FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 19623

FusionGeneSummary for LEPREL1_TP63

check button Fusion gene summary
Fusion gene informationFusion gene name: LEPREL1_TP63
Fusion gene ID: 19623
HgeneTgene
Gene symbol

LEPREL1

TP63

Gene ID

55214

8626

Gene nameprolyl 3-hydroxylase 2tumor protein p63
SynonymsLEPREL1|MCVD|MLAT4AIS|B(p51A)|B(p51B)|EEC3|KET|LMS|NBP|OFC8|RHS|SHFM4|TP53CP|TP53L|TP73L|p40|p51|p53CP|p63|p73H|p73L
Cytomap

3q28

3q28

Type of geneprotein-codingprotein-coding
Descriptionprolyl 3-hydroxylase 2leprecan-like 1myxoid liposarcoma-associated protein 4procollagen-proline 3-dioxygenase 2prolyl 3-hydroxylase 3tumor protein 63amplified in squamous cell carcinomachronic ulcerative stomatitis proteinkeratinocyte transcription factor KETtransformation-related protein 63tumor protein p53-competing protein
Modification date2018052320180521
UniProtAcc

Q9H3D4

Ensembl transtripts involved in fusion geneENST00000319332, ENST00000427335, 
ENST00000264731, ENST00000382063, 
ENST00000418709, ENST00000320472, 
ENST00000392460, ENST00000440651, 
ENST00000354600, ENST00000437221, 
ENST00000392463, ENST00000392461, 
ENST00000456148, ENST00000449992, 
Fusion gene scores* DoF score1 X 1 X 1=16 X 5 X 4=120
# samples 16
** MAII scorelog2(1/1*10)=3.32192809488736log2(6/120*10)=-1
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: LEPREL1 [Title/Abstract] AND TP63 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Tumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
Transcription factor involved fusion gene, inframe and retained DNA-binding domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneLEPREL1

GO:0008285

negative regulation of cell proliferation

19436308

HgeneLEPREL1

GO:0019511

peptidyl-proline hydroxylation

18487197

HgeneLEPREL1

GO:0032963

collagen metabolic process

18487197

TgeneTP63

GO:0045747

positive regulation of Notch signaling pathway

11641404

TgeneTP63

GO:0045892

negative regulation of transcription, DNA-templated

12446784

TgeneTP63

GO:0045893

positive regulation of transcription, DNA-templated

12446784|16343436

TgeneTP63

GO:0045944

positive regulation of transcription by RNA polymerase II

22521434

TgeneTP63

GO:2000271

positive regulation of fibroblast apoptotic process

9774969


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLGGTCGA-CS-4942-01ALEPREL1chr3

189838041

-TP63chr3

189526061

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000319332ENST00000264731LEPREL1chr3

