCATATAAATTGTTCTAAATTTCAGAATTGAACATTGAAGTATTAACTCTTC
TGTTCACACATTTAGAATTTTAGCTCCCAAGATGGTAGGGCAGACTGACCGTACAGTAATTTATTTGTCGTTAGTGTTAAAGATTAAGCA
TAGTAACTGACTCTTAAGTGTTAAATAATGTAGAAGTAAAAAAATTTTTTTTAAAGGCTTAATTTGGGAGGGGGGACTTATTTCTGTTTA
CAGTGTATTACCTTCCTTCCCTCCTCTTCTCCCCCCACACCCAACAAAATACAGTTTGGAATTCACTGAAACAGTACCAGCAAGTCATGA
GATTTTTTAGTAAAGATGAGAAAGATGGTTGAAGAAAATTAGTGCATAATTTCTCAGTGAATAAAGTTGTAGCTCTCATATACTAAATAG
ACAAGTTTACATGCTGTTATTTAGAAAATGACTAAAATATTAAAAACCGTGTTGTGTTAATCTGTTTTAAGTCATACCATGTTCAGAGTT
CTATGTAAGGTGGGTTTTATTTTTCTTTTAAGGGATAGTTTGTAATAGTAAGAACTGTCCCATATGTTAGTAAATTACATATGTACAAAT
TGAAACTGTAAATTGTGAACACTGGAAAGCACCATTGTGACATAGAGTAAACATCTTAGTAATATATTAAAGTGAATGTAAATGGTGGTT
AAAATTACATTACTGTGAAATTCATCTTCCAACTCTAAGTTAAGCTTTGGAGATACATGTTAGTGGTTAACTGTTAAGAGCTTTGAAAAC
ACTGCACATATCTGTACAAGCCAGAATTACTATTTCTTTGACTTATTATTAGCTTGGCAGTTGCTTTTGATTTGATTGTTTTATGACATG
GTATACTACTATATTTACTCAGTTTGAAACTATTCATTTCTACACACTATTTTTAAAAATTGCCTACTAGGTGAAACATAACAATAAAAC
TACCTGTGCTGAAATTTGGGGGAAGTTTAGGTCCTTTAAAAAAACATATTAATCATTGACTACATCTATGATAAAAGTGCTTATTTTGGT
TTACTAAGATAATGCAGTTGGTGGAAATGATAAACGTTTTAAGTGTTAACATCCTTTGAATGCGTTGGATTTCAGAGAATAAACATTTTG
TAAAAATCACTTGGTAAGGATTATAAACTTAATTACTGCACTTAAAATGAAACATTACTTTTTTTAAACAATGTGTCACAAATGTAGGTC
TGTATTACTTGTATGCTTGTGTGACTTACTGTTAGTCCAGCTCTAAAAATTTAAAGGTTGTAATTGAAATACAAGAAAAGAGCCTTCTTT
TAGAAGAAAGCAAGTATATTTTTGCTTTTACTTCAAATGTTATTTAAAGTAGAAATTTAATTTGTAGATATAACCTTTAAAAATTTTCTC
ATTAAGACAATGTTTTTAATTTAATTTGCCTCATTACATCTAATAGTTCCCATTTGATGGCATGTATAGGGAAGAGTGAGAGAGTGTGTG
TGTGTGTATGTGTGTGTAATATTTATATATATTCACAGTATGTATTTAGCATTTATTTTATTACAGCAGATTTAAAGTTTGTATCTAAAT
AATGCCTATGAGTTGTGTGAAGCTCTTGGCTTTTTTCCAACGTTACTTTGTAACTAATGAGGGTGGATGTTCATTGTAGTTTATTTATTT
GGTTCTTTAGATGGAGGAATTTAAAAAATCAAATTTTTCTCTTCACCTTTATGACTTGACATTTCCTTGATCTGTTGGAGGCTAAAAGTA
GGTATAAATGATATTGAATGTTGGGTATAGTGATACTCTGCCATAGTTCTTACTGCATGAAGAGAACAAGAGTCACACAAGTTCACCACT
TTGCACTTCATAGAGAAGGTACATAGAGACATTGCAAAACCTGTCTCCATTTGCTATCCTGATAATTAAGGTTTTCATAATACCTAGGGC
CTGTCTCTGAGTAATTTTAATTTTGCCAAATACACTGACATTTAAAATAGTGATCCATCTAAATTTTTTTCAGCTGGGTTTTGAGGAATA
TAAGAGCTTTCAATGATAAAGGTTTGTTGTAGTTGTCTTATGTGCTGAATTTGCAGATGATCAGATGCTGTGCAGAATTCTGATTTATTT
TTGTTTCCTAAAATTAAGATAGCTTGAATATTATTTCACATTCCTTTTTCTTTTTTAAATAAACAGGTTTGCTTTGGAAAGGCTTAATGA
TGGAATGTTAGCATCTTCACTAGGGTAAAGAAGAACAAAAAGAATGTTGCTGGAACGTAAAATAGTATTTAAAAGTTAATGAACACTTCT
CTAGTTTTCTTAGTTATGGCCTTAATAATTAGTCTCTTGGCTTAAATGTCCACTGGTTTTACTTTGACACAGTTGAACAACACTGGGGTT
AAGTCTCTGGTATTTAGGCTGGCAATATATATATTAACCATATTTTAAAAGTACCAATTTTGTTTTTACAGAAAAGATAAAACTCAAAAG
AGAACAGTGTATTCCTTCTGAGGGGCTTTTATAAATTATTAACTATAATATATGATGGATTTTTTCCTAATTTTTTATATTTCCTTACAA
TTTTGGTGGCCATTAATTTAACTTTAGGCTTTTGGGCATATGCTAGTCTGAGCTTCCGAAAAGATACATATATGTTTCCCTTTTCATTAG
CTGAATGAGGATATTTTAAGAAGTTGAAAGAGAATTTATTTTCAAGTTGTGAGTAAATCCTCCTTTGAAATTCACCTGATTATTAGATAA
CTTAAAGTTTATTTTTAAAAGCTGACAACTTTTTATGAATCTTCGAGTTGACAGTTCCTAAAAGCGTAACTCAGATATTAATGGGCTGTG
TATTAAATGGTTTTATTTTCAGTTTTGCAGCACAGAACACTGTTGAAATATCCATATCAACTTGATTTTTTTAACCTAATTCAGGTGTCC
TTTGCATCTCTTAAATGTTGGGGGTGGGGGTCAGAGCCAGTTATCCGGCTTCTGTTTTGTCGATTGCTTAGATTTGTTCCTGTTGTCAAA
ACTGTTACCCCCAAAATTGGTGTGACACATGCTCATGCATAAAATGTTAAAATGAGTACATCCTTGTATTTGTATTTGTTTTCAACATCG

>In-frame_LETMD1_ENST00000262055_chr12_51445990_+_LARP4_ENST00000429001_chr12_50847243_+_3453nt
AAAGACAACCTCTTCTCTCCCGCTTCTCTCGCTGTGAAGATGGCGCTCTCCAGGGTGTGCTGGGCTCGGTCGGCTGTGTGGGGCTCGGCA
GTCACCCCTGGACATTTTGTCACCCGGAGGCTGCAACTTGGTCGCTCTGGCCTGGCTTGGGGGGCCCCTCGGTCTTCAAAGCTTCACCTT
TCTCCAAAGGCAGATGTGAAGAACTTGATGTCTTATGTGGTAACCAAGACAAAAGCGATTAATGGGAAATACCATCGTTTCTTGGGTCGT
CATTTCCCCCGCTTCTATGTCCTGTACACAATCTTCATGAAAGGATTGCAGATGTTATGGGCTGATGCCAAAAAGGCTAGAAGAATAAAG
ACAAATATGTGGAAGCACAATATAAAGTTTCATCAACTTCCATACCGGGAGATGGAGCATTTGAGACAGGCAAGGATAAAAGCCATCAAT
ACATTTTTTGCTAAGAATGGTTATCGATTAATGGATTCTAGTATCTATAGTCACCCCATTCAAACTCAAGCACAGTATGCCTCCCCAGTC
TTTATGCAGCCTGTATATAATCCTCACCAACAGTACTCGGTCTATAGTATTGTGCCTCAGTCTTGGTCTCCAAATCCTACACCTTACTTT
GAAACACCACTGGCTCCCTTTCCCAATGGTAGTTTTGTGAATGGCTTTAATTCGCCAGGATCTTATAAAACAAATGCTGCTGCTATGAAT
ATGGGTCGACCATTCCAAAAAAATCGTGTGAAGCCTCAGTTTAGGTCATCTGGTGGTTCAGAACACTCAACAGAGGGCTCTGTATCCTTG
GGGGATGGACAGTTGAACAGATATAGTTCAAGAAACTTTCCAGCTGAACGGCATAACCCCACAGTAACTGGGCATCAGGAGCAAACTTAC
CTTCAGAAGGAGACTTCCACTTTGCAGGTGGAACAGAATGGGGACTATGGTAGGGGCAGGAGAACTCTCTTCAGAGGTCGAAGACGACGA
GAAGATGACAGGATCTCAAGACCTCATCCTTCAACAGCTGAATCAAAGGCTCCAACACCAAAGTTTGACTTATTAGCCTCAAATTTTCCA
CCTTTACCTGGAAGTTCATCAAGAATGCCAGGTGAACTCGTTTTGGAGAATAGGATGTCTGATGTTGTTAAAGGTGTCTACAAAGAAAAG
GATAATGAAGAGTTGACAATTAGTTGCCCAGTGCCTGCAGATGAGCAGACAGAATGCACTTCTGCCCAGCAACTCAATATGAGTACCAGT
TCTCCATGTGCTGCTGAGCTTACTGCATTAAGCACAACTCAGCAAGAAAAGGATCTAATAGAAGATTCCTCTGTTCAGAAGGATGGTCTC
AATCAGACAACTATACCAGTTTCTCCTCCAAGTACTACAAAGCCATCGAGGGCAAGTACTGCTTCACCATGTAATAATAACATAAATGCA
GCTACAGCTGTGGCTCTACAGGAACCCCGAAAGTTAAGTTATGCTGAAGTGTGCCAGAAGCCCCCTAAAGAGCCATCTTCAGTTCTTGTG
CAGCCACTACGGGAACTTCGCTCCAATGTGGTGTCTCCCACCAAAAATGAAGACAATGGAGCTCCTGAGAACTCCGTTGAGAAACCACAT
GAGAAGCCAGAAGCAAGGGCTAGTAAGGATTATTCTGGCTTCCGAGGCAATATAATCCCCAGGGGAGCAGCAGGAAAAATCAGGGAACAG
AGACGCCAGTTTAGCCATAGGGCTATACCTCAGGGAGTGACTCGACGTAATGGCAAAGAGCAATATGTGCCACCCAGATCACCAAAGTAA
AAAACAACAAAACTATTCAAAAACTTCACTCTCTTCCCATTAAACTTGAACTGTGGCTATATTGAACTGTTTTGGAGGGGAGGGGGTAGC
CAGGAAGGAAACAAGAGAAAGTACGTCCATTTCATTATGGATTTTGGAGTTGTGAGTGATAGGATCCCAAAATTCATCTCTAATGTGGTT
TTTAAATGCTGGAGGATTCCAATCAATATAAATATATATATATATATACACACACATATATAAAAAGTATAATTTTTCTATTTTTGTTTT
TGGTTTTAATTTGCAGAGATTTGCTGCCAGGAATCAATTTTGAGGGTTCAGATTTAGCTTGGAAGAAAAAAAAGAAACATACATCCTTCA
GTATAGGAGATGAGGGAATGAGAGAAAATATTTTTTGAAGAAGCATTTCTGTAAAATTAGAAATTACTTTTTTTAATCTATTTAAAGTTT
GGCTTGAAGAATGCCATCTCTGACTATATGGCCTTGTATTGCAAAGCGGATCAGTGGCTGGGGTGCCTGTTGTGGGTGTGAGTGTGTACA
AGAGCGATTGAAGCCAAATCTGTTGTCATGTTAGTAAATGATTTGAAAACTGAATGTAATACTTGAGTAGATTTTTTTTTCTAGTTTGAA
ATTTAGTCTGTCTTTTTGACCTTACTAATATTTCATTTAACAAGTTGTAAAACTCTGATTGTACTTAGAGATGTGACTACCAATCAGTTT
GATACTCAAGGAAAGGGGGTTATTCAAGAAATTGAAAATTTCATCTTGGACCTCAGTGCATAGGTCAAATGGATTTCAGAGGTTTAAACT
TCCCTGTGATTCCCCCGAATACCCCCAAAATGAGAAACAAAATTTTTTTTCTTACTCCATTTGTTACTCTCTGTTCTTTGACTGCCCACC
CACAGAAAAGCAAAATAACCAACTACCTACTCAATTGTGTGTTTGTAATTGCTTTGAGCAGTCTAGTCAAATCATATAAATTGTTCTAAA
TTTCAGAATTGAACATTGAAGTATTAACTCTTCTGTTCACACATTTAGAATTTTAGCTCCCAAGATGGTAGGGCAGACTGACCGTACAGT
AATTTATTTGTCGTTAGTGTTAAAGATTAAGCATAGTAACTGACTCTTAAGTGTTAAATAATGTAGAAGTAAAAAAATTTTTTTTAAAGG
CTTAATTTGGGAGGGGGGACTTATTTCTGTTTACAGTGTATTACCTTCCTTCCCTCCTCTTCTCCCCCCACACCCAACAAAATACAGTTT
GGAATTCACTGAAACAGTACCAGCAAGTCATGAGATTTTTTAGTAAAGATGAGAAAGATGGTTGAAGAAAATTAGTGCATAATTTCTCAG
TGAATAAAGTTGTAGCTCTCATATACTAAATAGACAAGTTTACATGCTGTTATTTAGAAAATGACTAAAATATTAAAAACCGTGTTGTGT
TAATCTGTTTTAAGTCATACCATGTTCAGAGTTCTATGTAAGGTGGGTTTTATTTTTCTTTTAAGGGATAGTTTGTAATAGTAAGAACTG
TCCCATATGTTAGTAAATTACATATGTACAAATTGAAACTGTAAATTGTGAACACTGGAAAGCACCATTGTGACATAGAGTAAACATCTT

