FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 19565

FusionGeneSummary for LDLRAD3_CD44

check button Fusion gene summary
Fusion gene informationFusion gene name: LDLRAD3_CD44
Fusion gene ID: 19565
HgeneTgene
Gene symbol

LDLRAD3

CD44

Gene ID

143458

960

Gene namelow density lipoprotein receptor class A domain containing 3CD44 molecule (Indian blood group)
SynonymsLRAD3CDW44|CSPG8|ECMR-III|HCELL|HUTCH-I|IN|LHR|MC56|MDU2|MDU3|MIC4|Pgp1
Cytomap

11p13

11p13

Type of geneprotein-codingprotein-coding
Descriptionlow-density lipoprotein receptor class A domain-containing protein 3CD44 antigenGP90 lymphocyte homing/adhesion receptorHermes antigencell surface glycoprotein CD44chondroitin sulfate proteoglycan 8epicanextracellular matrix receptor IIIhematopoietic cell E- and L-selectin ligandheparan sulfate proteoglycanhoming
Modification date2018051920180527
UniProtAcc

Q86YD5

P16070

Ensembl transtripts involved in fusion geneENST00000524419, ENST00000528989, 
ENST00000315571, ENST00000529759, 
ENST00000263398, ENST00000526025, 
ENST00000449691, ENST00000360158, 
ENST00000415148, ENST00000437706, 
ENST00000433354, ENST00000428726, 
ENST00000526669, ENST00000433892, 
ENST00000278386, ENST00000434472, 
ENST00000352818, ENST00000528922, 
Fusion gene scores* DoF score11 X 4 X 7=3086 X 7 X 3=126
# samples 129
** MAII scorelog2(12/308*10)=-1.35989594508638
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(9/126*10)=-0.485426827170242
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: LDLRAD3 [Title/Abstract] AND CD44 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneCD44

GO:0030214

hyaluronan catabolic process

17170110

TgeneCD44

GO:0033138

positive regulation of peptidyl-serine phosphorylation

17045821

TgeneCD44

GO:0043518

negative regulation of DNA damage response, signal transduction by p53 class mediator

17045821

TgeneCD44

GO:0044344

cellular response to fibroblast growth factor stimulus

19577615

TgeneCD44

GO:0050731

positive regulation of peptidyl-tyrosine phosphorylation

17045821

TgeneCD44

GO:0070374

positive regulation of ERK1 and ERK2 cascade

17045821

TgeneCD44

GO:1902166

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

17045821


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBRCATCGA-E9-A22G-01ALDLRAD3chr11

35965694

+CD44chr11

35198122

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000524419ENST00000263398LDLRAD3chr11