189838041

-TP63chr3

189526061

+
5CDS-intronENST00000319332ENST00000382063LEPREL1chr3

189838041

-TP63chr3

189526061

+
5CDS-intronENST00000319332ENST00000418709LEPREL1chr3

189838041

-TP63chr3

189526061

+
5CDS-intronENST00000319332ENST00000320472LEPREL1chr3

189838041

-TP63chr3

189526061

+
5CDS-intronENST00000319332ENST00000392460LEPREL1chr3

189838041

-TP63chr3

189526061

+
5CDS-intronENST00000319332ENST00000440651LEPREL1chr3

189838041

-TP63chr3

189526061

+
5CDS-intronENST00000319332ENST00000354600LEPREL1chr3

189838041

-TP63chr3

189526061

+
5CDS-intronENST00000319332ENST00000437221LEPREL1chr3

189838041

-TP63chr3

189526061

+
5CDS-intronENST00000319332ENST00000392463LEPREL1chr3

189838041

-TP63chr3

189526061

+
5CDS-intronENST00000319332ENST00000392461LEPREL1chr3

189838041

-TP63chr3

189526061

+
5CDS-intronENST00000319332ENST00000456148LEPREL1chr3

189838041

-TP63chr3

189526061

+
5CDS-intronENST00000319332ENST00000449992LEPREL1chr3

189838041

-TP63chr3

189526061

+
intron-3CDSENST00000427335ENST00000264731LEPREL1chr3

189838041

-TP63chr3

189526061

+
intron-intronENST00000427335ENST00000382063LEPREL1chr3

189838041

-TP63chr3

189526061

+
intron-intronENST00000427335ENST00000418709LEPREL1chr3

189838041

-TP63chr3

189526061

+
intron-intronENST00000427335ENST00000320472LEPREL1chr3

189838041

-TP63chr3

189526061

+
intron-intronENST00000427335ENST00000392460LEPREL1chr3

189838041

-TP63chr3

189526061

+
intron-intronENST00000427335ENST00000440651LEPREL1chr3

189838041

-TP63chr3

189526061

+
intron-intronENST00000427335ENST00000354600LEPREL1chr3

189838041

-TP63chr3

189526061

+
intron-intronENST00000427335ENST00000437221LEPREL1chr3

189838041

-TP63chr3

189526061

+
intron-intronENST00000427335ENST00000392463LEPREL1chr3

189838041

-TP63chr3

189526061

+
intron-intronENST00000427335ENST00000392461LEPREL1chr3

189838041

-TP63chr3

189526061

+
intron-intronENST00000427335ENST00000456148LEPREL1chr3

189838041

-TP63chr3

189526061

+
intron-intronENST00000427335ENST00000449992LEPREL1chr3

189838041

-TP63chr3

189526061

+

Top

FusionProtFeatures for LEPREL1_TP63


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
LEPREL1

TP63

Q9H3D4

Lectin that binds to various sugars: galactose > mannose= fucose > N-acetylglucosamine > N-acetylgalactosamine(PubMed:10224141). Acts as a chemoattractant, probably involved inthe regulation of cell migration (PubMed:28301481).{ECO:0000269|PubMed:10224141, ECO:0000269|PubMed:28301481}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneLEPREL1chr3:189838041chr3:189526061ENST00000319332-11593_99160709Compositional biasNote=Poly-Pro
HgeneLEPREL1chr3:189838041chr3:189526061ENST00000319332-11544_77160709RepeatNote=TPR 1
TgeneTP63chr3:189838041chr3:189526061ENST00000264731+214437_444108681Compositional biasNote=Poly-Gln
TgeneTP63chr3:189838041chr3:189526061ENST00000320472+212437_444108511Compositional biasNote=Poly-Gln
TgeneTP63chr3:189838041chr3:189526061ENST00000354600+012437_44414587Compositional biasNote=Poly-Gln
TgeneTP63chr3:189838041chr3:189526061ENST00000382063+013437_444-30596Compositional biasNote=Poly-Gln
TgeneTP63chr3:189838041chr3:189526061ENST00000392460+213437_444108556Compositional biasNote=Poly-Gln
TgeneTP63chr3:189838041chr3:189526061ENST00000392461+010437_44414417Compositional biasNote=Poly-Gln
TgeneTP63chr3:189838041chr3:189526061ENST00000392463+011437_44414462Compositional biasNote=Poly-Gln
TgeneTP63chr3:189838041chr3:189526061ENST00000418709+211437_444108488Compositional biasNote=Poly-Gln
TgeneTP63chr3:189838041chr3:189526061ENST00000437221+09437_44414394Compositional biasNote=Poly-Gln
TgeneTP63chr3:189838041chr3:189526061ENST00000440651+214437_444108677Compositional biasNote=Poly-Gln
TgeneTP63chr3:189838041chr3:189526061ENST00000449992+011437_4440502Compositional biasNote=Poly-Gln
TgeneTP63chr3:189838041chr3:189526061ENST00000456148+012437_44414583Compositional biasNote=Poly-Gln
TgeneTP63chr3:189838041chr3:189526061ENST00000264731+214170_362108681DNA binding.
TgeneTP63chr3:189838041chr3:189526061ENST00000320472+212170_362108511DNA binding.
TgeneTP63chr3:189838041chr3:189526061ENST00000354600+012170_36214587DNA binding.
TgeneTP63chr3:189838041chr3:189526061ENST00000382063+013170_362-30596DNA binding.
TgeneTP63chr3:189838041chr3:189526061ENST00000392460+213170_362108556DNA binding.
TgeneTP63chr3:189838041chr3:189526061ENST00000392461+010170_36214417DNA binding.
TgeneTP63chr3:189838041chr3:189526061ENST00000392463+011170_36214462DNA binding.
TgeneTP63chr3:189838041chr3:189526061ENST00000418709+211170_362108488DNA binding.
TgeneTP63chr3:189838041chr3:189526061ENST00000437221+09170_36214394DNA binding.
TgeneTP63chr3:189838041chr3:189526061ENST00000440651+214170_362108677DNA binding.
TgeneTP63chr3:189838041chr3:189526061ENST00000449992+011170_3620502DNA binding.
TgeneTP63chr3:189838041chr3:189526061ENST00000456148+012170_36214583DNA binding.
TgeneTP63chr3:189838041chr3:189526061ENST00000264731+214541_607108681DomainNote=SAM
TgeneTP63chr3:189838041chr3:189526061ENST00000320472+212541_607108511DomainNote=SAM
TgeneTP63chr3:189838041chr3:189526061ENST00000354600+012541_60714587DomainNote=SAM
TgeneTP63chr3:189838041chr3:189526061ENST00000382063+013541_607-30596DomainNote=SAM
TgeneTP63chr3:189838041chr3:189526061ENST00000392460+213541_607108556DomainNote=SAM
TgeneTP63chr3:189838041chr3:189526061ENST00000392461+010541_60714417DomainNote=SAM
TgeneTP63chr3:189838041chr3:189526061ENST00000392463+011541_60714462DomainNote=SAM
TgeneTP63chr3:189838041chr3:189526061ENST00000418709+211541_607108488DomainNote=SAM
TgeneTP63chr3:189838041chr3:189526061ENST00000437221+09541_60714394DomainNote=SAM
TgeneTP63chr3:189838041chr3:189526061ENST00000440651+214541_607108677DomainNote=SAM
TgeneTP63chr3:189838041chr3:189526061ENST00000449992+011541_6070502DomainNote=SAM
TgeneTP63chr3:189838041chr3:189526061ENST00000456148+012541_60714583DomainNote=SAM
TgeneTP63chr3:189838041chr3:189526061ENST00000264731+214394_443108681RegionNote=Oligomerization
TgeneTP63chr3:189838041chr3:189526061ENST00000264731+214610_680108681RegionNote=Transactivation inhibition
TgeneTP63chr3:189838041chr3:189526061ENST00000320472+212394_443108511RegionNote=Oligomerization
TgeneTP63chr3:189838041chr3:189526061ENST00000320472+212610_680108511RegionNote=Transactivation inhibition
TgeneTP63chr3:189838041chr3:189526061ENST00000354600+012394_44314587RegionNote=Oligomerization
TgeneTP63chr3:189838041chr3:189526061ENST00000354600+012610_68014587RegionNote=Transactivation inhibition
TgeneTP63chr3:189838041chr3:189526061ENST00000382063+0131_107-30596RegionNote=Transcription activation
TgeneTP63chr3:189838041chr3:189526061ENST00000382063+013394_443-30596RegionNote=Oligomerization
TgeneTP63chr3:189838041chr3:189526061ENST00000382063+013610_680-30596RegionNote=Transactivation inhibition
TgeneTP63chr3:189838041chr3:189526061ENST00000392460+213394_443108556RegionNote=Oligomerization
TgeneTP63chr3:189838041chr3:189526061ENST00000392460+213610_680108556RegionNote=Transactivation inhibition
TgeneTP63chr3:189838041chr3:189526061ENST00000392461+010394_44314417RegionNote=Oligomerization
TgeneTP63chr3:189838041chr3:189526061ENST00000392461+010610_68014417RegionNote=Transactivation inhibition
TgeneTP63chr3:189838041chr3:189526061ENST00000392463+011394_44314462RegionNote=Oligomerization
TgeneTP63chr3:189838041chr3:189526061ENST00000392463+011610_68014462RegionNote=Transactivation inhibition
TgeneTP63chr3:189838041chr3:189526061ENST00000418709+211394_443108488RegionNote=Oligomerization
TgeneTP63chr3:189838041chr3:189526061ENST00000418709+211610_680108488RegionNote=Transactivation inhibition
TgeneTP63chr3:189838041chr3:189526061ENST00000437221+09394_44314394RegionNote=Oligomerization
TgeneTP63chr3:189838041chr3:189526061ENST00000437221+09610_68014394RegionNote=Transactivation inhibition
TgeneTP63chr3:189838041chr3:189526061ENST00000440651+214394_443108677RegionNote=Oligomerization
TgeneTP63chr3:189838041chr3:189526061ENST00000440651+214610_680108677RegionNote=Transactivation inhibition
TgeneTP63chr3:189838041chr3:189526061ENST00000449992+0111_1070502RegionNote=Transcription activation
TgeneTP63chr3:189838041chr3:189526061ENST00000449992+011394_4430502RegionNote=Oligomerization
TgeneTP63chr3:189838041chr3:189526061ENST00000449992+011610_6800502RegionNote=Transactivation inhibition
TgeneTP63chr3:189838041chr3:189526061ENST00000456148+012394_44314583RegionNote=Oligomerization
TgeneTP63chr3:189838041chr3:189526061ENST00000456148+012610_68014583RegionNote=Transactivation inhibition