>In-frame_LETMD1_ENST00000262055_chr12_51445990_+_LARP4_ENST00000398473_chr12_50847243_+_5940nt
AAAGACAACCTCTTCTCTCCCGCTTCTCTCGCTGTGAAGATGGCGCTCTCCAGGGTGTGCTGGGCTCGGTCGGCTGTGTGGGGCTCGGCA
GTCACCCCTGGACATTTTGTCACCCGGAGGCTGCAACTTGGTCGCTCTGGCCTGGCTTGGGGGGCCCCTCGGTCTTCAAAGCTTCACCTT
TCTCCAAAGGCAGATGTGAAGAACTTGATGTCTTATGTGGTAACCAAGACAAAAGCGATTAATGGGAAATACCATCGTTTCTTGGGTCGT
CATTTCCCCCGCTTCTATGTCCTGTACACAATCTTCATGAAAGGATTGCAGATGTTATGGGCTGATGCCAAAAAGGCTAGAAGAATAAAG
ACAAATATGTGGAAGCACAATATAAAGTTTCATCAACTTCCATACCGGGAGATGGAGCATTTGAGACAGGCAAGGATAAAAGCCATCAAT
ACATTTTTTGCTAAGAATGGTTATCGATTAATGGATTCTAGTATCTATAGTCACCCCATTCAAACTCAAGCACAGTATGCCTCCCCAGTC
TTTATGCAGCCTGTATATAATCCTCACCAACAGTACTCGGTCTATAGTATTGTGCCTCAGTCTTGGTCTCCAAATCCTACACCTTACTTT
GAAACACCACTGGCTCCCTTTCCCAATGGTAGTTTTGTGAATGGCTTTAATTCGCCAGGATCTTATAAAACAAATGCTGCTGCTATGAAT
ATGGGTCGACCATTCCAAAAAAATCGTGTGAAGCCTCAGTTTAGGTCATCTGGTGGTTCAGAACACTCAACAGAGGGCTCTGTATCCTTG
GGGGATGGACAGTTGAACAGATATAGTTCAAGAAACTTTCCAGCTGAACGGCATAACCCCACAGTAACTGGGCATCAGGAGCAAACTTAC
CTTCAGAAGGAGACTTCCACTTTGCAGGTGGAACAGAATGGGGACTATGGTAGGGGCAGGAGAACTCTCTTCAGAGGTCGAAGACGACGA
GAAGATGACAGGATCTCAAGACCTCATCCTTCAACAGCTGAATCAAAGGCTCCAACACCAAAGTTTGACTTATTAGCCTCAAATTTTCCA
CCTTTACCTGGAAGTTCATCAAGAATGCCAGGTGAACTCGTTTTGGAGAATAGGATGTCTGATGTTGTTAAAGGTGTCTACAAAGAAAAG
GATAATGAAGAGTTGACAATTAGTTGCCCAGTGCCTGCAGATGAGCAGACAGAATGCACTTCTGCCCAGCAACTCAATATGAGTACCAGT
TCTCCATGTGCTGCTGAGCTTACTGCATTAAGCACAACTCAGCAAGAAAAGGATCTAATAGAAGATTCCTCTGTTCAGAAGGATGGTCTC
AATCAGACAACTATACCAGTTTCTCCTCCAAGTACTACAAAGCCATCGAGGGCAAGTACTGCTTCACCATGTAATAATAACATAAATGCA
GCTACAGCTGTGGCTCTACAGGAACCCCGAAAGTTAAGTTATGCTGAAGTGTGCCAGAAGCCCCCTAAAGAGCCATCTTCAGTTCTTGTG
CAGCCACTACGGGAACTTCGCTCCAATGTGGTGTCTCCCACCAAAAATGAAGACAATGGAGCTCCTGAGAACTCCGTTGAGAAACCACAT
GAGAAGCCAGAAGCAAGGGCTAGTAAGGATTATTCTGGCTTCCGAGGCAATATAATCCCCAGGGGAGCAGCAGGAAAAATCAGGGAACAG
AGACGCCAGTTTAGCCATAGGGCTATACCTCAGGGAGTGACTCGACGTAATGGCAAAGAGCAATATGTGCCACCCAGATCACCAAAGTAA
AAAACAACAAAACTATTCAAAAACTTCACTCTCTTCCCATTAAACTTGAACTGTGGCTATATTGAACTGTTTTGGAGGGGAGGGGGTAGC
CAGGAAGGAAACAAGAGAAAGTACGTCCATTTCATTATGGATTTTGGAGTTGTGAGTGATAGGATCCCAAAATTCATCTCTAATGTGGTT
TTTAAATGCTGGAGGATTCCAATCAATATAAATATATATATATATATACACACACATATATAAAAAGTATAATTTTTCTATTTTTGTTTT
TGGTTTTAATTTGCAGAGATTTGCTGCCAGGAATCAATTTTGAGGGTTCAGATTTAGCTTGGAAGAAAAAAAAGAAACATACATCCTTCA
GTATAGGAGATGAGGGAATGAGAGAAAATATTTTTTGAAGAAGCATTTCTGTAAAATTAGAAATTACTTTTTTTAATCTATTTAAAGTTT
GGCTTGAAGAATGCCATCTCTGACTATATGGCCTTGTATTGCAAAGCGGATCAGTGGCTGGGGTGCCTGTTGTGGGTGTGAGTGTGTACA
AGAGCGATTGAAGCCAAATCTGTTGTCATGTTAGTAAATGATTTGAAAACTGAATGTAATACTTGAGTAGATTTTTTTTTCTAGTTTGAA
ATTTAGTCTGTCTTTTTGACCTTACTAATATTTCATTTAACAAGTTGTAAAACTCTGATTGTACTTAGAGATGTGACTACCAATCAGTTT
GATACTCAAGGAAAGGGGGTTATTCAAGAAATTGAAAATTTCATCTTGGACCTCAGTGCATAGGTCAAATGGATTTCAGAGGTTTAAACT
TCCCTGTGATTCCCCCGAATACCCCCAAAATGAGAAACAAAATTTTTTTTCTTACTCCATTTGTTACTCTCTGTTCTTTGACTGCCCACC
CACAGAAAAGCAAAATAACCAACTACCTACTCAATTGTGTGTTTGTAATTGCTTTGAGCAGTCTAGTCAAATCATATAAATTGTTCTAAA
TTTCAGAATTGAACATTGAAGTATTAACTCTTCTGTTCACACATTTAGAATTTTAGCTCCCAAGATGGTAGGGCAGACTGACCGTACAGT
AATTTATTTGTCGTTAGTGTTAAAGATTAAGCATAGTAACTGACTCTTAAGTGTTAAATAATGTAGAAGTAAAAAAATTTTTTTTAAAGG
CTTAATTTGGGAGGGGGGACTTATTTCTGTTTACAGTGTATTACCTTCCTTCCCTCCTCTTCTCCCCCCACACCCAACAAAATACAGTTT
GGAATTCACTGAAACAGTACCAGCAAGTCATGAGATTTTTTAGTAAAGATGAGAAAGATGGTTGAAGAAAATTAGTGCATAATTTCTCAG
TGAATAAAGTTGTAGCTCTCATATACTAAATAGACAAGTTTACATGCTGTTATTTAGAAAATGACTAAAATATTAAAAACCGTGTTGTGT
TAATCTGTTTTAAGTCATACCATGTTCAGAGTTCTATGTAAGGTGGGTTTTATTTTTCTTTTAAGGGATAGTTTGTAATAGTAAGAACTG
TCCCATATGTTAGTAAATTACATATGTACAAATTGAAACTGTAAATTGTGAACACTGGAAAGCACCATTGTGACATAGAGTAAACATCTT
AGTAATATATTAAAGTGAATGTAAATGGTGGTTAAAATTACATTACTGTGAAATTCATCTTCCAACTCTAAGTTAAGCTTTGGAGATACA
TGTTAGTGGTTAACTGTTAAGAGCTTTGAAAACACTGCACATATCTGTACAAGCCAGAATTACTATTTCTTTGACTTATTATTAGCTTGG
CAGTTGCTTTTGATTTGATTGTTTTATGACATGGTATACTACTATATTTACTCAGTTTGAAACTATTCATTTCTACACACTATTTTTAAA
AATTGCCTACTAGGTGAAACATAACAATAAAACTACCTGTGCTGAAATTTGGGGGAAGTTTAGGTCCTTTAAAAAAACATATTAATCATT
GACTACATCTATGATAAAAGTGCTTATTTTGGTTTACTAAGATAATGCAGTTGGTGGAAATGATAAACGTTTTAAGTGTTAACATCCTTT
GAATGCGTTGGATTTCAGAGAATAAACATTTTGTAAAAATCACTTGGTAAGGATTATAAACTTAATTACTGCACTTAAAATGAAACATTA
CTTTTTTTAAACAATGTGTCACAAATGTAGGTCTGTATTACTTGTATGCTTGTGTGACTTACTGTTAGTCCAGCTCTAAAAATTTAAAGG
TTGTAATTGAAATACAAGAAAAGAGCCTTCTTTTAGAAGAAAGCAAGTATATTTTTGCTTTTACTTCAAATGTTATTTAAAGTAGAAATT
TAATTTGTAGATATAACCTTTAAAAATTTTCTCATTAAGACAATGTTTTTAATTTAATTTGCCTCATTACATCTAATAGTTCCCATTTGA
TGGCATGTATAGGGAAGAGTGAGAGAGTGTGTGTGTGTGTATGTGTGTGTAATATTTATATATATTCACAGTATGTATTTAGCATTTATT
TTATTACAGCAGATTTAAAGTTTGTATCTAAATAATGCCTATGAGTTGTGTGAAGCTCTTGGCTTTTTTCCAACGTTACTTTGTAACTAA
TGAGGGTGGATGTTCATTGTAGTTTATTTATTTGGTTCTTTAGATGGAGGAATTTAAAAAATCAAATTTTTCTCTTCACCTTTATGACTT
GACATTTCCTTGATCTGTTGGAGGCTAAAAGTAGGTATAAATGATATTGAATGTTGGGTATAGTGATACTCTGCCATAGTTCTTACTGCA
TGAAGAGAACAAGAGTCACACAAGTTCACCACTTTGCACTTCATAGAGAAGGTACATAGAGACATTGCAAAACCTGTCTCCATTTGCTAT
CCTGATAATTAAGGTTTTCATAATACCTAGGGCCTGTCTCTGAGTAATTTTAATTTTGCCAAATACACTGACATTTAAAATAGTGATCCA
TCTAAATTTTTTTCAGCTGGGTTTTGAGGAATATAAGAGCTTTCAATGATAAAGGTTTGTTGTAGTTGTCTTATGTGCTGAATTTGCAGA
TGATCAGATGCTGTGCAGAATTCTGATTTATTTTTGTTTCCTAAAATTAAGATAGCTTGAATATTATTTCACATTCCTTTTTCTTTTTTA
AATAAACAGGTTTGCTTTGGAAAGGCTTAATGATGGAATGTTAGCATCTTCACTAGGGTAAAGAAGAACAAAAAGAATGTTGCTGGAACG
TAAAATAGTATTTAAAAGTTAATGAACACTTCTCTAGTTTTCTTAGTTATGGCCTTAATAATTAGTCTCTTGGCTTAAATGTCCACTGGT
TTTACTTTGACACAGTTGAACAACACTGGGGTTAAGTCTCTGGTATTTAGGCTGGCAATATATATATTAACCATATTTTAAAAGTACCAA
TTTTGTTTTTACAGAAAAGATAAAACTCAAAAGAGAACAGTGTATTCCTTCTGAGGGGCTTTTATAAATTATTAACTATAATATATGATG
GATTTTTTCCTAATTTTTTATATTTCCTTACAATTTTGGTGGCCATTAATTTAACTTTAGGCTTTTGGGCATATGCTAGTCTGAGCTTCC
GAAAAGATACATATATGTTTCCCTTTTCATTAGCTGAATGAGGATATTTTAAGAAGTTGAAAGAGAATTTATTTTCAAGTTGTGAGTAAA
TCCTCCTTTGAAATTCACCTGATTATTAGATAACTTAAAGTTTATTTTTAAAAGCTGACAACTTTTTATGAATCTTCGAGTTGACAGTTC
CTAAAAGCGTAACTCAGATATTAATGGGCTGTGTATTAAATGGTTTTATTTTCAGTTTTGCAGCACAGAACACTGTTGAAATATCCATAT
CAACTTGATTTTTTTAACCTAATTCAGGTGTCCTTTGCATCTCTTAAATGTTGGGGGTGGGGGTCAGAGCCAGTTATCCGGCTTCTGTTT
TGTCGATTGCTTAGATTTGTTCCTGTTGTCAAAACTGTTACCCCCAAAATTGGTGTGACACATGCTCATGCATAAAATGTTAAAATGAGT
ACATCCTTGTATTTGTATTTGTTTTCAACATCGCCAAGGTGCTATGGGAAATTAACAAAATTAGAAAAAAAATAAAATTATTAAAAAGCA