35965694

+CD44chr11

35198122

+
Frame-shitENST00000524419ENST00000526025LDLRAD3chr11

35965694

+CD44chr11

35198122

+
In-frameENST00000524419ENST00000449691LDLRAD3chr11

35965694

+CD44chr11

35198122

+
In-frameENST00000524419ENST00000360158LDLRAD3chr11

35965694

+CD44chr11

35198122

+
In-frameENST00000524419ENST00000415148LDLRAD3chr11

35965694

+CD44chr11

35198122

+
In-frameENST00000524419ENST00000437706LDLRAD3chr11

35965694

+CD44chr11

35198122

+
In-frameENST00000524419ENST00000433354LDLRAD3chr11

35965694

+CD44chr11

35198122

+
In-frameENST00000524419ENST00000428726LDLRAD3chr11

35965694

+CD44chr11

35198122

+
In-frameENST00000524419ENST00000526669LDLRAD3chr11

35965694

+CD44chr11

35198122

+
In-frameENST00000524419ENST00000433892LDLRAD3chr11

35965694

+CD44chr11

35198122

+
In-frameENST00000524419ENST00000278386LDLRAD3chr11

35965694

+CD44chr11

35198122

+
In-frameENST00000524419ENST00000434472LDLRAD3chr11

35965694

+CD44chr11

35198122

+
In-frameENST00000524419ENST00000352818LDLRAD3chr11

35965694

+CD44chr11

35198122

+
5CDS-intronENST00000524419ENST00000528922LDLRAD3chr11

35965694

+CD44chr11

35198122

+
In-frameENST00000528989ENST00000263398LDLRAD3chr11

35965694

+CD44chr11

35198122

+
Frame-shitENST00000528989ENST00000526025LDLRAD3chr11

35965694

+CD44chr11

35198122

+
In-frameENST00000528989ENST00000449691LDLRAD3chr11

35965694

+CD44chr11

35198122

+
In-frameENST00000528989ENST00000360158LDLRAD3chr11

35965694

+CD44chr11

35198122

+
In-frameENST00000528989ENST00000415148LDLRAD3chr11

35965694

+CD44chr11

35198122

+
In-frameENST00000528989ENST00000437706LDLRAD3chr11

35965694

+CD44chr11

35198122

+
In-frameENST00000528989ENST00000433354LDLRAD3chr11

35965694

+CD44chr11

35198122

+
In-frameENST00000528989ENST00000428726LDLRAD3chr11

35965694

+CD44chr11

35198122

+
In-frameENST00000528989ENST00000526669LDLRAD3chr11

35965694

+CD44chr11

35198122

+
In-frameENST00000528989ENST00000433892LDLRAD3chr11

35965694

+CD44chr11

35198122

+
In-frameENST00000528989ENST00000278386LDLRAD3chr11

35965694

+CD44chr11

35198122

+
In-frameENST00000528989ENST00000434472LDLRAD3chr11

35965694

+CD44chr11

35198122

+
In-frameENST00000528989ENST00000352818LDLRAD3chr11

35965694

+CD44chr11

35198122

+
5CDS-intronENST00000528989ENST00000528922LDLRAD3chr11

35965694

+CD44chr11

35198122

+
In-frameENST00000315571ENST00000263398LDLRAD3chr11

35965694

+CD44chr11

35198122

+
Frame-shitENST00000315571ENST00000526025LDLRAD3chr11

35965694

+CD44chr11

35198122

+
In-frameENST00000315571ENST00000449691LDLRAD3chr11

35965694

+CD44chr11

35198122

+
In-frameENST00000315571ENST00000360158LDLRAD3chr11

35965694

+CD44chr11

35198122

+
In-frameENST00000315571ENST00000415148LDLRAD3chr11

35965694

+CD44chr11

35198122

+
In-frameENST00000315571ENST00000437706LDLRAD3chr11

35965694

+CD44chr11

35198122

+
In-frameENST00000315571ENST00000433354LDLRAD3chr11

35965694

+CD44chr11

35198122

+
In-frameENST00000315571ENST00000428726LDLRAD3chr11

35965694

+CD44chr11

35198122

+
In-frameENST00000315571ENST00000526669LDLRAD3chr11

35965694

+CD44chr11

35198122

+
In-frameENST00000315571ENST00000433892LDLRAD3chr11

35965694

+CD44chr11

35198122

+
In-frameENST00000315571ENST00000278386LDLRAD3chr11

35965694

+CD44chr11

35198122

+
In-frameENST00000315571ENST00000434472LDLRAD3chr11

35965694

+CD44chr11

35198122

+
In-frameENST00000315571ENST00000352818LDLRAD3chr11

35965694

+CD44chr11

35198122

+
5CDS-intronENST00000315571ENST00000528922LDLRAD3chr11

35965694

+CD44chr11

35198122

+
intron-3CDSENST00000529759ENST00000263398LDLRAD3chr11

35965694

+CD44chr11

35198122

+
intron-3CDSENST00000529759ENST00000526025LDLRAD3chr11

35965694

+CD44chr11

35198122

+
intron-3CDSENST00000529759ENST00000449691LDLRAD3chr11

35965694