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneLEPREL1chr3:189838041chr3:189526061ENST00000319332-115557_671160709DomainFe2OG dioxygenase
HgeneLEPREL1chr3:189838041chr3:189526061ENST00000319332-115705_708160709MotifPrevents secretion from ER
HgeneLEPREL1chr3:189838041chr3:189526061ENST00000319332-115148_181160709RepeatNote=TPR 2
HgeneLEPREL1chr3:189838041chr3:189526061ENST00000319332-115210_243160709RepeatNote=TPR 3
HgeneLEPREL1chr3:189838041chr3:189526061ENST00000319332-115306_339160709RepeatNote=TPR 4
TgeneTP63chr3:189838041chr3:189526061ENST00000264731+2141_107108681RegionNote=Transcription activation
TgeneTP63chr3:189838041chr3:189526061ENST00000320472+2121_107108511RegionNote=Transcription activation
TgeneTP63chr3:189838041chr3:189526061ENST00000354600+0121_10714587RegionNote=Transcription activation
TgeneTP63chr3:189838041chr3:189526061ENST00000392460+2131_107108556RegionNote=Transcription activation
TgeneTP63chr3:189838041chr3:189526061ENST00000392461+0101_10714417RegionNote=Transcription activation
TgeneTP63chr3:189838041chr3:189526061ENST00000392463+0111_10714462RegionNote=Transcription activation
TgeneTP63chr3:189838041chr3:189526061ENST00000418709+2111_107108488RegionNote=Transcription activation
TgeneTP63chr3:189838041chr3:189526061ENST00000437221+091_10714394RegionNote=Transcription activation
TgeneTP63chr3:189838041chr3:189526061ENST00000440651+2141_107108677RegionNote=Transcription activation
TgeneTP63chr3:189838041chr3:189526061ENST00000456148+0121_10714583RegionNote=Transcription activation