>In-frame_LETMD1_ENST00000262055_chr12_51445990_+_LARP4_ENST00000518444_chr12_50847243_+_2399nt
AAAGACAACCTCTTCTCTCCCGCTTCTCTCGCTGTGAAGATGGCGCTCTCCAGGGTGTGCTGGGCTCGGTCGGCTGTGTGGGGCTCGGCA
GTCACCCCTGGACATTTTGTCACCCGGAGGCTGCAACTTGGTCGCTCTGGCCTGGCTTGGGGGGCCCCTCGGTCTTCAAAGCTTCACCTT
TCTCCAAAGGCAGATGTGAAGAACTTGATGTCTTATGTGGTAACCAAGACAAAAGCGATTAATGGGAAATACCATCGTTTCTTGGGTCGT
CATTTCCCCCGCTTCTATGTCCTGTACACAATCTTCATGAAAGGATTGCAGATGTTATGGGCTGATGCCAAAAAGGCTAGAAGAATAAAG
ACAAATATGTGGAAGCACAATATAAAGTTTCATCAACTTCCATACCGGGAGATGGAGCATTTGAGACAGGCAAGGATAAAAGCCATCAAT
ACATTTTTTGCTAAGAATGGTTATCGATTAATGGATTCTAGTATCTATAGTCACCCCATTCAAACTCAAGCACAGTATGCCTCCCCAGTC
TTTATGCAGCCTGTATATAATCCTCACCAACAGTACTCGGTCTATAGTATTGTGCCTCAGTCTTGGTCTCCAAATCCTACACCTTACTTT
GAAACACCACTGGCTCCCTTTCCCAATGGTAGTTTTGTGAATGGCTTTAATTCGCCAGGATCTTATAAAACAAATGCTGCTGCTATGAAT
ATGGGTCGACCATTCCAAAAAAATCGTGTGAAGCCTCAGTTTAGGTCATCTGGTGGTTCAGAACACTCAACAGAGGGCTCTGTATCCTTG
GGGGATGGACAGTTGAACAGATATAGTTCAAGAAACTTTCCAGCTGAACGGCATAACCCCACAGTAACTGGGCATCAGGAGCAAACTTAC
CTTCAGAAGGAGACTTCCACTTTGCAGGTGGAACAGAATGGGGACTATGGTAGGGGCAGGAGAACTCTCTTCAGAGGTCGAAGACGACGA
GAAGATGACAGGATCTCAAGACCTCATCCTTCAACAGCTGAATCAAAGGCTCCAACACCAAAGTTTGACTTATTAGCCTCAAATTTTCCA
CCTTTACCTGGAAGTTCATCAAGAATGCCAGGTGAACTCGTTTTGGAGAATAGGATGTCTGATGTTGTTAAAGGTGTCTACAAAGAAAAG
GATAATGAAGAGTTGACAATTAGTTGCCCAGTGCCTGCAGATGAGCAGACAGAATGCACTTCTGCCCAGCAACTCAATATGAGTACCAGT
TCTCCATGTGCTGCTGAGCTTACTGCATTAAGCACAACTCAGCAAGAAAAGGATCTAATAGAAGATTCCTCTGTTCAGAAGGATGGTCTC
AATCAGACAACTATACCAGTTTCTCCTCCAAGTACTACAAAGCCATCGAGGGCAAGTACTGCTTCACCATGTAATAATAACATAAATGCA
GCTACAGCTGTGGCTCTACAGGAACCCCGAAAGTTAAGTTATGCTGAAGTGTGCCAGAAGCCCCCTAAAGAGCCATCTTCAGTTCTTGTG
CAGCCACTACGGGAACTTCGCTCCAATGTGGTGTCTCCCACCAAAAATGAAGACAATGGAGCTCCTGAGAACTCCGTTGAGAAACCACAT
GAGAAGCCAGAAGCAAGGGCTAGTAAGGATTATTCTGGCTTCCGAGGCAATATAATCCCCAGGGGAGCAGCAGGAAAAATCAGGGAACAG
AGACGCCAGTTTAGCCATAGGGCTATACCTCAGGGAGTGACTCGACGTAATGGCAAAGAGCAATATGTGCCACCCAGATCACCAAAGTAA
AAAACAACAAAACTATTCAAAAACTTCACTCTCTTCCCATTAAACTTGAACTGTGGCTATATTGAACTGTTTTGGAGGGGAGGGGGTAGC
CAGGAAGGAAACAAGAGAAAGTACGTCCATTTCATTATGGATTTTGGAGTTGTGAGTGATAGGATCCCAAAATTCATCTCTAATGTGGTT
TTTAAATGCTGGAGGATTCCAATCAATATAAATATATATATATATATACACACACATATATAAAAAGTATAATTTTTCTATTTTTGTTTT
TGGTTTTAATTTGCAGAGATTTGCTGCCAGGAATCAATTTTGAGGGTTCAGATTTAGCTTGGAAGAAAAAAAAGAAACATACATCCTTCA
GTATAGGAGATGAGGGAATGAGAGAAAATATTTTTTGAAGAAGCATTTCTGTAAAATTAGAAATTACTTTTTTTAATCTATTTAAAGTTT
GGCTTGAAGAATGCCATCTCTGACTATATGGCCTTGTATTGCAAAGCGGATCAGTGGCTGGGGTGCCTGTTGTGGGTGTGAGTGTGTACA

>In-frame_LETMD1_ENST00000418425_chr12_51445990_+_LARP4_ENST00000293618_chr12_50847243_+_5758nt
AAAGACAACCTCTTCTCTCCCGCTTCTCTCGCTGTGAAGATGGCGCTCTCCAGGGTGTGCTGGGCTCGGTCGGCTGTGTGGGGCTCGGCA
GTCACCCCTGGACATTTTGTCACCCGGAGGCTGCAACTTGGTCGCTCTGGCCTGGCTTGGGGGGCCCCTCGGTCTTCAAAGCTTCACCTT
TCTCCAAAGGCAGATGTGAAGAACTTGATGTCTTATGTGGTAACCAAGACAAAAGCGATTAATGGGAAATACCATCGTTTCTTGGGTCGT
CATTTCCCCCGCTTCTATGTCCTGTACACAATCTTCATGAAAGGATTGCAGATGTTATGGGCTGATGCCAAAAAGGCTAGAAGAATAAAG
ACAAATATGTGGAAGCACAATATAAAGTTTCATCAACTTCCATACCGGGAGATGGAGCATTTGAGACAGGTATGGGCCAGGGGCAGATAT
CCAGAAGTTCATGGTGAGGCAAGGATAAAAGCCATCAATACATTTTTTGCTAAGAATGGTTATCGATTAATGGATTCTAGTATCTATAGT
CACCCCATTCAAACTCAAGCACAGTATGCCTCCCCAGTCTTTATGCAGCCTGTATATAATCCTCACCAACAGTACTCGGTCTATAGTATT
GTGCCTCAGTCTTGGTCTCCAAATCCTACACCTTACTTTGAAACACCACTGGCTCCCTTTCCCAATGGTAGTTTTGTGAATGGCTTTAAT
TCGCCAGGATCTTATAAAACAAATGCTGCTGCTATGAATATGGGTCGACCATTCCAAAAAAATCGGAGAACTCTCTTCAGAGGTCGAAGA
CGACGAGAAGATGACAGGATCTCAAGACCTCATCCTTCAACAGCTGAATCAAAGGCTCCAACACCAAAGTTTGACTTATTAGCCTCAAAT
TTTCCACCTTTACCTGGAAGTTCATCAAGAATGCCAGGTGAACTCGTTTTGGAGAATAGGATGTCTGATGTTGTTAAAGGTGTCTACAAA
GAAAAGGATAATGAAGAGTTGACAATTAGTTGCCCAGTGCCTGCAGATGAGCAGACAGAATGCACTTCTGCCCAGCAACTCAATATGAGT
ACCAGTTCTCCATGTGCTGCTGAGCTTACTGCATTAAGCACAACTCAGCAAGAAAAGGATCTAATAGAAGATTCCTCTGTTCAGAAGGAT
GGTCTCAATCAGACAACTATACCAGTTTCTCCTCCAAGTACTACAAAGCCATCGAGGGCAAGTACTGCTTCACCATGTAATAATAACATA
AATGCAGCTACAGCTGTGGCTCTACAGGAACCCCGAAAGTTAAGTTATGCTGAAGTGTGCCAGAAGCCCCCTAAAGAGCCATCTTCAGTT
CTTGTGCAGCCACTACGGGAACTTCGCTCCAATGTGGTGTCTCCCACCAAAAATGAAGACAATGGAGCTCCTGAGAACTCCGTTGAGAAA
CCACATGAGAAGCCAGAAGCAAGGGCTAGTAAGGATTATTCTGGCTTCCGAGGCAATATAATCCCCAGGGGAGCAGCAGGAAAAATCAGG
GAACAGAGACGCCAGTTTAGCCATAGGGCTATACCTCAGGGAGTGACTCGACGTAATGGCAAAGAGCAATATGTGCCACCCAGATCACCA
AAGTAAAAAACAACAAAACTATTCAAAAACTTCACTCTCTTCCCATTAAACTTGAACTGTGGCTATATTGAACTGTTTTGGAGGGGAGGG
GGTAGCCAGGAAGGAAACAAGAGAAAGTACGTCCATTTCATTATGGATTTTGGAGTTGTGAGTGATAGGATCCCAAAATTCATCTCTAAT
GTGGTTTTTAAATGCTGGAGGATTCCAATCAATATAAATATATATATATATATACACACACATATATAAAAAGTATAATTTTTCTATTTT
TGTTTTTGGTTTTAATTTGCAGAGATTTGCTGCCAGGAATCAATTTTGAGGGTTCAGATTTAGCTTGGAAGAAAAAAAAGAAACATACAT
CCTTCAGTATAGGAGATGAGGGAATGAGAGAAAATATTTTTTGAAGAAGCATTTCTGTAAAATTAGAAATTACTTTTTTTAATCTATTTA
AAGTTTGGCTTGAAGAATGCCATCTCTGACTATATGGCCTTGTATTGCAAAGCGGATCAGTGGCTGGGGTGCCTGTTGTGGGTGTGAGTG
TGTACAAGAGCGATTGAAGCCAAATCTGTTGTCATGTTAGTAAATGATTTGAAAACTGAATGTAATACTTGAGTAGATTTTTTTTTCTAG
TTTGAAATTTAGTCTGTCTTTTTGACCTTACTAATATTTCATTTAACAAGTTGTAAAACTCTGATTGTACTTAGAGATGTGACTACCAAT
CAGTTTGATACTCAAGGAAAGGGGGTTATTCAAGAAATTGAAAATTTCATCTTGGACCTCAGTGCATAGGTCAAATGGATTTCAGAGGTT
TAAACTTCCCTGTGATTCCCCCGAATACCCCCAAAATGAGAAACAAAATTTTTTTTCTTACTCCATTTGTTACTCTCTGTTCTTTGACTG
CCCACCCACAGAAAAGCAAAATAACCAACTACCTACTCAATTGTGTGTTTGTAATTGCTTTGAGCAGTCTAGTCAAATCATATAAATTGT
TCTAAATTTCAGAATTGAACATTGAAGTATTAACTCTTCTGTTCACACATTTAGAATTTTAGCTCCCAAGATGGTAGGGCAGACTGACCG
TACAGTAATTTATTTGTCGTTAGTGTTAAAGATTAAGCATAGTAACTGACTCTTAAGTGTTAAATAATGTAGAAGTAAAAAAATTTTTTT
TAAAGGCTTAATTTGGGAGGGGGGACTTATTTCTGTTTACAGTGTATTACCTTCCTTCCCTCCTCTTCTCCCCCCACACCCAACAAAATA
CAGTTTGGAATTCACTGAAACAGTACCAGCAAGTCATGAGATTTTTTAGTAAAGATGAGAAAGATGGTTGAAGAAAATTAGTGCATAATT
TCTCAGTGAATAAAGTTGTAGCTCTCATATACTAAATAGACAAGTTTACATGCTGTTATTTAGAAAATGACTAAAATATTAAAAACCGTG
TTGTGTTAATCTGTTTTAAGTCATACCATGTTCAGAGTTCTATGTAAGGTGGGTTTTATTTTTCTTTTAAGGGATAGTTTGTAATAGTAA
GAACTGTCCCATATGTTAGTAAATTACATATGTACAAATTGAAACTGTAAATTGTGAACACTGGAAAGCACCATTGTGACATAGAGTAAA
CATCTTAGTAATATATTAAAGTGAATGTAAATGGTGGTTAAAATTACATTACTGTGAAATTCATCTTCCAACTCTAAGTTAAGCTTTGGA
GATACATGTTAGTGGTTAACTGTTAAGAGCTTTGAAAACACTGCACATATCTGTACAAGCCAGAATTACTATTTCTTTGACTTATTATTA
GCTTGGCAGTTGCTTTTGATTTGATTGTTTTATGACATGGTATACTACTATATTTACTCAGTTTGAAACTATTCATTTCTACACACTATT
TTTAAAAATTGCCTACTAGGTGAAACATAACAATAAAACTACCTGTGCTGAAATTTGGGGGAAGTTTAGGTCCTTTAAAAAAACATATTA
ATCATTGACTACATCTATGATAAAAGTGCTTATTTTGGTTTACTAAGATAATGCAGTTGGTGGAAATGATAAACGTTTTAAGTGTTAACA
TCCTTTGAATGCGTTGGATTTCAGAGAATAAACATTTTGTAAAAATCACTTGGTAAGGATTATAAACTTAATTACTGCACTTAAAATGAA
ACATTACTTTTTTTAAACAATGTGTCACAAATGTAGGTCTGTATTACTTGTATGCTTGTGTGACTTACTGTTAGTCCAGCTCTAAAAATT
TAAAGGTTGTAATTGAAATACAAGAAAAGAGCCTTCTTTTAGAAGAAAGCAAGTATATTTTTGCTTTTACTTCAAATGTTATTTAAAGTA
GAAATTTAATTTGTAGATATAACCTTTAAAAATTTTCTCATTAAGACAATGTTTTTAATTTAATTTGCCTCATTACATCTAATAGTTCCC
ATTTGATGGCATGTATAGGGAAGAGTGAGAGAGTGTGTGTGTGTGTATGTGTGTGTAATATTTATATATATTCACAGTATGTATTTAGCA
TTTATTTTATTACAGCAGATTTAAAGTTTGTATCTAAATAATGCCTATGAGTTGTGTGAAGCTCTTGGCTTTTTTCCAACGTTACTTTGT
AACTAATGAGGGTGGATGTTCATTGTAGTTTATTTATTTGGTTCTTTAGATGGAGGAATTTAAAAAATCAAATTTTTCTCTTCACCTTTA
TGACTTGACATTTCCTTGATCTGTTGGAGGCTAAAAGTAGGTATAAATGATATTGAATGTTGGGTATAGTGATACTCTGCCATAGTTCTT
ACTGCATGAAGAGAACAAGAGTCACACAAGTTCACCACTTTGCACTTCATAGAGAAGGTACATAGAGACATTGCAAAACCTGTCTCCATT
TGCTATCCTGATAATTAAGGTTTTCATAATACCTAGGGCCTGTCTCTGAGTAATTTTAATTTTGCCAAATACACTGACATTTAAAATAGT
GATCCATCTAAATTTTTTTCAGCTGGGTTTTGAGGAATATAAGAGCTTTCAATGATAAAGGTTTGTTGTAGTTGTCTTATGTGCTGAATT
TGCAGATGATCAGATGCTGTGCAGAATTCTGATTTATTTTTGTTTCCTAAAATTAAGATAGCTTGAATATTATTTCACATTCCTTTTTCT
TTTTTAAATAAACAGGTTTGCTTTGGAAAGGCTTAATGATGGAATGTTAGCATCTTCACTAGGGTAAAGAAGAACAAAAAGAATGTTGCT
GGAACGTAAAATAGTATTTAAAAGTTAATGAACACTTCTCTAGTTTTCTTAGTTATGGCCTTAATAATTAGTCTCTTGGCTTAAATGTCC
ACTGGTTTTACTTTGACACAGTTGAACAACACTGGGGTTAAGTCTCTGGTATTTAGGCTGGCAATATATATATTAACCATATTTTAAAAG
TACCAATTTTGTTTTTACAGAAAAGATAAAACTCAAAAGAGAACAGTGTATTCCTTCTGAGGGGCTTTTATAAATTATTAACTATAATAT
ATGATGGATTTTTTCCTAATTTTTTATATTTCCTTACAATTTTGGTGGCCATTAATTTAACTTTAGGCTTTTGGGCATATGCTAGTCTGA
GCTTCCGAAAAGATACATATATGTTTCCCTTTTCATTAGCTGAATGAGGATATTTTAAGAAGTTGAAAGAGAATTTATTTTCAAGTTGTG
AGTAAATCCTCCTTTGAAATTCACCTGATTATTAGATAACTTAAAGTTTATTTTTAAAAGCTGACAACTTTTTATGAATCTTCGAGTTGA
CAGTTCCTAAAAGCGTAACTCAGATATTAATGGGCTGTGTATTAAATGGTTTTATTTTCAGTTTTGCAGCACAGAACACTGTTGAAATAT
CCATATCAACTTGATTTTTTTAACCTAATTCAGGTGTCCTTTGCATCTCTTAAATGTTGGGGGTGGGGGTCAGAGCCAGTTATCCGGCTT
CTGTTTTGTCGATTGCTTAGATTTGTTCCTGTTGTCAAAACTGTTACCCCCAAAATTGGTGTGACACATGCTCATGCATAAAATGTTAAA