+CD44chr11

35198122

+
intron-3CDSENST00000529759ENST00000360158LDLRAD3chr11

35965694

+CD44chr11

35198122

+
intron-3CDSENST00000529759ENST00000415148LDLRAD3chr11

35965694

+CD44chr11

35198122

+
intron-3CDSENST00000529759ENST00000437706LDLRAD3chr11

35965694

+CD44chr11

35198122

+
intron-3CDSENST00000529759ENST00000433354LDLRAD3chr11

35965694

+CD44chr11

35198122

+
intron-3CDSENST00000529759ENST00000428726LDLRAD3chr11

35965694

+CD44chr11

35198122

+
intron-3CDSENST00000529759ENST00000526669LDLRAD3chr11

35965694

+CD44chr11

35198122

+
intron-3CDSENST00000529759ENST00000433892LDLRAD3chr11

35965694

+CD44chr11

35198122

+
intron-3CDSENST00000529759ENST00000278386LDLRAD3chr11

35965694

+CD44chr11

35198122

+
intron-3CDSENST00000529759ENST00000434472LDLRAD3chr11

35965694

+CD44chr11

35198122

+
intron-3CDSENST00000529759ENST00000352818LDLRAD3chr11

35965694

+CD44chr11

35198122

+
intron-intronENST00000529759ENST00000528922LDLRAD3chr11

35965694

+CD44chr11

35198122

+

Top

FusionProtFeatures for LDLRAD3_CD44


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
LDLRAD3

Q86YD5

CD44

P16070

May influence APP processing, resulting in a decrease insAPP-alpha production and increased amyloidogenic P3 peptideproduction. {ECO:0000250}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneCD44chr11:35965694chr11:35198122ENST00000263398+09150_15822362Compositional biasNote=Arg/Lys-rich (basic)
TgeneCD44chr11:35965694chr11:35198122ENST00000278386+04150_15822140Compositional biasNote=Arg/Lys-rich (basic)
TgeneCD44chr11:35965694chr11:35198122ENST00000352818+08150_15822341Compositional biasNote=Arg/Lys-rich (basic)
TgeneCD44chr11:35965694chr11:35198122ENST00000360158+010150_15822397Compositional biasNote=Arg/Lys-rich (basic)
TgeneCD44chr11:35965694chr11:35198122ENST00000415148+017150_15822700Compositional biasNote=Arg/Lys-rich (basic)
TgeneCD44chr11:35965694chr11:35198122ENST00000428726+018150_15822743Compositional biasNote=Arg/Lys-rich (basic)
TgeneCD44chr11:35965694chr11:35198122ENST00000433892+012150_15822494Compositional biasNote=Arg/Lys-rich (basic)
TgeneCD44chr11:35965694chr11:35198122ENST00000434472+010150_15822430Compositional biasNote=Arg/Lys-rich (basic)
TgeneCD44chr11:35965694chr11:35198122ENST00000437706+017150_15822675Compositional biasNote=Arg/Lys-rich (basic)
TgeneCD44chr11:35965694chr11:35198122ENST00000449691+017150_15822700Compositional biasNote=Arg/Lys-rich (basic)
TgeneCD44chr11:35965694chr11:35198122ENST00000263398+0932_12022362DomainLink
TgeneCD44chr11:35965694chr11:35198122ENST00000278386+0432_12022140DomainLink
TgeneCD44chr11:35965694chr11:35198122ENST00000352818+0832_12022341DomainLink
TgeneCD44chr11:35965694chr11:35198122ENST00000360158+01032_12022397DomainLink
TgeneCD44chr11:35965694chr11:35198122ENST00000415148+01732_12022700DomainLink
TgeneCD44chr11:35965694chr11:35198122ENST00000428726+01832_12022743DomainLink
TgeneCD44chr11:35965694chr11:35198122ENST00000433892+01232_12022494DomainLink
TgeneCD44chr11:35965694chr11:35198122ENST00000434472+01032_12022430DomainLink
TgeneCD44chr11:35965694chr11:35198122ENST00000437706+01732_12022675DomainLink
TgeneCD44chr11:35965694chr11:35198122ENST00000449691+01732_12022700DomainLink
TgeneCD44chr11:35965694chr11:35198122ENST00000263398+09224_64922362RegionNote=Stem
TgeneCD44chr11:35965694chr11:35198122ENST00000278386+04224_64922140RegionNote=Stem
TgeneCD44chr11:35965694chr11:35198122ENST00000352818+08224_64922341RegionNote=Stem
TgeneCD44chr11:35965694chr11:35198122ENST00000360158+010224_64922397RegionNote=Stem
TgeneCD44chr11:35965694chr11:35198122ENST00000415148+017224_64922700RegionNote=Stem
TgeneCD44chr11:35965694chr11:35198122ENST00000428726+018224_64922743RegionNote=Stem
TgeneCD44chr11:35965694chr11:35198122ENST00000433892+012224_64922494RegionNote=Stem