Top

FusionGeneSequence for LEPREL1_TP63


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_LEPREL1_ENST00000319332_chr3_189838041_-_TP63_ENST00000264731_chr3_189526061_+_733aa
MRERIWAPPLLLLLPLLLPPPLWGGPPDSPRRELELEPGPLQPFDLLYASGAAAYYSGDYERAVRDLEAALRSHRRLREIRTRCARHCAA
RHPLPPPPPGEGPGAELPLFRSLLGRARCYRSCETQRLGGPASRHRVSEDVRSDFQRRVPYNYLQRAYIKPQYTNLGLLNSMDQQIQNGS
SSTSPYNTDHAQNSVTAPSPYAQPSSTFDALSPSPAIPSNTDYPGPHSFDVSFQQSSTAKSATWTYSTELKKLYCQIAKTCPIQIKVMTP
PPQGAVIRAMPVYKKAEHVTEVVKRCPNHELSREFNEGQIAPPSHLIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFTTVLYNFMC
NSSCVGGMNRRPILIIVTLETRDGQVLGRRCFEARICACPGRDRKADEDSIRKQQVSDSTKNGDGTKRPFRQNTHGIQMTSIKKRRSPDD
ELLYLPVRGRETYEMLLKIKESLELMQYLPQHTIETYRQQQQQQHQHLLQKQTSIQSPSSYGNSSPPLNKMNSMNKLPSVSQLINPQQRN
ALTPTTIPDGMGANIPMMGTHMPMAGDMNGLSPTQALPPPLSMPSTSHCTPPPPYPTDCSIVSFLARLGCSSCLDYFTTQGLTTIYQIEH
YSMDDLASLKIPEQFRHAIWKGILDHRQLHEFSSPSHLLRTPSSASTVSVGSSETRGERVIDAVRFTLRQTISFPPRDEWNDFNFDMDAR