>In-frame_LETMD1_ENST00000418425_chr12_51445990_+_LARP4_ENST00000429001_chr12_50847243_+_3492nt
AAAGACAACCTCTTCTCTCCCGCTTCTCTCGCTGTGAAGATGGCGCTCTCCAGGGTGTGCTGGGCTCGGTCGGCTGTGTGGGGCTCGGCA
GTCACCCCTGGACATTTTGTCACCCGGAGGCTGCAACTTGGTCGCTCTGGCCTGGCTTGGGGGGCCCCTCGGTCTTCAAAGCTTCACCTT
TCTCCAAAGGCAGATGTGAAGAACTTGATGTCTTATGTGGTAACCAAGACAAAAGCGATTAATGGGAAATACCATCGTTTCTTGGGTCGT
CATTTCCCCCGCTTCTATGTCCTGTACACAATCTTCATGAAAGGATTGCAGATGTTATGGGCTGATGCCAAAAAGGCTAGAAGAATAAAG
ACAAATATGTGGAAGCACAATATAAAGTTTCATCAACTTCCATACCGGGAGATGGAGCATTTGAGACAGGTATGGGCCAGGGGCAGATAT
CCAGAAGTTCATGGTGAGGCAAGGATAAAAGCCATCAATACATTTTTTGCTAAGAATGGTTATCGATTAATGGATTCTAGTATCTATAGT
CACCCCATTCAAACTCAAGCACAGTATGCCTCCCCAGTCTTTATGCAGCCTGTATATAATCCTCACCAACAGTACTCGGTCTATAGTATT
GTGCCTCAGTCTTGGTCTCCAAATCCTACACCTTACTTTGAAACACCACTGGCTCCCTTTCCCAATGGTAGTTTTGTGAATGGCTTTAAT
TCGCCAGGATCTTATAAAACAAATGCTGCTGCTATGAATATGGGTCGACCATTCCAAAAAAATCGTGTGAAGCCTCAGTTTAGGTCATCT
GGTGGTTCAGAACACTCAACAGAGGGCTCTGTATCCTTGGGGGATGGACAGTTGAACAGATATAGTTCAAGAAACTTTCCAGCTGAACGG
CATAACCCCACAGTAACTGGGCATCAGGAGCAAACTTACCTTCAGAAGGAGACTTCCACTTTGCAGGTGGAACAGAATGGGGACTATGGT
AGGGGCAGGAGAACTCTCTTCAGAGGTCGAAGACGACGAGAAGATGACAGGATCTCAAGACCTCATCCTTCAACAGCTGAATCAAAGGCT
CCAACACCAAAGTTTGACTTATTAGCCTCAAATTTTCCACCTTTACCTGGAAGTTCATCAAGAATGCCAGGTGAACTCGTTTTGGAGAAT
AGGATGTCTGATGTTGTTAAAGGTGTCTACAAAGAAAAGGATAATGAAGAGTTGACAATTAGTTGCCCAGTGCCTGCAGATGAGCAGACA
GAATGCACTTCTGCCCAGCAACTCAATATGAGTACCAGTTCTCCATGTGCTGCTGAGCTTACTGCATTAAGCACAACTCAGCAAGAAAAG
GATCTAATAGAAGATTCCTCTGTTCAGAAGGATGGTCTCAATCAGACAACTATACCAGTTTCTCCTCCAAGTACTACAAAGCCATCGAGG
GCAAGTACTGCTTCACCATGTAATAATAACATAAATGCAGCTACAGCTGTGGCTCTACAGGAACCCCGAAAGTTAAGTTATGCTGAAGTG
TGCCAGAAGCCCCCTAAAGAGCCATCTTCAGTTCTTGTGCAGCCACTACGGGAACTTCGCTCCAATGTGGTGTCTCCCACCAAAAATGAA
GACAATGGAGCTCCTGAGAACTCCGTTGAGAAACCACATGAGAAGCCAGAAGCAAGGGCTAGTAAGGATTATTCTGGCTTCCGAGGCAAT
ATAATCCCCAGGGGAGCAGCAGGAAAAATCAGGGAACAGAGACGCCAGTTTAGCCATAGGGCTATACCTCAGGGAGTGACTCGACGTAAT
GGCAAAGAGCAATATGTGCCACCCAGATCACCAAAGTAAAAAACAACAAAACTATTCAAAAACTTCACTCTCTTCCCATTAAACTTGAAC
TGTGGCTATATTGAACTGTTTTGGAGGGGAGGGGGTAGCCAGGAAGGAAACAAGAGAAAGTACGTCCATTTCATTATGGATTTTGGAGTT
GTGAGTGATAGGATCCCAAAATTCATCTCTAATGTGGTTTTTAAATGCTGGAGGATTCCAATCAATATAAATATATATATATATATACAC
ACACATATATAAAAAGTATAATTTTTCTATTTTTGTTTTTGGTTTTAATTTGCAGAGATTTGCTGCCAGGAATCAATTTTGAGGGTTCAG
ATTTAGCTTGGAAGAAAAAAAAGAAACATACATCCTTCAGTATAGGAGATGAGGGAATGAGAGAAAATATTTTTTGAAGAAGCATTTCTG
TAAAATTAGAAATTACTTTTTTTAATCTATTTAAAGTTTGGCTTGAAGAATGCCATCTCTGACTATATGGCCTTGTATTGCAAAGCGGAT
CAGTGGCTGGGGTGCCTGTTGTGGGTGTGAGTGTGTACAAGAGCGATTGAAGCCAAATCTGTTGTCATGTTAGTAAATGATTTGAAAACT
GAATGTAATACTTGAGTAGATTTTTTTTTCTAGTTTGAAATTTAGTCTGTCTTTTTGACCTTACTAATATTTCATTTAACAAGTTGTAAA
ACTCTGATTGTACTTAGAGATGTGACTACCAATCAGTTTGATACTCAAGGAAAGGGGGTTATTCAAGAAATTGAAAATTTCATCTTGGAC
CTCAGTGCATAGGTCAAATGGATTTCAGAGGTTTAAACTTCCCTGTGATTCCCCCGAATACCCCCAAAATGAGAAACAAAATTTTTTTTC
TTACTCCATTTGTTACTCTCTGTTCTTTGACTGCCCACCCACAGAAAAGCAAAATAACCAACTACCTACTCAATTGTGTGTTTGTAATTG
CTTTGAGCAGTCTAGTCAAATCATATAAATTGTTCTAAATTTCAGAATTGAACATTGAAGTATTAACTCTTCTGTTCACACATTTAGAAT
TTTAGCTCCCAAGATGGTAGGGCAGACTGACCGTACAGTAATTTATTTGTCGTTAGTGTTAAAGATTAAGCATAGTAACTGACTCTTAAG
TGTTAAATAATGTAGAAGTAAAAAAATTTTTTTTAAAGGCTTAATTTGGGAGGGGGGACTTATTTCTGTTTACAGTGTATTACCTTCCTT
CCCTCCTCTTCTCCCCCCACACCCAACAAAATACAGTTTGGAATTCACTGAAACAGTACCAGCAAGTCATGAGATTTTTTAGTAAAGATG
AGAAAGATGGTTGAAGAAAATTAGTGCATAATTTCTCAGTGAATAAAGTTGTAGCTCTCATATACTAAATAGACAAGTTTACATGCTGTT
ATTTAGAAAATGACTAAAATATTAAAAACCGTGTTGTGTTAATCTGTTTTAAGTCATACCATGTTCAGAGTTCTATGTAAGGTGGGTTTT
ATTTTTCTTTTAAGGGATAGTTTGTAATAGTAAGAACTGTCCCATATGTTAGTAAATTACATATGTACAAATTGAAACTGTAAATTGTGA