TgeneCD44chr11:35965694chr11:35198122ENST00000434472+010224_64922430RegionNote=Stem
TgeneCD44chr11:35965694chr11:35198122ENST00000437706+017224_64922675RegionNote=Stem
TgeneCD44chr11:35965694chr11:35198122ENST00000449691+017224_64922700RegionNote=Stem
TgeneCD44chr11:35965694chr11:35198122ENST00000263398+0921_64922362Topological domainExtracellular
TgeneCD44chr11:35965694chr11:35198122ENST00000263398+09671_74222362Topological domainCytoplasmic
TgeneCD44chr11:35965694chr11:35198122ENST00000278386+0421_64922140Topological domainExtracellular
TgeneCD44chr11:35965694chr11:35198122ENST00000278386+04671_74222140Topological domainCytoplasmic
TgeneCD44chr11:35965694chr11:35198122ENST00000352818+0821_64922341Topological domainExtracellular
TgeneCD44chr11:35965694chr11:35198122ENST00000352818+08671_74222341Topological domainCytoplasmic
TgeneCD44chr11:35965694chr11:35198122ENST00000360158+01021_64922397Topological domainExtracellular
TgeneCD44chr11:35965694chr11:35198122ENST00000360158+010671_74222397Topological domainCytoplasmic
TgeneCD44chr11:35965694chr11:35198122ENST00000415148+01721_64922700Topological domainExtracellular
TgeneCD44chr11:35965694chr11:35198122ENST00000415148+017671_74222700Topological domainCytoplasmic
TgeneCD44chr11:35965694chr11:35198122ENST00000428726+01821_64922743Topological domainExtracellular
TgeneCD44chr11:35965694chr11:35198122ENST00000428726+018671_74222743Topological domainCytoplasmic
TgeneCD44chr11:35965694chr11:35198122ENST00000433892+01221_64922494Topological domainExtracellular
TgeneCD44chr11:35965694chr11:35198122ENST00000433892+012671_74222494Topological domainCytoplasmic
TgeneCD44chr11:35965694chr11:35198122ENST00000434472+01021_64922430Topological domainExtracellular
TgeneCD44chr11:35965694chr11:35198122ENST00000434472+010671_74222430Topological domainCytoplasmic
TgeneCD44chr11:35965694chr11:35198122ENST00000437706+01721_64922675Topological domainExtracellular
TgeneCD44chr11:35965694chr11:35198122ENST00000437706+017671_74222675Topological domainCytoplasmic
TgeneCD44chr11:35965694chr11:35198122ENST00000449691+01721_64922700Topological domainExtracellular
TgeneCD44chr11:35965694chr11:35198122ENST00000449691+017671_74222700Topological domainCytoplasmic
TgeneCD44chr11:35965694chr11:35198122ENST00000263398+09650_67022362TransmembraneHelical
TgeneCD44chr11:35965694chr11:35198122ENST00000278386+04650_67022140TransmembraneHelical
TgeneCD44chr11:35965694chr11:35198122ENST00000352818+08650_67022341TransmembraneHelical
TgeneCD44chr11:35965694chr11:35198122ENST00000360158+010650_67022397TransmembraneHelical
TgeneCD44chr11:35965694chr11:35198122ENST00000415148+017650_67022700TransmembraneHelical
TgeneCD44chr11:35965694chr11:35198122ENST00000428726+018650_67022743TransmembraneHelical
TgeneCD44chr11:35965694chr11:35198122ENST00000433892+012650_67022494TransmembraneHelical
TgeneCD44chr11:35965694chr11:35198122ENST00000434472+010650_67022430TransmembraneHelical
TgeneCD44chr11:35965694chr11:35198122ENST00000437706+017650_67022675TransmembraneHelical
TgeneCD44chr11:35965694chr11:35198122ENST00000449691+017650_67022700TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneLDLRAD3chr11:35965694chr11:35198122ENST00000315571+16274_27715346Compositional biasNote=Poly-Pro
HgeneLDLRAD3chr11:35965694chr11:35198122ENST00000315571+16112_14815346DomainLDL-receptor class A 3
HgeneLDLRAD3chr11:35965694chr11:35198122ENST00000315571+1628_6515346DomainLDL-receptor class A 1
HgeneLDLRAD3chr11:35965694chr11:35198122ENST00000315571+1670_10715346DomainLDL-receptor class A 2
HgeneLDLRAD3chr11:35965694chr11:35198122ENST00000315571+1618_17315346Topological domainExtracellular
HgeneLDLRAD3chr11:35965694chr11:35198122ENST00000315571+16195_34515346Topological domainCytoplasmic
HgeneLDLRAD3chr11:35965694chr11:35198122ENST00000315571+16174_19415346TransmembraneHelical