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_LEPREL1_ENST00000319332_chr3_189838041_-_TP63_ENST00000264731_chr3_189526061_+_2199nt
ATGCGGGAGCGCATCTGGGCGCCGCCGCTGCTGCTGCTGCTGCCGCTGCTACTGCCGCCGCCACTGTGGGGCGGCCCCCCGGACAGCCCA
CGCCGGGAGCTGGAGCTGGAGCCCGGGCCTCTGCAGCCCTTCGACCTGCTCTACGCCAGCGGCGCGGCCGCCTACTACAGCGGAGACTAC
GAGCGAGCGGTGCGCGACTTGGAAGCGGCGCTGCGCAGCCACCGGCGCCTGCGGGAAATCCGCACGCGCTGTGCCCGCCACTGCGCGGCG
CGCCACCCGCTCCCGCCCCCGCCCCCCGGCGAGGGCCCCGGCGCTGAGCTGCCCCTTTTCCGCTCCTTGTTGGGGCGGGCGCGCTGTTAT
CGCAGCTGTGAGACCCAGCGCCTCGGGGGCCCCGCATCCCGCCACCGCGTCAGCGAGGATGTGCGCAGCGACTTCCAGCGCAGAGTGCCC
TACAACTACCTGCAGCGGGCCTACATCAAGCCACAGTACACGAACCTGGGGCTCCTGAACAGCATGGACCAGCAGATTCAGAACGGCTCC
TCGTCCACCAGTCCCTATAACACAGACCACGCGCAGAACAGCGTCACGGCGCCCTCGCCCTACGCACAGCCCAGCTCCACCTTCGATGCT
CTCTCTCCATCACCCGCCATCCCCTCCAACACCGACTACCCAGGCCCGCACAGTTTCGACGTGTCCTTCCAGCAGTCGAGCACCGCCAAG
TCGGCCACCTGGACGTATTCCACTGAACTGAAGAAACTCTACTGCCAAATTGCAAAGACATGCCCCATCCAGATCAAGGTGATGACCCCA
CCTCCTCAGGGAGCTGTTATCCGCGCCATGCCTGTCTACAAAAAAGCTGAGCACGTCACGGAGGTGGTGAAGCGGTGCCCCAACCATGAG
CTGAGCCGTGAATTCAACGAGGGACAGATTGCCCCTCCTAGTCATTTGATTCGAGTAGAGGGGAACAGCCATGCCCAGTATGTAGAAGAT
CCCATCACAGGAAGACAGAGTGTGCTGGTACCTTATGAGCCACCCCAGGTTGGCACTGAATTCACGACAGTCTTGTACAATTTCATGTGT
AACAGCAGTTGTGTTGGAGGGATGAACCGCCGTCCAATTTTAATCATTGTTACTCTGGAAACCAGAGATGGGCAAGTCCTGGGCCGACGC
TGCTTTGAGGCCCGGATCTGTGCTTGCCCAGGAAGAGACAGGAAGGCGGATGAAGATAGCATCAGAAAGCAGCAAGTTTCGGACAGTACA
AAGAACGGTGATGGTACGAAGCGCCCGTTTCGTCAGAACACACATGGTATCCAGATGACATCCATCAAGAAACGAAGATCCCCAGATGAT
GAACTGTTATACTTACCAGTGAGGGGCCGTGAGACTTATGAAATGCTGTTGAAGATCAAAGAGTCCCTGGAACTCATGCAGTACCTTCCT
CAGCACACAATTGAAACGTACAGGCAACAGCAACAGCAGCAGCACCAGCACTTACTTCAGAAACAGACCTCAATACAGTCTCCATCTTCA
TATGGTAACAGCTCCCCACCTCTGAACAAAATGAACAGCATGAACAAGCTGCCTTCTGTGAGCCAGCTTATCAACCCTCAGCAGCGCAAC
GCCCTCACTCCTACAACCATTCCTGATGGCATGGGAGCCAACATTCCCATGATGGGCACCCACATGCCAATGGCTGGAGACATGAATGGA
CTCAGCCCCACCCAGGCACTCCCTCCCCCACTCTCCATGCCATCCACCTCCCACTGCACACCCCCACCTCCGTATCCCACAGATTGCAGC
ATTGTCAGTTTCTTAGCGAGGTTGGGCTGTTCATCATGTCTGGACTATTTCACGACCCAGGGGCTGACCACCATCTATCAGATTGAGCAT
TACTCCATGGATGATCTGGCAAGTCTGAAAATCCCTGAGCAATTTCGACATGCGATCTGGAAGGGCATCCTGGACCACCGGCAGCTCCAC
GAATTCTCCTCCCCTTCTCATCTCCTGCGGACCCCAAGCAGTGCCTCTACAGTCAGTGTGGGCTCCAGTGAGACCCGGGGTGAGCGTGTT
ATTGATGCTGTGCGATTCACCCTCCGCCAGACCATCTCTTTCCCACCCCGAGATGAGTGGAATGACTTCAACTTTGACATGGATGCTCGC