>In-frame_LETMD1_ENST00000418425_chr12_51445990_+_LARP4_ENST00000398473_chr12_50847243_+_5979nt
AAAGACAACCTCTTCTCTCCCGCTTCTCTCGCTGTGAAGATGGCGCTCTCCAGGGTGTGCTGGGCTCGGTCGGCTGTGTGGGGCTCGGCA
GTCACCCCTGGACATTTTGTCACCCGGAGGCTGCAACTTGGTCGCTCTGGCCTGGCTTGGGGGGCCCCTCGGTCTTCAAAGCTTCACCTT
TCTCCAAAGGCAGATGTGAAGAACTTGATGTCTTATGTGGTAACCAAGACAAAAGCGATTAATGGGAAATACCATCGTTTCTTGGGTCGT
CATTTCCCCCGCTTCTATGTCCTGTACACAATCTTCATGAAAGGATTGCAGATGTTATGGGCTGATGCCAAAAAGGCTAGAAGAATAAAG
ACAAATATGTGGAAGCACAATATAAAGTTTCATCAACTTCCATACCGGGAGATGGAGCATTTGAGACAGGTATGGGCCAGGGGCAGATAT
CCAGAAGTTCATGGTGAGGCAAGGATAAAAGCCATCAATACATTTTTTGCTAAGAATGGTTATCGATTAATGGATTCTAGTATCTATAGT
CACCCCATTCAAACTCAAGCACAGTATGCCTCCCCAGTCTTTATGCAGCCTGTATATAATCCTCACCAACAGTACTCGGTCTATAGTATT
GTGCCTCAGTCTTGGTCTCCAAATCCTACACCTTACTTTGAAACACCACTGGCTCCCTTTCCCAATGGTAGTTTTGTGAATGGCTTTAAT
TCGCCAGGATCTTATAAAACAAATGCTGCTGCTATGAATATGGGTCGACCATTCCAAAAAAATCGTGTGAAGCCTCAGTTTAGGTCATCT
GGTGGTTCAGAACACTCAACAGAGGGCTCTGTATCCTTGGGGGATGGACAGTTGAACAGATATAGTTCAAGAAACTTTCCAGCTGAACGG
CATAACCCCACAGTAACTGGGCATCAGGAGCAAACTTACCTTCAGAAGGAGACTTCCACTTTGCAGGTGGAACAGAATGGGGACTATGGT
AGGGGCAGGAGAACTCTCTTCAGAGGTCGAAGACGACGAGAAGATGACAGGATCTCAAGACCTCATCCTTCAACAGCTGAATCAAAGGCT
CCAACACCAAAGTTTGACTTATTAGCCTCAAATTTTCCACCTTTACCTGGAAGTTCATCAAGAATGCCAGGTGAACTCGTTTTGGAGAAT
AGGATGTCTGATGTTGTTAAAGGTGTCTACAAAGAAAAGGATAATGAAGAGTTGACAATTAGTTGCCCAGTGCCTGCAGATGAGCAGACA
GAATGCACTTCTGCCCAGCAACTCAATATGAGTACCAGTTCTCCATGTGCTGCTGAGCTTACTGCATTAAGCACAACTCAGCAAGAAAAG
GATCTAATAGAAGATTCCTCTGTTCAGAAGGATGGTCTCAATCAGACAACTATACCAGTTTCTCCTCCAAGTACTACAAAGCCATCGAGG
GCAAGTACTGCTTCACCATGTAATAATAACATAAATGCAGCTACAGCTGTGGCTCTACAGGAACCCCGAAAGTTAAGTTATGCTGAAGTG
TGCCAGAAGCCCCCTAAAGAGCCATCTTCAGTTCTTGTGCAGCCACTACGGGAACTTCGCTCCAATGTGGTGTCTCCCACCAAAAATGAA
GACAATGGAGCTCCTGAGAACTCCGTTGAGAAACCACATGAGAAGCCAGAAGCAAGGGCTAGTAAGGATTATTCTGGCTTCCGAGGCAAT
ATAATCCCCAGGGGAGCAGCAGGAAAAATCAGGGAACAGAGACGCCAGTTTAGCCATAGGGCTATACCTCAGGGAGTGACTCGACGTAAT
GGCAAAGAGCAATATGTGCCACCCAGATCACCAAAGTAAAAAACAACAAAACTATTCAAAAACTTCACTCTCTTCCCATTAAACTTGAAC
TGTGGCTATATTGAACTGTTTTGGAGGGGAGGGGGTAGCCAGGAAGGAAACAAGAGAAAGTACGTCCATTTCATTATGGATTTTGGAGTT
GTGAGTGATAGGATCCCAAAATTCATCTCTAATGTGGTTTTTAAATGCTGGAGGATTCCAATCAATATAAATATATATATATATATACAC
ACACATATATAAAAAGTATAATTTTTCTATTTTTGTTTTTGGTTTTAATTTGCAGAGATTTGCTGCCAGGAATCAATTTTGAGGGTTCAG
ATTTAGCTTGGAAGAAAAAAAAGAAACATACATCCTTCAGTATAGGAGATGAGGGAATGAGAGAAAATATTTTTTGAAGAAGCATTTCTG
TAAAATTAGAAATTACTTTTTTTAATCTATTTAAAGTTTGGCTTGAAGAATGCCATCTCTGACTATATGGCCTTGTATTGCAAAGCGGAT
CAGTGGCTGGGGTGCCTGTTGTGGGTGTGAGTGTGTACAAGAGCGATTGAAGCCAAATCTGTTGTCATGTTAGTAAATGATTTGAAAACT
GAATGTAATACTTGAGTAGATTTTTTTTTCTAGTTTGAAATTTAGTCTGTCTTTTTGACCTTACTAATATTTCATTTAACAAGTTGTAAA
ACTCTGATTGTACTTAGAGATGTGACTACCAATCAGTTTGATACTCAAGGAAAGGGGGTTATTCAAGAAATTGAAAATTTCATCTTGGAC
CTCAGTGCATAGGTCAAATGGATTTCAGAGGTTTAAACTTCCCTGTGATTCCCCCGAATACCCCCAAAATGAGAAACAAAATTTTTTTTC
TTACTCCATTTGTTACTCTCTGTTCTTTGACTGCCCACCCACAGAAAAGCAAAATAACCAACTACCTACTCAATTGTGTGTTTGTAATTG
CTTTGAGCAGTCTAGTCAAATCATATAAATTGTTCTAAATTTCAGAATTGAACATTGAAGTATTAACTCTTCTGTTCACACATTTAGAAT
TTTAGCTCCCAAGATGGTAGGGCAGACTGACCGTACAGTAATTTATTTGTCGTTAGTGTTAAAGATTAAGCATAGTAACTGACTCTTAAG
TGTTAAATAATGTAGAAGTAAAAAAATTTTTTTTAAAGGCTTAATTTGGGAGGGGGGACTTATTTCTGTTTACAGTGTATTACCTTCCTT
CCCTCCTCTTCTCCCCCCACACCCAACAAAATACAGTTTGGAATTCACTGAAACAGTACCAGCAAGTCATGAGATTTTTTAGTAAAGATG
AGAAAGATGGTTGAAGAAAATTAGTGCATAATTTCTCAGTGAATAAAGTTGTAGCTCTCATATACTAAATAGACAAGTTTACATGCTGTT
ATTTAGAAAATGACTAAAATATTAAAAACCGTGTTGTGTTAATCTGTTTTAAGTCATACCATGTTCAGAGTTCTATGTAAGGTGGGTTTT
ATTTTTCTTTTAAGGGATAGTTTGTAATAGTAAGAACTGTCCCATATGTTAGTAAATTACATATGTACAAATTGAAACTGTAAATTGTGA
ACACTGGAAAGCACCATTGTGACATAGAGTAAACATCTTAGTAATATATTAAAGTGAATGTAAATGGTGGTTAAAATTACATTACTGTGA
AATTCATCTTCCAACTCTAAGTTAAGCTTTGGAGATACATGTTAGTGGTTAACTGTTAAGAGCTTTGAAAACACTGCACATATCTGTACA
AGCCAGAATTACTATTTCTTTGACTTATTATTAGCTTGGCAGTTGCTTTTGATTTGATTGTTTTATGACATGGTATACTACTATATTTAC
TCAGTTTGAAACTATTCATTTCTACACACTATTTTTAAAAATTGCCTACTAGGTGAAACATAACAATAAAACTACCTGTGCTGAAATTTG
GGGGAAGTTTAGGTCCTTTAAAAAAACATATTAATCATTGACTACATCTATGATAAAAGTGCTTATTTTGGTTTACTAAGATAATGCAGT
TGGTGGAAATGATAAACGTTTTAAGTGTTAACATCCTTTGAATGCGTTGGATTTCAGAGAATAAACATTTTGTAAAAATCACTTGGTAAG
GATTATAAACTTAATTACTGCACTTAAAATGAAACATTACTTTTTTTAAACAATGTGTCACAAATGTAGGTCTGTATTACTTGTATGCTT
GTGTGACTTACTGTTAGTCCAGCTCTAAAAATTTAAAGGTTGTAATTGAAATACAAGAAAAGAGCCTTCTTTTAGAAGAAAGCAAGTATA
TTTTTGCTTTTACTTCAAATGTTATTTAAAGTAGAAATTTAATTTGTAGATATAACCTTTAAAAATTTTCTCATTAAGACAATGTTTTTA
ATTTAATTTGCCTCATTACATCTAATAGTTCCCATTTGATGGCATGTATAGGGAAGAGTGAGAGAGTGTGTGTGTGTGTATGTGTGTGTA
ATATTTATATATATTCACAGTATGTATTTAGCATTTATTTTATTACAGCAGATTTAAAGTTTGTATCTAAATAATGCCTATGAGTTGTGT
GAAGCTCTTGGCTTTTTTCCAACGTTACTTTGTAACTAATGAGGGTGGATGTTCATTGTAGTTTATTTATTTGGTTCTTTAGATGGAGGA
ATTTAAAAAATCAAATTTTTCTCTTCACCTTTATGACTTGACATTTCCTTGATCTGTTGGAGGCTAAAAGTAGGTATAAATGATATTGAA
TGTTGGGTATAGTGATACTCTGCCATAGTTCTTACTGCATGAAGAGAACAAGAGTCACACAAGTTCACCACTTTGCACTTCATAGAGAAG
GTACATAGAGACATTGCAAAACCTGTCTCCATTTGCTATCCTGATAATTAAGGTTTTCATAATACCTAGGGCCTGTCTCTGAGTAATTTT
AATTTTGCCAAATACACTGACATTTAAAATAGTGATCCATCTAAATTTTTTTCAGCTGGGTTTTGAGGAATATAAGAGCTTTCAATGATA
AAGGTTTGTTGTAGTTGTCTTATGTGCTGAATTTGCAGATGATCAGATGCTGTGCAGAATTCTGATTTATTTTTGTTTCCTAAAATTAAG
ATAGCTTGAATATTATTTCACATTCCTTTTTCTTTTTTAAATAAACAGGTTTGCTTTGGAAAGGCTTAATGATGGAATGTTAGCATCTTC
ACTAGGGTAAAGAAGAACAAAAAGAATGTTGCTGGAACGTAAAATAGTATTTAAAAGTTAATGAACACTTCTCTAGTTTTCTTAGTTATG
GCCTTAATAATTAGTCTCTTGGCTTAAATGTCCACTGGTTTTACTTTGACACAGTTGAACAACACTGGGGTTAAGTCTCTGGTATTTAGG
CTGGCAATATATATATTAACCATATTTTAAAAGTACCAATTTTGTTTTTACAGAAAAGATAAAACTCAAAAGAGAACAGTGTATTCCTTC
TGAGGGGCTTTTATAAATTATTAACTATAATATATGATGGATTTTTTCCTAATTTTTTATATTTCCTTACAATTTTGGTGGCCATTAATT
TAACTTTAGGCTTTTGGGCATATGCTAGTCTGAGCTTCCGAAAAGATACATATATGTTTCCCTTTTCATTAGCTGAATGAGGATATTTTA
AGAAGTTGAAAGAGAATTTATTTTCAAGTTGTGAGTAAATCCTCCTTTGAAATTCACCTGATTATTAGATAACTTAAAGTTTATTTTTAA
AAGCTGACAACTTTTTATGAATCTTCGAGTTGACAGTTCCTAAAAGCGTAACTCAGATATTAATGGGCTGTGTATTAAATGGTTTTATTT
TCAGTTTTGCAGCACAGAACACTGTTGAAATATCCATATCAACTTGATTTTTTTAACCTAATTCAGGTGTCCTTTGCATCTCTTAAATGT
TGGGGGTGGGGGTCAGAGCCAGTTATCCGGCTTCTGTTTTGTCGATTGCTTAGATTTGTTCCTGTTGTCAAAACTGTTACCCCCAAAATT
GGTGTGACACATGCTCATGCATAAAATGTTAAAATGAGTACATCCTTGTATTTGTATTTGTTTTCAACATCGCCAAGGTGCTATGGGAAA

>In-frame_LETMD1_ENST00000418425_chr12_51445990_+_LARP4_ENST00000518444_chr12_50847243_+_2438nt
AAAGACAACCTCTTCTCTCCCGCTTCTCTCGCTGTGAAGATGGCGCTCTCCAGGGTGTGCTGGGCTCGGTCGGCTGTGTGGGGCTCGGCA
GTCACCCCTGGACATTTTGTCACCCGGAGGCTGCAACTTGGTCGCTCTGGCCTGGCTTGGGGGGCCCCTCGGTCTTCAAAGCTTCACCTT
TCTCCAAAGGCAGATGTGAAGAACTTGATGTCTTATGTGGTAACCAAGACAAAAGCGATTAATGGGAAATACCATCGTTTCTTGGGTCGT
CATTTCCCCCGCTTCTATGTCCTGTACACAATCTTCATGAAAGGATTGCAGATGTTATGGGCTGATGCCAAAAAGGCTAGAAGAATAAAG
ACAAATATGTGGAAGCACAATATAAAGTTTCATCAACTTCCATACCGGGAGATGGAGCATTTGAGACAGGTATGGGCCAGGGGCAGATAT
CCAGAAGTTCATGGTGAGGCAAGGATAAAAGCCATCAATACATTTTTTGCTAAGAATGGTTATCGATTAATGGATTCTAGTATCTATAGT
CACCCCATTCAAACTCAAGCACAGTATGCCTCCCCAGTCTTTATGCAGCCTGTATATAATCCTCACCAACAGTACTCGGTCTATAGTATT
GTGCCTCAGTCTTGGTCTCCAAATCCTACACCTTACTTTGAAACACCACTGGCTCCCTTTCCCAATGGTAGTTTTGTGAATGGCTTTAAT
TCGCCAGGATCTTATAAAACAAATGCTGCTGCTATGAATATGGGTCGACCATTCCAAAAAAATCGTGTGAAGCCTCAGTTTAGGTCATCT
GGTGGTTCAGAACACTCAACAGAGGGCTCTGTATCCTTGGGGGATGGACAGTTGAACAGATATAGTTCAAGAAACTTTCCAGCTGAACGG
CATAACCCCACAGTAACTGGGCATCAGGAGCAAACTTACCTTCAGAAGGAGACTTCCACTTTGCAGGTGGAACAGAATGGGGACTATGGT
AGGGGCAGGAGAACTCTCTTCAGAGGTCGAAGACGACGAGAAGATGACAGGATCTCAAGACCTCATCCTTCAACAGCTGAATCAAAGGCT
CCAACACCAAAGTTTGACTTATTAGCCTCAAATTTTCCACCTTTACCTGGAAGTTCATCAAGAATGCCAGGTGAACTCGTTTTGGAGAAT
AGGATGTCTGATGTTGTTAAAGGTGTCTACAAAGAAAAGGATAATGAAGAGTTGACAATTAGTTGCCCAGTGCCTGCAGATGAGCAGACA
GAATGCACTTCTGCCCAGCAACTCAATATGAGTACCAGTTCTCCATGTGCTGCTGAGCTTACTGCATTAAGCACAACTCAGCAAGAAAAG
GATCTAATAGAAGATTCCTCTGTTCAGAAGGATGGTCTCAATCAGACAACTATACCAGTTTCTCCTCCAAGTACTACAAAGCCATCGAGG
GCAAGTACTGCTTCACCATGTAATAATAACATAAATGCAGCTACAGCTGTGGCTCTACAGGAACCCCGAAAGTTAAGTTATGCTGAAGTG
TGCCAGAAGCCCCCTAAAGAGCCATCTTCAGTTCTTGTGCAGCCACTACGGGAACTTCGCTCCAATGTGGTGTCTCCCACCAAAAATGAA
GACAATGGAGCTCCTGAGAACTCCGTTGAGAAACCACATGAGAAGCCAGAAGCAAGGGCTAGTAAGGATTATTCTGGCTTCCGAGGCAAT
ATAATCCCCAGGGGAGCAGCAGGAAAAATCAGGGAACAGAGACGCCAGTTTAGCCATAGGGCTATACCTCAGGGAGTGACTCGACGTAAT
GGCAAAGAGCAATATGTGCCACCCAGATCACCAAAGTAAAAAACAACAAAACTATTCAAAAACTTCACTCTCTTCCCATTAAACTTGAAC
TGTGGCTATATTGAACTGTTTTGGAGGGGAGGGGGTAGCCAGGAAGGAAACAAGAGAAAGTACGTCCATTTCATTATGGATTTTGGAGTT
GTGAGTGATAGGATCCCAAAATTCATCTCTAATGTGGTTTTTAAATGCTGGAGGATTCCAATCAATATAAATATATATATATATATACAC
ACACATATATAAAAAGTATAATTTTTCTATTTTTGTTTTTGGTTTTAATTTGCAGAGATTTGCTGCCAGGAATCAATTTTGAGGGTTCAG
ATTTAGCTTGGAAGAAAAAAAAGAAACATACATCCTTCAGTATAGGAGATGAGGGAATGAGAGAAAATATTTTTTGAAGAAGCATTTCTG
TAAAATTAGAAATTACTTTTTTTAATCTATTTAAAGTTTGGCTTGAAGAATGCCATCTCTGACTATATGGCCTTGTATTGCAAAGCGGAT
CAGTGGCTGGGGTGCCTGTTGTGGGTGTGAGTGTGTACAAGAGCGATTGAAGCCAAATCTGTTGTCATGTTAGTAAATGATTTGAAAACT

>In-frame_LETMD1_ENST00000547008_chr12_51445990_+_LARP4_ENST00000293618_chr12_50847243_+_5696nt
TTCTCTCGCTGTGAAGATGGCGCTCTCCAGGGTGTGCTGGGCTCGGTCGGCTGTGTGGGGCTCGGCAGTCACCCCTGGACATTTTGTCAC
CCGGAGGCTGCAACTTGGTCGCTCTGGCCTGGCTTGGGGGGCCCCTCGGTCTTCAAAGCTTCACCTTTCTCCAAAGGCAGATGTGAAGAA
CTTGATGTCTTATGTGGTAACCAAGACAAAAGCGATTAATGGGAAATACCATCGTTTCTTGGGTCGTCATTTCCCCCGCTTCTATGTCCT
GTACACAATCTTCATGAAAGGATTGCAGATGTTATGGGCTGATGCCAAAAAGGCTAGAAGAATAAAGACAAATATGTGGAAGCACAATAT
AAAGTTTCATCAACTTCCATACCGGGAGATGGAGCATTTGAGACAGGCAAGGATAAAAGCCATCAATACATTTTTTGCTAAGAATGGTTA
TCGATTAATGGATTCTAGTATCTATAGTCACCCCATTCAAACTCAAGCACAGTATGCCTCCCCAGTCTTTATGCAGCCTGTATATAATCC
TCACCAACAGTACTCGGTCTATAGTATTGTGCCTCAGTCTTGGTCTCCAAATCCTACACCTTACTTTGAAACACCACTGGCTCCCTTTCC
CAATGGTAGTTTTGTGAATGGCTTTAATTCGCCAGGATCTTATAAAACAAATGCTGCTGCTATGAATATGGGTCGACCATTCCAAAAAAA
TCGGAGAACTCTCTTCAGAGGTCGAAGACGACGAGAAGATGACAGGATCTCAAGACCTCATCCTTCAACAGCTGAATCAAAGGCTCCAAC
ACCAAAGTTTGACTTATTAGCCTCAAATTTTCCACCTTTACCTGGAAGTTCATCAAGAATGCCAGGTGAACTCGTTTTGGAGAATAGGAT
GTCTGATGTTGTTAAAGGTGTCTACAAAGAAAAGGATAATGAAGAGTTGACAATTAGTTGCCCAGTGCCTGCAGATGAGCAGACAGAATG
CACTTCTGCCCAGCAACTCAATATGAGTACCAGTTCTCCATGTGCTGCTGAGCTTACTGCATTAAGCACAACTCAGCAAGAAAAGGATCT
AATAGAAGATTCCTCTGTTCAGAAGGATGGTCTCAATCAGACAACTATACCAGTTTCTCCTCCAAGTACTACAAAGCCATCGAGGGCAAG
TACTGCTTCACCATGTAATAATAACATAAATGCAGCTACAGCTGTGGCTCTACAGGAACCCCGAAAGTTAAGTTATGCTGAAGTGTGCCA
GAAGCCCCCTAAAGAGCCATCTTCAGTTCTTGTGCAGCCACTACGGGAACTTCGCTCCAATGTGGTGTCTCCCACCAAAAATGAAGACAA
TGGAGCTCCTGAGAACTCCGTTGAGAAACCACATGAGAAGCCAGAAGCAAGGGCTAGTAAGGATTATTCTGGCTTCCGAGGCAATATAAT
CCCCAGGGGAGCAGCAGGAAAAATCAGGGAACAGAGACGCCAGTTTAGCCATAGGGCTATACCTCAGGGAGTGACTCGACGTAATGGCAA
AGAGCAATATGTGCCACCCAGATCACCAAAGTAAAAAACAACAAAACTATTCAAAAACTTCACTCTCTTCCCATTAAACTTGAACTGTGG
CTATATTGAACTGTTTTGGAGGGGAGGGGGTAGCCAGGAAGGAAACAAGAGAAAGTACGTCCATTTCATTATGGATTTTGGAGTTGTGAG
TGATAGGATCCCAAAATTCATCTCTAATGTGGTTTTTAAATGCTGGAGGATTCCAATCAATATAAATATATATATATATATACACACACA
TATATAAAAAGTATAATTTTTCTATTTTTGTTTTTGGTTTTAATTTGCAGAGATTTGCTGCCAGGAATCAATTTTGAGGGTTCAGATTTA
GCTTGGAAGAAAAAAAAGAAACATACATCCTTCAGTATAGGAGATGAGGGAATGAGAGAAAATATTTTTTGAAGAAGCATTTCTGTAAAA
TTAGAAATTACTTTTTTTAATCTATTTAAAGTTTGGCTTGAAGAATGCCATCTCTGACTATATGGCCTTGTATTGCAAAGCGGATCAGTG
GCTGGGGTGCCTGTTGTGGGTGTGAGTGTGTACAAGAGCGATTGAAGCCAAATCTGTTGTCATGTTAGTAAATGATTTGAAAACTGAATG
TAATACTTGAGTAGATTTTTTTTTCTAGTTTGAAATTTAGTCTGTCTTTTTGACCTTACTAATATTTCATTTAACAAGTTGTAAAACTCT
GATTGTACTTAGAGATGTGACTACCAATCAGTTTGATACTCAAGGAAAGGGGGTTATTCAAGAAATTGAAAATTTCATCTTGGACCTCAG
TGCATAGGTCAAATGGATTTCAGAGGTTTAAACTTCCCTGTGATTCCCCCGAATACCCCCAAAATGAGAAACAAAATTTTTTTTCTTACT
CCATTTGTTACTCTCTGTTCTTTGACTGCCCACCCACAGAAAAGCAAAATAACCAACTACCTACTCAATTGTGTGTTTGTAATTGCTTTG
AGCAGTCTAGTCAAATCATATAAATTGTTCTAAATTTCAGAATTGAACATTGAAGTATTAACTCTTCTGTTCACACATTTAGAATTTTAG
CTCCCAAGATGGTAGGGCAGACTGACCGTACAGTAATTTATTTGTCGTTAGTGTTAAAGATTAAGCATAGTAACTGACTCTTAAGTGTTA
AATAATGTAGAAGTAAAAAAATTTTTTTTAAAGGCTTAATTTGGGAGGGGGGACTTATTTCTGTTTACAGTGTATTACCTTCCTTCCCTC
CTCTTCTCCCCCCACACCCAACAAAATACAGTTTGGAATTCACTGAAACAGTACCAGCAAGTCATGAGATTTTTTAGTAAAGATGAGAAA
GATGGTTGAAGAAAATTAGTGCATAATTTCTCAGTGAATAAAGTTGTAGCTCTCATATACTAAATAGACAAGTTTACATGCTGTTATTTA
GAAAATGACTAAAATATTAAAAACCGTGTTGTGTTAATCTGTTTTAAGTCATACCATGTTCAGAGTTCTATGTAAGGTGGGTTTTATTTT
TCTTTTAAGGGATAGTTTGTAATAGTAAGAACTGTCCCATATGTTAGTAAATTACATATGTACAAATTGAAACTGTAAATTGTGAACACT
GGAAAGCACCATTGTGACATAGAGTAAACATCTTAGTAATATATTAAAGTGAATGTAAATGGTGGTTAAAATTACATTACTGTGAAATTC
ATCTTCCAACTCTAAGTTAAGCTTTGGAGATACATGTTAGTGGTTAACTGTTAAGAGCTTTGAAAACACTGCACATATCTGTACAAGCCA
GAATTACTATTTCTTTGACTTATTATTAGCTTGGCAGTTGCTTTTGATTTGATTGTTTTATGACATGGTATACTACTATATTTACTCAGT
TTGAAACTATTCATTTCTACACACTATTTTTAAAAATTGCCTACTAGGTGAAACATAACAATAAAACTACCTGTGCTGAAATTTGGGGGA
AGTTTAGGTCCTTTAAAAAAACATATTAATCATTGACTACATCTATGATAAAAGTGCTTATTTTGGTTTACTAAGATAATGCAGTTGGTG
GAAATGATAAACGTTTTAAGTGTTAACATCCTTTGAATGCGTTGGATTTCAGAGAATAAACATTTTGTAAAAATCACTTGGTAAGGATTA
TAAACTTAATTACTGCACTTAAAATGAAACATTACTTTTTTTAAACAATGTGTCACAAATGTAGGTCTGTATTACTTGTATGCTTGTGTG
ACTTACTGTTAGTCCAGCTCTAAAAATTTAAAGGTTGTAATTGAAATACAAGAAAAGAGCCTTCTTTTAGAAGAAAGCAAGTATATTTTT
GCTTTTACTTCAAATGTTATTTAAAGTAGAAATTTAATTTGTAGATATAACCTTTAAAAATTTTCTCATTAAGACAATGTTTTTAATTTA
ATTTGCCTCATTACATCTAATAGTTCCCATTTGATGGCATGTATAGGGAAGAGTGAGAGAGTGTGTGTGTGTGTATGTGTGTGTAATATT
TATATATATTCACAGTATGTATTTAGCATTTATTTTATTACAGCAGATTTAAAGTTTGTATCTAAATAATGCCTATGAGTTGTGTGAAGC
TCTTGGCTTTTTTCCAACGTTACTTTGTAACTAATGAGGGTGGATGTTCATTGTAGTTTATTTATTTGGTTCTTTAGATGGAGGAATTTA
AAAAATCAAATTTTTCTCTTCACCTTTATGACTTGACATTTCCTTGATCTGTTGGAGGCTAAAAGTAGGTATAAATGATATTGAATGTTG
GGTATAGTGATACTCTGCCATAGTTCTTACTGCATGAAGAGAACAAGAGTCACACAAGTTCACCACTTTGCACTTCATAGAGAAGGTACA
TAGAGACATTGCAAAACCTGTCTCCATTTGCTATCCTGATAATTAAGGTTTTCATAATACCTAGGGCCTGTCTCTGAGTAATTTTAATTT
TGCCAAATACACTGACATTTAAAATAGTGATCCATCTAAATTTTTTTCAGCTGGGTTTTGAGGAATATAAGAGCTTTCAATGATAAAGGT
TTGTTGTAGTTGTCTTATGTGCTGAATTTGCAGATGATCAGATGCTGTGCAGAATTCTGATTTATTTTTGTTTCCTAAAATTAAGATAGC
TTGAATATTATTTCACATTCCTTTTTCTTTTTTAAATAAACAGGTTTGCTTTGGAAAGGCTTAATGATGGAATGTTAGCATCTTCACTAG
GGTAAAGAAGAACAAAAAGAATGTTGCTGGAACGTAAAATAGTATTTAAAAGTTAATGAACACTTCTCTAGTTTTCTTAGTTATGGCCTT
AATAATTAGTCTCTTGGCTTAAATGTCCACTGGTTTTACTTTGACACAGTTGAACAACACTGGGGTTAAGTCTCTGGTATTTAGGCTGGC
AATATATATATTAACCATATTTTAAAAGTACCAATTTTGTTTTTACAGAAAAGATAAAACTCAAAAGAGAACAGTGTATTCCTTCTGAGG
GGCTTTTATAAATTATTAACTATAATATATGATGGATTTTTTCCTAATTTTTTATATTTCCTTACAATTTTGGTGGCCATTAATTTAACT
TTAGGCTTTTGGGCATATGCTAGTCTGAGCTTCCGAAAAGATACATATATGTTTCCCTTTTCATTAGCTGAATGAGGATATTTTAAGAAG
TTGAAAGAGAATTTATTTTCAAGTTGTGAGTAAATCCTCCTTTGAAATTCACCTGATTATTAGATAACTTAAAGTTTATTTTTAAAAGCT
GACAACTTTTTATGAATCTTCGAGTTGACAGTTCCTAAAAGCGTAACTCAGATATTAATGGGCTGTGTATTAAATGGTTTTATTTTCAGT
TTTGCAGCACAGAACACTGTTGAAATATCCATATCAACTTGATTTTTTTAACCTAATTCAGGTGTCCTTTGCATCTCTTAAATGTTGGGG
GTGGGGGTCAGAGCCAGTTATCCGGCTTCTGTTTTGTCGATTGCTTAGATTTGTTCCTGTTGTCAAAACTGTTACCCCCAAAATTGGTGT
GACACATGCTCATGCATAAAATGTTAAAATGAGTACATCCTTGTATTTGTATTTGTTTTCAACATCGCCAAGGTGCTATGGGAAATTAAC