* Fusion transcript sequences (Full-length transcript).
>In-frame_LEPREL1_ENST00000319332_chr3_189838041_-_TP63_ENST00000264731_chr3_189526061_+_5174nt
CCTTTAAGAGCGGCTGGCCAGGCACGGCCTCCGCCTCTCAGTACGCGGAGCGCCGGCGGTCACCTGGGGCTCGCGGAGCGGCCAGATCGC
GGCGGAGTCGGCGCGCTTCCCCGAGGGAAGGTGGGAGAGGGGACCCGGACGCGAGGTGCCCCGAAGCCCTCTCGAGCGTAACCGTCCCGC
GCCTCTCTGAGGCGGAGGATGCGGGAGCGCATCTGGGCGCCGCCGCTGCTGCTGCTGCTGCCGCTGCTACTGCCGCCGCCACTGTGGGGC
GGCCCCCCGGACAGCCCACGCCGGGAGCTGGAGCTGGAGCCCGGGCCTCTGCAGCCCTTCGACCTGCTCTACGCCAGCGGCGCGGCCGCC
TACTACAGCGGAGACTACGAGCGAGCGGTGCGCGACTTGGAAGCGGCGCTGCGCAGCCACCGGCGCCTGCGGGAAATCCGCACGCGCTGT
GCCCGCCACTGCGCGGCGCGCCACCCGCTCCCGCCCCCGCCCCCCGGCGAGGGCCCCGGCGCTGAGCTGCCCCTTTTCCGCTCCTTGTTG
GGGCGGGCGCGCTGTTATCGCAGCTGTGAGACCCAGCGCCTCGGGGGCCCCGCATCCCGCCACCGCGTCAGCGAGGATGTGCGCAGCGAC
TTCCAGCGCAGAGTGCCCTACAACTACCTGCAGCGGGCCTACATCAAGCCACAGTACACGAACCTGGGGCTCCTGAACAGCATGGACCAG
CAGATTCAGAACGGCTCCTCGTCCACCAGTCCCTATAACACAGACCACGCGCAGAACAGCGTCACGGCGCCCTCGCCCTACGCACAGCCC
AGCTCCACCTTCGATGCTCTCTCTCCATCACCCGCCATCCCCTCCAACACCGACTACCCAGGCCCGCACAGTTTCGACGTGTCCTTCCAG
CAGTCGAGCACCGCCAAGTCGGCCACCTGGACGTATTCCACTGAACTGAAGAAACTCTACTGCCAAATTGCAAAGACATGCCCCATCCAG
ATCAAGGTGATGACCCCACCTCCTCAGGGAGCTGTTATCCGCGCCATGCCTGTCTACAAAAAAGCTGAGCACGTCACGGAGGTGGTGAAG
CGGTGCCCCAACCATGAGCTGAGCCGTGAATTCAACGAGGGACAGATTGCCCCTCCTAGTCATTTGATTCGAGTAGAGGGGAACAGCCAT
GCCCAGTATGTAGAAGATCCCATCACAGGAAGACAGAGTGTGCTGGTACCTTATGAGCCACCCCAGGTTGGCACTGAATTCACGACAGTC
TTGTACAATTTCATGTGTAACAGCAGTTGTGTTGGAGGGATGAACCGCCGTCCAATTTTAATCATTGTTACTCTGGAAACCAGAGATGGG
CAAGTCCTGGGCCGACGCTGCTTTGAGGCCCGGATCTGTGCTTGCCCAGGAAGAGACAGGAAGGCGGATGAAGATAGCATCAGAAAGCAG
CAAGTTTCGGACAGTACAAAGAACGGTGATGGTACGAAGCGCCCGTTTCGTCAGAACACACATGGTATCCAGATGACATCCATCAAGAAA
CGAAGATCCCCAGATGATGAACTGTTATACTTACCAGTGAGGGGCCGTGAGACTTATGAAATGCTGTTGAAGATCAAAGAGTCCCTGGAA
CTCATGCAGTACCTTCCTCAGCACACAATTGAAACGTACAGGCAACAGCAACAGCAGCAGCACCAGCACTTACTTCAGAAACAGACCTCA
ATACAGTCTCCATCTTCATATGGTAACAGCTCCCCACCTCTGAACAAAATGAACAGCATGAACAAGCTGCCTTCTGTGAGCCAGCTTATC
AACCCTCAGCAGCGCAACGCCCTCACTCCTACAACCATTCCTGATGGCATGGGAGCCAACATTCCCATGATGGGCACCCACATGCCAATG
GCTGGAGACATGAATGGACTCAGCCCCACCCAGGCACTCCCTCCCCCACTCTCCATGCCATCCACCTCCCACTGCACACCCCCACCTCCG
TATCCCACAGATTGCAGCATTGTCAGTTTCTTAGCGAGGTTGGGCTGTTCATCATGTCTGGACTATTTCACGACCCAGGGGCTGACCACC
ATCTATCAGATTGAGCATTACTCCATGGATGATCTGGCAAGTCTGAAAATCCCTGAGCAATTTCGACATGCGATCTGGAAGGGCATCCTG
GACCACCGGCAGCTCCACGAATTCTCCTCCCCTTCTCATCTCCTGCGGACCCCAAGCAGTGCCTCTACAGTCAGTGTGGGCTCCAGTGAG
ACCCGGGGTGAGCGTGTTATTGATGCTGTGCGATTCACCCTCCGCCAGACCATCTCTTTCCCACCCCGAGATGAGTGGAATGACTTCAAC
TTTGACATGGATGCTCGCCGCAATAAGCAACAGCGCATCAAAGAGGAGGGGGAGTGAGCCTCACCATGTGAGCTCTTCCTATCCCTCTCC
TAACTGCCAGCCCCCTAAAAGCACTCCTGCTTAATCTTCAAAGCCTTCTCCCTAGCTCCTCCCCTTCCTCTTGTCTGATTTCTTAGGGGA