>In-frame_LETMD1_ENST00000547008_chr12_51445990_+_LARP4_ENST00000429001_chr12_50847243_+_3430nt
TTCTCTCGCTGTGAAGATGGCGCTCTCCAGGGTGTGCTGGGCTCGGTCGGCTGTGTGGGGCTCGGCAGTCACCCCTGGACATTTTGTCAC
CCGGAGGCTGCAACTTGGTCGCTCTGGCCTGGCTTGGGGGGCCCCTCGGTCTTCAAAGCTTCACCTTTCTCCAAAGGCAGATGTGAAGAA
CTTGATGTCTTATGTGGTAACCAAGACAAAAGCGATTAATGGGAAATACCATCGTTTCTTGGGTCGTCATTTCCCCCGCTTCTATGTCCT
GTACACAATCTTCATGAAAGGATTGCAGATGTTATGGGCTGATGCCAAAAAGGCTAGAAGAATAAAGACAAATATGTGGAAGCACAATAT
AAAGTTTCATCAACTTCCATACCGGGAGATGGAGCATTTGAGACAGGCAAGGATAAAAGCCATCAATACATTTTTTGCTAAGAATGGTTA
TCGATTAATGGATTCTAGTATCTATAGTCACCCCATTCAAACTCAAGCACAGTATGCCTCCCCAGTCTTTATGCAGCCTGTATATAATCC
TCACCAACAGTACTCGGTCTATAGTATTGTGCCTCAGTCTTGGTCTCCAAATCCTACACCTTACTTTGAAACACCACTGGCTCCCTTTCC
CAATGGTAGTTTTGTGAATGGCTTTAATTCGCCAGGATCTTATAAAACAAATGCTGCTGCTATGAATATGGGTCGACCATTCCAAAAAAA
TCGTGTGAAGCCTCAGTTTAGGTCATCTGGTGGTTCAGAACACTCAACAGAGGGCTCTGTATCCTTGGGGGATGGACAGTTGAACAGATA
TAGTTCAAGAAACTTTCCAGCTGAACGGCATAACCCCACAGTAACTGGGCATCAGGAGCAAACTTACCTTCAGAAGGAGACTTCCACTTT
GCAGGTGGAACAGAATGGGGACTATGGTAGGGGCAGGAGAACTCTCTTCAGAGGTCGAAGACGACGAGAAGATGACAGGATCTCAAGACC
TCATCCTTCAACAGCTGAATCAAAGGCTCCAACACCAAAGTTTGACTTATTAGCCTCAAATTTTCCACCTTTACCTGGAAGTTCATCAAG
AATGCCAGGTGAACTCGTTTTGGAGAATAGGATGTCTGATGTTGTTAAAGGTGTCTACAAAGAAAAGGATAATGAAGAGTTGACAATTAG
TTGCCCAGTGCCTGCAGATGAGCAGACAGAATGCACTTCTGCCCAGCAACTCAATATGAGTACCAGTTCTCCATGTGCTGCTGAGCTTAC
TGCATTAAGCACAACTCAGCAAGAAAAGGATCTAATAGAAGATTCCTCTGTTCAGAAGGATGGTCTCAATCAGACAACTATACCAGTTTC
TCCTCCAAGTACTACAAAGCCATCGAGGGCAAGTACTGCTTCACCATGTAATAATAACATAAATGCAGCTACAGCTGTGGCTCTACAGGA
ACCCCGAAAGTTAAGTTATGCTGAAGTGTGCCAGAAGCCCCCTAAAGAGCCATCTTCAGTTCTTGTGCAGCCACTACGGGAACTTCGCTC
CAATGTGGTGTCTCCCACCAAAAATGAAGACAATGGAGCTCCTGAGAACTCCGTTGAGAAACCACATGAGAAGCCAGAAGCAAGGGCTAG
TAAGGATTATTCTGGCTTCCGAGGCAATATAATCCCCAGGGGAGCAGCAGGAAAAATCAGGGAACAGAGACGCCAGTTTAGCCATAGGGC
TATACCTCAGGGAGTGACTCGACGTAATGGCAAAGAGCAATATGTGCCACCCAGATCACCAAAGTAAAAAACAACAAAACTATTCAAAAA
CTTCACTCTCTTCCCATTAAACTTGAACTGTGGCTATATTGAACTGTTTTGGAGGGGAGGGGGTAGCCAGGAAGGAAACAAGAGAAAGTA
CGTCCATTTCATTATGGATTTTGGAGTTGTGAGTGATAGGATCCCAAAATTCATCTCTAATGTGGTTTTTAAATGCTGGAGGATTCCAAT
CAATATAAATATATATATATATATACACACACATATATAAAAAGTATAATTTTTCTATTTTTGTTTTTGGTTTTAATTTGCAGAGATTTG
CTGCCAGGAATCAATTTTGAGGGTTCAGATTTAGCTTGGAAGAAAAAAAAGAAACATACATCCTTCAGTATAGGAGATGAGGGAATGAGA
GAAAATATTTTTTGAAGAAGCATTTCTGTAAAATTAGAAATTACTTTTTTTAATCTATTTAAAGTTTGGCTTGAAGAATGCCATCTCTGA
CTATATGGCCTTGTATTGCAAAGCGGATCAGTGGCTGGGGTGCCTGTTGTGGGTGTGAGTGTGTACAAGAGCGATTGAAGCCAAATCTGT
TGTCATGTTAGTAAATGATTTGAAAACTGAATGTAATACTTGAGTAGATTTTTTTTTCTAGTTTGAAATTTAGTCTGTCTTTTTGACCTT
ACTAATATTTCATTTAACAAGTTGTAAAACTCTGATTGTACTTAGAGATGTGACTACCAATCAGTTTGATACTCAAGGAAAGGGGGTTAT
TCAAGAAATTGAAAATTTCATCTTGGACCTCAGTGCATAGGTCAAATGGATTTCAGAGGTTTAAACTTCCCTGTGATTCCCCCGAATACC
CCCAAAATGAGAAACAAAATTTTTTTTCTTACTCCATTTGTTACTCTCTGTTCTTTGACTGCCCACCCACAGAAAAGCAAAATAACCAAC
TACCTACTCAATTGTGTGTTTGTAATTGCTTTGAGCAGTCTAGTCAAATCATATAAATTGTTCTAAATTTCAGAATTGAACATTGAAGTA
TTAACTCTTCTGTTCACACATTTAGAATTTTAGCTCCCAAGATGGTAGGGCAGACTGACCGTACAGTAATTTATTTGTCGTTAGTGTTAA
AGATTAAGCATAGTAACTGACTCTTAAGTGTTAAATAATGTAGAAGTAAAAAAATTTTTTTTAAAGGCTTAATTTGGGAGGGGGGACTTA
TTTCTGTTTACAGTGTATTACCTTCCTTCCCTCCTCTTCTCCCCCCACACCCAACAAAATACAGTTTGGAATTCACTGAAACAGTACCAG
CAAGTCATGAGATTTTTTAGTAAAGATGAGAAAGATGGTTGAAGAAAATTAGTGCATAATTTCTCAGTGAATAAAGTTGTAGCTCTCATA
TACTAAATAGACAAGTTTACATGCTGTTATTTAGAAAATGACTAAAATATTAAAAACCGTGTTGTGTTAATCTGTTTTAAGTCATACCAT
GTTCAGAGTTCTATGTAAGGTGGGTTTTATTTTTCTTTTAAGGGATAGTTTGTAATAGTAAGAACTGTCCCATATGTTAGTAAATTACAT
ATGTACAAATTGAAACTGTAAATTGTGAACACTGGAAAGCACCATTGTGACATAGAGTAAACATCTTAGTAATATATTAAAGTGAATGTA