AGGAGAAGTAAGAGGCTACCTCTTACCTAACATCTGACCTGGCATCTAATTCTGATTCTGGCTTTAAGCCTTCAAAACTATAGCTTGCAG
AACTGTAGCTGCCATGGCTAGGTAGAAGTGAGCAAAAAAGAGTTGGGTGTCTCCTTAAGCTGCAGAGATTTCTCATTGACTTTTATAAAG
CATGTTCACCCTTATAGTCTAAGACTATATATATAAATGTATAAATATACAGTATAGATTTTTGGGTGGGGGGCATTGAGTATTGTTTAA
AATGTAATTTAAATGAAAGAAAATTGAGTTGCACTTATTGACCATTTTTTAATTTACTTGTTTTGGATGGCTTGTCTATACTCCTTCCCT
TAAGGGGTATCATGTATGGTGATAGGTATCTAGAGCTTAATGCTACATGTGAGTGACGATGATGTACAGATTCTTTCAGTTCTTTGGATT
CTAAATACATGCCACATCAAACCTTTGAGTAGATCCATTTCCATTGCTTATTATGTAGGTAAGACTGTAGATATGTATTCTTTTCTCAGT
GTTGGTATATTTTATATTACTGACATTTCTTCTAGTGATGATGGTTCACGTTGGGGTGATTTAATCCAGTTATAAGAAGAAGTTCATGTC
CAAACGTCCTCTTTAGTTTTTGGTTGGGAATGAGGAAAATTCTTAAAAGGCCCATAGCAGCCAGTTCAAAAACACCCGACGTCATGTATT
TGAGCATATCAGTAACCCCCTTAAATTTAATACCAGATACCTTATCTTACAATATTGATTGGGAAAACATTTGCTGCCATTACAGAGGTA
TTAAAACTAAATTTCACTACTAGATTGACTAACTCAAATACACATTTGCTACTGTTGTAAGAATTCTGATTGATTTGATTGGGATGAATG
CCATCTATCTAGTTCTAACAGTGAAGTTTTACTGTCTATTAATATTCAGGGTAAATAGGAATCATTCAGAAATGTTGAGTCTGTACTAAA
CAGTAAGATATCTCAATGAACCATAAATTCAACTTTGTAAAAATCTTTTGAAGCATAGATAATATTGTTTGGTAAATGTTTCTTTTGTTT
GGTAAATGTTTCTTTTAAAGACCCTCCTATTCTATAAAACTCTGCATGTAGAGGCTTGTTTACCTTTCTCTCTCTAAGGTTTACAATAGG
AGTGGTGATTTGAAAAATATAAAATTATGAGATTGGTTTTCCTGTGGCATAAATTGCATCACTGTATCATTTTCTTTTTTAACCGGTAAG
AGTTTCAGTTTGTTGGAAAGTAACTGTGAGAACCCAGTTTCCCGTCCATCTCCCTTAGGGACTACCCATAGACATGAAAGGTCCCCACAG
AGCAAGAGATAAGTCTTTCATGGCTGCTGTTGCTTAAACCACTTAAACGAAGAGTTCCCTTGAAACTTTGGGAAAACATGTTAATGACAA
TATTCCAGATCTTTCAGAAATATAACACATTTTTTTGCATGCATGCAAATGAGCTCTGAAATCTTCCCATGCATTCTGGTCAAGGGCTGT
CATTGCACATAAGCTTCCATTTTAATTTTAAAGTGCAAAAGGGCCAGCGTGGCTCTAAAAGGTAATGTGTGGATTGCCTCTGAAAAGTGT
GTATATATTTTGTGTGAAATTGCATACTTTGTATTTTGATTATTTTTTTTTTCTTCTTGGGATAGTGGGATTTCCAGAACCACACTTGAA
ACCTTTTTTTATCGTTTTTGTATTTTCATGAAAATACCATTTAGTAAGAATACCACATCAAATAAGAAATAATGCTACAATTTTAAGAGG
GGAGGGAAGGGAAAGTTTTTTTTTATTATTTTTTTAAAATTTTGTATGTTAAAGAGAATGAGTCCTTGATTTCAAAGTTTTGTTGTACTT
AAATGGTAATAAGCACTGTAAACTTCTGCAACAAGCATGCAGCTTTGCAAACCCATTAAGGGGAAGAATGAAAGCTGTTCCTTGGTCCTA
GTAAGAAGACAAACTGCTTCCCTTACTTTGCTGAGGGTTTGAATAAACCTAGGACTTCCGAGCTATGTCAGTACTATTCAGGTAACACTA
GGGCCTTGGAAATTCCTGTACTGTGTCTCATGGATTTGGCACTAGCCAAAGCGAGGCACCCTTACTGGCTTACCTCCTCATGGCAGCCTA
CTCTCCTTGAGTGTATGAGTAGCCAGGGTAAGGGGTAAAAGGATAGTAAGCATAGAAACCACTAGAAAGTGGGCTTAATGGAGTTCTTGT
GGCCTCAGCTCAATGCAGTTAGCTGAAGAATTGAAAAGTTTTTGTTTGGAGACGTTTATAAACAGAAATGGAAAGCAGAGTTTTCATTAA
ATCCTTTTACCTTTTTTTTTTCTTGGTAATCCCCTAAAATAACAGTATGTGGGATATTGAATGTTAAAGGGATATTTTTTTCTATTATTT
TTATAATTGTACAAAATTAAGCAAATGTTAAAAGTTTTATATGCTTTATTAATGTTTTCAAAAGGTATTATACATGTGATACATTTTTTA
AGCTTCAGTTGCTTGTCTTCTGGTACTTTCTGTTATGGGCTTTTGGGGAGCCAGAAGCCAATCTACAATCTCTTTTTGTTTGCCAGGACA