>In-frame_LETMD1_ENST00000547008_chr12_51445990_+_LARP4_ENST00000398473_chr12_50847243_+_5917nt
TTCTCTCGCTGTGAAGATGGCGCTCTCCAGGGTGTGCTGGGCTCGGTCGGCTGTGTGGGGCTCGGCAGTCACCCCTGGACATTTTGTCAC
CCGGAGGCTGCAACTTGGTCGCTCTGGCCTGGCTTGGGGGGCCCCTCGGTCTTCAAAGCTTCACCTTTCTCCAAAGGCAGATGTGAAGAA
CTTGATGTCTTATGTGGTAACCAAGACAAAAGCGATTAATGGGAAATACCATCGTTTCTTGGGTCGTCATTTCCCCCGCTTCTATGTCCT
GTACACAATCTTCATGAAAGGATTGCAGATGTTATGGGCTGATGCCAAAAAGGCTAGAAGAATAAAGACAAATATGTGGAAGCACAATAT
AAAGTTTCATCAACTTCCATACCGGGAGATGGAGCATTTGAGACAGGCAAGGATAAAAGCCATCAATACATTTTTTGCTAAGAATGGTTA
TCGATTAATGGATTCTAGTATCTATAGTCACCCCATTCAAACTCAAGCACAGTATGCCTCCCCAGTCTTTATGCAGCCTGTATATAATCC
TCACCAACAGTACTCGGTCTATAGTATTGTGCCTCAGTCTTGGTCTCCAAATCCTACACCTTACTTTGAAACACCACTGGCTCCCTTTCC
CAATGGTAGTTTTGTGAATGGCTTTAATTCGCCAGGATCTTATAAAACAAATGCTGCTGCTATGAATATGGGTCGACCATTCCAAAAAAA
TCGTGTGAAGCCTCAGTTTAGGTCATCTGGTGGTTCAGAACACTCAACAGAGGGCTCTGTATCCTTGGGGGATGGACAGTTGAACAGATA
TAGTTCAAGAAACTTTCCAGCTGAACGGCATAACCCCACAGTAACTGGGCATCAGGAGCAAACTTACCTTCAGAAGGAGACTTCCACTTT
GCAGGTGGAACAGAATGGGGACTATGGTAGGGGCAGGAGAACTCTCTTCAGAGGTCGAAGACGACGAGAAGATGACAGGATCTCAAGACC
TCATCCTTCAACAGCTGAATCAAAGGCTCCAACACCAAAGTTTGACTTATTAGCCTCAAATTTTCCACCTTTACCTGGAAGTTCATCAAG
AATGCCAGGTGAACTCGTTTTGGAGAATAGGATGTCTGATGTTGTTAAAGGTGTCTACAAAGAAAAGGATAATGAAGAGTTGACAATTAG
TTGCCCAGTGCCTGCAGATGAGCAGACAGAATGCACTTCTGCCCAGCAACTCAATATGAGTACCAGTTCTCCATGTGCTGCTGAGCTTAC
TGCATTAAGCACAACTCAGCAAGAAAAGGATCTAATAGAAGATTCCTCTGTTCAGAAGGATGGTCTCAATCAGACAACTATACCAGTTTC
TCCTCCAAGTACTACAAAGCCATCGAGGGCAAGTACTGCTTCACCATGTAATAATAACATAAATGCAGCTACAGCTGTGGCTCTACAGGA
ACCCCGAAAGTTAAGTTATGCTGAAGTGTGCCAGAAGCCCCCTAAAGAGCCATCTTCAGTTCTTGTGCAGCCACTACGGGAACTTCGCTC
CAATGTGGTGTCTCCCACCAAAAATGAAGACAATGGAGCTCCTGAGAACTCCGTTGAGAAACCACATGAGAAGCCAGAAGCAAGGGCTAG
TAAGGATTATTCTGGCTTCCGAGGCAATATAATCCCCAGGGGAGCAGCAGGAAAAATCAGGGAACAGAGACGCCAGTTTAGCCATAGGGC
TATACCTCAGGGAGTGACTCGACGTAATGGCAAAGAGCAATATGTGCCACCCAGATCACCAAAGTAAAAAACAACAAAACTATTCAAAAA
CTTCACTCTCTTCCCATTAAACTTGAACTGTGGCTATATTGAACTGTTTTGGAGGGGAGGGGGTAGCCAGGAAGGAAACAAGAGAAAGTA
CGTCCATTTCATTATGGATTTTGGAGTTGTGAGTGATAGGATCCCAAAATTCATCTCTAATGTGGTTTTTAAATGCTGGAGGATTCCAAT
CAATATAAATATATATATATATATACACACACATATATAAAAAGTATAATTTTTCTATTTTTGTTTTTGGTTTTAATTTGCAGAGATTTG
CTGCCAGGAATCAATTTTGAGGGTTCAGATTTAGCTTGGAAGAAAAAAAAGAAACATACATCCTTCAGTATAGGAGATGAGGGAATGAGA
GAAAATATTTTTTGAAGAAGCATTTCTGTAAAATTAGAAATTACTTTTTTTAATCTATTTAAAGTTTGGCTTGAAGAATGCCATCTCTGA
CTATATGGCCTTGTATTGCAAAGCGGATCAGTGGCTGGGGTGCCTGTTGTGGGTGTGAGTGTGTACAAGAGCGATTGAAGCCAAATCTGT
TGTCATGTTAGTAAATGATTTGAAAACTGAATGTAATACTTGAGTAGATTTTTTTTTCTAGTTTGAAATTTAGTCTGTCTTTTTGACCTT
ACTAATATTTCATTTAACAAGTTGTAAAACTCTGATTGTACTTAGAGATGTGACTACCAATCAGTTTGATACTCAAGGAAAGGGGGTTAT
TCAAGAAATTGAAAATTTCATCTTGGACCTCAGTGCATAGGTCAAATGGATTTCAGAGGTTTAAACTTCCCTGTGATTCCCCCGAATACC
CCCAAAATGAGAAACAAAATTTTTTTTCTTACTCCATTTGTTACTCTCTGTTCTTTGACTGCCCACCCACAGAAAAGCAAAATAACCAAC
TACCTACTCAATTGTGTGTTTGTAATTGCTTTGAGCAGTCTAGTCAAATCATATAAATTGTTCTAAATTTCAGAATTGAACATTGAAGTA
TTAACTCTTCTGTTCACACATTTAGAATTTTAGCTCCCAAGATGGTAGGGCAGACTGACCGTACAGTAATTTATTTGTCGTTAGTGTTAA
AGATTAAGCATAGTAACTGACTCTTAAGTGTTAAATAATGTAGAAGTAAAAAAATTTTTTTTAAAGGCTTAATTTGGGAGGGGGGACTTA
TTTCTGTTTACAGTGTATTACCTTCCTTCCCTCCTCTTCTCCCCCCACACCCAACAAAATACAGTTTGGAATTCACTGAAACAGTACCAG
CAAGTCATGAGATTTTTTAGTAAAGATGAGAAAGATGGTTGAAGAAAATTAGTGCATAATTTCTCAGTGAATAAAGTTGTAGCTCTCATA
TACTAAATAGACAAGTTTACATGCTGTTATTTAGAAAATGACTAAAATATTAAAAACCGTGTTGTGTTAATCTGTTTTAAGTCATACCAT
GTTCAGAGTTCTATGTAAGGTGGGTTTTATTTTTCTTTTAAGGGATAGTTTGTAATAGTAAGAACTGTCCCATATGTTAGTAAATTACAT
ATGTACAAATTGAAACTGTAAATTGTGAACACTGGAAAGCACCATTGTGACATAGAGTAAACATCTTAGTAATATATTAAAGTGAATGTA
AATGGTGGTTAAAATTACATTACTGTGAAATTCATCTTCCAACTCTAAGTTAAGCTTTGGAGATACATGTTAGTGGTTAACTGTTAAGAG
CTTTGAAAACACTGCACATATCTGTACAAGCCAGAATTACTATTTCTTTGACTTATTATTAGCTTGGCAGTTGCTTTTGATTTGATTGTT
TTATGACATGGTATACTACTATATTTACTCAGTTTGAAACTATTCATTTCTACACACTATTTTTAAAAATTGCCTACTAGGTGAAACATA
ACAATAAAACTACCTGTGCTGAAATTTGGGGGAAGTTTAGGTCCTTTAAAAAAACATATTAATCATTGACTACATCTATGATAAAAGTGC
TTATTTTGGTTTACTAAGATAATGCAGTTGGTGGAAATGATAAACGTTTTAAGTGTTAACATCCTTTGAATGCGTTGGATTTCAGAGAAT
AAACATTTTGTAAAAATCACTTGGTAAGGATTATAAACTTAATTACTGCACTTAAAATGAAACATTACTTTTTTTAAACAATGTGTCACA
AATGTAGGTCTGTATTACTTGTATGCTTGTGTGACTTACTGTTAGTCCAGCTCTAAAAATTTAAAGGTTGTAATTGAAATACAAGAAAAG
AGCCTTCTTTTAGAAGAAAGCAAGTATATTTTTGCTTTTACTTCAAATGTTATTTAAAGTAGAAATTTAATTTGTAGATATAACCTTTAA
AAATTTTCTCATTAAGACAATGTTTTTAATTTAATTTGCCTCATTACATCTAATAGTTCCCATTTGATGGCATGTATAGGGAAGAGTGAG
AGAGTGTGTGTGTGTGTATGTGTGTGTAATATTTATATATATTCACAGTATGTATTTAGCATTTATTTTATTACAGCAGATTTAAAGTTT
GTATCTAAATAATGCCTATGAGTTGTGTGAAGCTCTTGGCTTTTTTCCAACGTTACTTTGTAACTAATGAGGGTGGATGTTCATTGTAGT
TTATTTATTTGGTTCTTTAGATGGAGGAATTTAAAAAATCAAATTTTTCTCTTCACCTTTATGACTTGACATTTCCTTGATCTGTTGGAG
GCTAAAAGTAGGTATAAATGATATTGAATGTTGGGTATAGTGATACTCTGCCATAGTTCTTACTGCATGAAGAGAACAAGAGTCACACAA
GTTCACCACTTTGCACTTCATAGAGAAGGTACATAGAGACATTGCAAAACCTGTCTCCATTTGCTATCCTGATAATTAAGGTTTTCATAA
TACCTAGGGCCTGTCTCTGAGTAATTTTAATTTTGCCAAATACACTGACATTTAAAATAGTGATCCATCTAAATTTTTTTCAGCTGGGTT
TTGAGGAATATAAGAGCTTTCAATGATAAAGGTTTGTTGTAGTTGTCTTATGTGCTGAATTTGCAGATGATCAGATGCTGTGCAGAATTC
TGATTTATTTTTGTTTCCTAAAATTAAGATAGCTTGAATATTATTTCACATTCCTTTTTCTTTTTTAAATAAACAGGTTTGCTTTGGAAA
GGCTTAATGATGGAATGTTAGCATCTTCACTAGGGTAAAGAAGAACAAAAAGAATGTTGCTGGAACGTAAAATAGTATTTAAAAGTTAAT
GAACACTTCTCTAGTTTTCTTAGTTATGGCCTTAATAATTAGTCTCTTGGCTTAAATGTCCACTGGTTTTACTTTGACACAGTTGAACAA
CACTGGGGTTAAGTCTCTGGTATTTAGGCTGGCAATATATATATTAACCATATTTTAAAAGTACCAATTTTGTTTTTACAGAAAAGATAA
AACTCAAAAGAGAACAGTGTATTCCTTCTGAGGGGCTTTTATAAATTATTAACTATAATATATGATGGATTTTTTCCTAATTTTTTATAT
TTCCTTACAATTTTGGTGGCCATTAATTTAACTTTAGGCTTTTGGGCATATGCTAGTCTGAGCTTCCGAAAAGATACATATATGTTTCCC
TTTTCATTAGCTGAATGAGGATATTTTAAGAAGTTGAAAGAGAATTTATTTTCAAGTTGTGAGTAAATCCTCCTTTGAAATTCACCTGAT
TATTAGATAACTTAAAGTTTATTTTTAAAAGCTGACAACTTTTTATGAATCTTCGAGTTGACAGTTCCTAAAAGCGTAACTCAGATATTA
ATGGGCTGTGTATTAAATGGTTTTATTTTCAGTTTTGCAGCACAGAACACTGTTGAAATATCCATATCAACTTGATTTTTTTAACCTAAT
TCAGGTGTCCTTTGCATCTCTTAAATGTTGGGGGTGGGGGTCAGAGCCAGTTATCCGGCTTCTGTTTTGTCGATTGCTTAGATTTGTTCC
TGTTGTCAAAACTGTTACCCCCAAAATTGGTGTGACACATGCTCATGCATAAAATGTTAAAATGAGTACATCCTTGTATTTGTATTTGTT

>In-frame_LETMD1_ENST00000547008_chr12_51445990_+_LARP4_ENST00000518444_chr12_50847243_+_2376nt
TTCTCTCGCTGTGAAGATGGCGCTCTCCAGGGTGTGCTGGGCTCGGTCGGCTGTGTGGGGCTCGGCAGTCACCCCTGGACATTTTGTCAC
CCGGAGGCTGCAACTTGGTCGCTCTGGCCTGGCTTGGGGGGCCCCTCGGTCTTCAAAGCTTCACCTTTCTCCAAAGGCAGATGTGAAGAA
CTTGATGTCTTATGTGGTAACCAAGACAAAAGCGATTAATGGGAAATACCATCGTTTCTTGGGTCGTCATTTCCCCCGCTTCTATGTCCT
GTACACAATCTTCATGAAAGGATTGCAGATGTTATGGGCTGATGCCAAAAAGGCTAGAAGAATAAAGACAAATATGTGGAAGCACAATAT
AAAGTTTCATCAACTTCCATACCGGGAGATGGAGCATTTGAGACAGGCAAGGATAAAAGCCATCAATACATTTTTTGCTAAGAATGGTTA
TCGATTAATGGATTCTAGTATCTATAGTCACCCCATTCAAACTCAAGCACAGTATGCCTCCCCAGTCTTTATGCAGCCTGTATATAATCC
TCACCAACAGTACTCGGTCTATAGTATTGTGCCTCAGTCTTGGTCTCCAAATCCTACACCTTACTTTGAAACACCACTGGCTCCCTTTCC
CAATGGTAGTTTTGTGAATGGCTTTAATTCGCCAGGATCTTATAAAACAAATGCTGCTGCTATGAATATGGGTCGACCATTCCAAAAAAA
TCGTGTGAAGCCTCAGTTTAGGTCATCTGGTGGTTCAGAACACTCAACAGAGGGCTCTGTATCCTTGGGGGATGGACAGTTGAACAGATA
TAGTTCAAGAAACTTTCCAGCTGAACGGCATAACCCCACAGTAACTGGGCATCAGGAGCAAACTTACCTTCAGAAGGAGACTTCCACTTT
GCAGGTGGAACAGAATGGGGACTATGGTAGGGGCAGGAGAACTCTCTTCAGAGGTCGAAGACGACGAGAAGATGACAGGATCTCAAGACC
TCATCCTTCAACAGCTGAATCAAAGGCTCCAACACCAAAGTTTGACTTATTAGCCTCAAATTTTCCACCTTTACCTGGAAGTTCATCAAG
AATGCCAGGTGAACTCGTTTTGGAGAATAGGATGTCTGATGTTGTTAAAGGTGTCTACAAAGAAAAGGATAATGAAGAGTTGACAATTAG
TTGCCCAGTGCCTGCAGATGAGCAGACAGAATGCACTTCTGCCCAGCAACTCAATATGAGTACCAGTTCTCCATGTGCTGCTGAGCTTAC
TGCATTAAGCACAACTCAGCAAGAAAAGGATCTAATAGAAGATTCCTCTGTTCAGAAGGATGGTCTCAATCAGACAACTATACCAGTTTC
TCCTCCAAGTACTACAAAGCCATCGAGGGCAAGTACTGCTTCACCATGTAATAATAACATAAATGCAGCTACAGCTGTGGCTCTACAGGA
ACCCCGAAAGTTAAGTTATGCTGAAGTGTGCCAGAAGCCCCCTAAAGAGCCATCTTCAGTTCTTGTGCAGCCACTACGGGAACTTCGCTC
CAATGTGGTGTCTCCCACCAAAAATGAAGACAATGGAGCTCCTGAGAACTCCGTTGAGAAACCACATGAGAAGCCAGAAGCAAGGGCTAG
TAAGGATTATTCTGGCTTCCGAGGCAATATAATCCCCAGGGGAGCAGCAGGAAAAATCAGGGAACAGAGACGCCAGTTTAGCCATAGGGC
TATACCTCAGGGAGTGACTCGACGTAATGGCAAAGAGCAATATGTGCCACCCAGATCACCAAAGTAAAAAACAACAAAACTATTCAAAAA
CTTCACTCTCTTCCCATTAAACTTGAACTGTGGCTATATTGAACTGTTTTGGAGGGGAGGGGGTAGCCAGGAAGGAAACAAGAGAAAGTA
CGTCCATTTCATTATGGATTTTGGAGTTGTGAGTGATAGGATCCCAAAATTCATCTCTAATGTGGTTTTTAAATGCTGGAGGATTCCAAT
CAATATAAATATATATATATATATACACACACATATATAAAAAGTATAATTTTTCTATTTTTGTTTTTGGTTTTAATTTGCAGAGATTTG
CTGCCAGGAATCAATTTTGAGGGTTCAGATTTAGCTTGGAAGAAAAAAAAGAAACATACATCCTTCAGTATAGGAGATGAGGGAATGAGA
GAAAATATTTTTTGAAGAAGCATTTCTGTAAAATTAGAAATTACTTTTTTTAATCTATTTAAAGTTTGGCTTGAAGAATGCCATCTCTGA
CTATATGGCCTTGTATTGCAAAGCGGATCAGTGGCTGGGGTGCCTGTTGTGGGTGTGAGTGTGTACAAGAGCGATTGAAGCCAAATCTGT


Top

FusionGenePPI for LETMD1_LARP4


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
LETMD1APP, ENO1, MOV10, NXF1, PEX19, SLC39A4, CPVL, RTN4IP1, POMK, CD164L2, HCK, SH2D1A, NCBP1, RAB5C, JRKL, PCGF1, DPPA4, BCOR, NANOG, POU5F1, SLC39A12, HDAC10, UPK1A, EVL, C3AR1LARP4ELAVL1, SIRT7, CUL3, COPS6, APP, MPG, TARDBP, LIN28A, LIN28B, CRX, BHLHE40, EGFR, GNB2L1, NTRK1, MYO1C, NPM1, RPL10, AKAP1, RNF126, G3BP1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
TgeneLARP4chr12:51445990chr12:50847243ENST00000347328+01513_22-9654PABPC1
TgeneLARP4chr12:51445990chr12:50847243ENST00000347328+015111_303-9654the poly-A tract of mRNA


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
TgeneLARP4chr12:51445990chr12:50847243ENST00000293618+71513_22268654PABPC1
TgeneLARP4chr12:51445990chr12:50847243ENST00000398473+71613_22268725PABPC1
TgeneLARP4chr12:51445990chr12:50847243ENST00000429001+71613_22274731PABPC1
TgeneLARP4chr12:51445990chr12:50847243ENST00000518444+71613_22267724PABPC1
TgeneLARP4chr12:51445990chr12:50847243ENST00000522085+71113_22268446PABPC1
TgeneLARP4chr12:51445990chr12:50847243ENST00000293618+715111_303268654the poly-A tract of mRNA
TgeneLARP4chr12:51445990chr12:50847243ENST00000398473+716111_303268725the poly-A tract of mRNA
TgeneLARP4chr12:51445990chr12:50847243ENST00000429001+716111_303274731the poly-A tract of mRNA
TgeneLARP4chr12:51445990chr12:50847243ENST00000518444+716111_303267724the poly-A tract of mRNA
TgeneLARP4chr12:51445990chr12:50847243ENST00000522085+711111_303268446the poly-A tract of mRNA


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for LETMD1_LARP4


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for LETMD1_LARP4


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneLARP4C0032460Polycystic Ovary Syndrome1CTD_human