Top

FusionGenePPI for LEPREL1_TP63


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
LEPREL1TP63HNRNPAB, GNB2L1, SCAF4, YAP1, HIPK2, BTRC, ADH5, AGBL2, ASPM, BRD8, NPRL3, TRAPPC11, CDT1, DAB2IP, DDX23, DNAJB6, DPH1, AGO1, AGO2, GAS8, IGF2BP1, LOC613037, JPH1, MTHFSD, MYL9, N4BP2, PIWIL1, RNF38, SMARCD2, TRMT11, EMX1, ITCH, MDM2, MDM4, WWP1, RELA, BRCA1, CHUK, IKBKB, FBXW7, CDKN2A, CDKN1A, TP53, RBL2, SFN, UBE2I, SUMO1, UBE4B, DAXX, PML, RCHY1, WWOX, FAS, CAD, FLNC, DHX9, SEC24C, VCP, SACS, PSMD2, HNRNPR, GOLGA4, HSPA5, FUS, A2M, SYNCRIP, ZNF676, TP63, CPSF6, PLS3, KRT5, CARM1, HNRNPL, CCT8, NONO, HNRNPK, KRT6C, TUBA1C, ATP5A1, RPL3, EEF1A1, RPSA, ZBTB4, HNRNPCL1, HNRNPA3, MAP1A, RPLP0, HIST1H1D, UACA, SNRPA, UPF2, CENPE, SAFB, S1PR5, RPL24, RPL13A, RPL12, MYLPF, HSP90AB1, ETV4, CEBPB, NFYA, NFKB1, STK11, NIPSNAP3A, ORM1, CCNC, ITIH4, BAG6, GCGR, HP, HPX, COPS6, SLC35A3, PINX1, SMAD3, RNF144B, EP300, KAT2B, CEP83, CHEK2, TP73, SH3KBP1, RPH3A, FOXK1, FOXK2, PEX14, ATF3


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
TgeneTP63chr3:189838041chr3:189526061ENST00000264731+214352_388108681HIPK2
TgeneTP63chr3:189838041chr3:189526061ENST00000320472+212352_388108511HIPK2
TgeneTP63chr3:189838041chr3:189526061ENST00000354600+012352_38814587HIPK2
TgeneTP63chr3:189838041chr3:189526061ENST00000382063+013352_388-30596HIPK2
TgeneTP63chr3:189838041chr3:189526061ENST00000392460+213352_388108556HIPK2
TgeneTP63chr3:189838041chr3:189526061ENST00000392461+010352_38814417HIPK2
TgeneTP63chr3:189838041chr3:189526061ENST00000392463+011352_38814462HIPK2
TgeneTP63chr3:189838041chr3:189526061ENST00000418709+211352_388108488HIPK2
TgeneTP63chr3:189838041chr3:189526061ENST00000437221+09352_38814394HIPK2
TgeneTP63chr3:189838041chr3:189526061ENST00000440651+214352_388108677HIPK2
TgeneTP63chr3:189838041chr3:189526061ENST00000449992+011352_3880502HIPK2
TgeneTP63chr3:189838041chr3:189526061ENST00000456148+012352_38814583HIPK2


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for LEPREL1_TP63


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for LEPREL1_TP63


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneTP63C1785148RAPP-HODGKIN SYNDROME6CTD_human;ORPHANET;UNIPROT
TgeneTP63C1858562ECTRODACTYLY, ECTODERMAL DYSPLASIA, AND CLEFT LIP/PALATE SYNDROME 35CTD_human;UNIPROT
TgeneTP63C0406709Hay-Wells syndrome3CTD_human;UNIPROT
TgeneTP63C0024121Lung Neoplasms2CTD_human
TgeneTP63C1854442SPLIT-HAND/FOOT MALFORMATION 42CTD_human;UNIPROT
TgeneTP63C0001418Adenocarcinoma1CTD_human
TgeneTP63C0006145Breast Diseases1CTD_human
TgeneTP63C0007137Squamous cell carcinoma1CTD_human
TgeneTP63C0007621Neoplastic Cell Transformation1CTD_human
TgeneTP63C0008924Cleft Lip1CTD_human;HPO;ORPHANET
TgeneTP63C0008925Cleft Palate1CTD_human;HPO
TgeneTP63C0009404Colorectal Neoplasms1CTD_human
TgeneTP63C0016508Congenital Foot Deformity1CTD_human
TgeneTP63C0018566Congenital Hand Deformities1CTD_human
TgeneTP63C0027627Neoplasm Metastasis1CTD_human
TgeneTP63C0030297Pancreatic Neoplasm1CTD_human
TgeneTP63C0037268Skin Abnormalities1CTD_human
TgeneTP63C0038987Sweat Gland Neoplasms1CTD_human
TgeneTP63C0152013Adenocarcinoma of lung (disorder)1CTD_human
TgeneTP63C0206720Squamous Cell Neoplasms1CTD_human
TgeneTP63C0206762Limb Deformities, Congenital1CTD_human
TgeneTP63C0376634Craniofacial Abnormalities1CTD_human
TgeneTP63C0406704Rudiger syndrome 11CTD_human;ORPHANET
TgeneTP63C0919267ovarian neoplasm1CTD_human
TgeneTP63C1720887Female Urogenital Diseases1CTD_human
TgeneTP63C1863204ADULT SYNDROME1CTD_human;ORPHANET;UNIPROT
TgeneTP63C1863753LIMB-MAMMARY SYNDROME1CTD_human;ORPHANET