Top

FusionGeneSequence for LDLRAD3_CD44


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_LDLRAD3_ENST00000524419_chr11_35965694_+_CD44_ENST00000263398_chr11_35198122_+_355aa
MWLLGPLCLLLSSAADLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSIC
AANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDVSSGSSSERS
STSGGYIFYTFSTVHPIPDEDSPWITDSTDRIPATRDQDTFHPSGGSHTTHGSESDGHSHGSQEGGANTTSGPIRTPQIPEWLIILASLL

>In-frame_LDLRAD3_ENST00000524419_chr11_35965694_+_CD44_ENST00000449691_chr11_35198122_+_693aa
MWLLGPLCLLLSSAADLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSIC
AANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDVSSGSSSERS
STSGGYIFYTFSTVHPIPDEDSPWITDSTDRIPATTLMSTSATATETATKRQETWDWFSWLFLPSESKNHLHTTTQMAGTSSNTISAGWE
PNEENEDERDRHLSFSGSGIDDDEDFISSTISTTPRAFDHTKQNQDWTQWNPSHSNPEVLLQTTTRMTDVDRNGTTAYEGNWNPEAHPPL
IHHEHHEEEETPHSTSTTASAHTSHPMQGRTTPSPEDSSWTDFFNPISHPMGRGHQAGRRMDMDSSHSITLQPTANPNTGLVEDLDRTGP
LSMTTQQSNSQSFSTSHEGLEEDKDHPTTSTLTSSNRNDVTGGRRDPNHSEGSTTLLEGYTSHYPHTKESRTFIPVTSAKTGSFGVTAVT
VGDSNSNVNRSLSGDQDTFHPSGGSHTTHGSESDGHSHGSQEGGANTTSGPIRTPQIPEWLIILASLLALALILAVCIAVNSRRRCGQKK

>In-frame_LDLRAD3_ENST00000524419_chr11_35965694_+_CD44_ENST00000360158_chr11_35198122_+_390aa
MWLLGPLCLLLSSAADLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSIC
AANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDVSSGSSSERS
STSGGYIFYTFSTVHPIPDEDSPWITDSTDRIPATNMDSSHSITLQPTANPNTGLVEDLDRTGPLSMTTRRDQDTFHPSGGSHTTHGSES
DGHSHGSQEGGANTTSGPIRTPQIPEWLIILASLLALALILAVCIAVNSRRRCGQKKKLVINSGNGAVEDRKPSGLNGEASKSQEMVHLV

>In-frame_LDLRAD3_ENST00000524419_chr11_35965694_+_CD44_ENST00000415148_chr11_35198122_+_693aa
MWLLGPLCLLLSSAADLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSIC
AANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDVSSGSSSERS
STSGGYIFYTFSTVHPIPDEDSPWITDSTDRIPATSTSSNTISAGWEPNEENEDERDRHLSFSGSGIDDDEDFISSTISTTPRAFDHTKQ
NQDWTQWNPSHSNPEVLLQTTTRMTDVDRNGTTAYEGNWNPEAHPPLIHHEHHEEEETPHSTSTIQATPSSTTEETATQKEQWFGNRWHE
GYRQTPKEDSHSTTGTAAASAHTSHPMQGRTTPSPEDSSWTDFFNPISHPMGRGHQAGRRMDMDSSHSITLQPTANPNTGLVEDLDRTGP
LSMTTQQSNSQSFSTSHEGLEEDKDHPTTSTLTSSNRNDVTGGRRDPNHSEGSTTLLEGYTSHYPHTKESRTFIPVTSAKTGSFGVTAVT
VGDSNSNVNRSLSGDQDTFHPSGGSHTTHGSESDGHSHGSQEGGANTTSGPIRTPQIPEWLIILASLLALALILAVCIAVNSRRRCGQKK

>In-frame_LDLRAD3_ENST00000524419_chr11_35965694_+_CD44_ENST00000437706_chr11_35198122_+_668aa
MWLLGPLCLLLSSAADLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSIC
AANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDVSSGSSSERS
STSGGYIFYTFSTVHPIPDEDSPWITDSTDRIPATTLMSTSATATETATKRQETWDWFSWLFLPSESKNHLHTTTQMAGTSSNTISAGWE
PNEENEDERDRHLSFSGSGIDDDEDFISSTISTTPRAFDHTKQNQDWTQWNPSHSNPEVLLQTTTRMTDVDRNGTTAYEGNWNPEAHPPL
IHHEHHEEEETPHSTSTIQATPSSTTEETATQKEQWFGNRWHEGYRQTPKEDSHSTTGTAAASAHTSHPMQGRTTPSPEDSSWTDFFNPI
SHPMGRGHQAGRRMDMDSSHSITLQPTANPNTGLVEDLDRTGPLSMTTQQSNSQSFSTSHEGLEEDKDHPTTSTLTSSRDQDTFHPSGGS
HTTHGSESDGHSHGSQEGGANTTSGPIRTPQIPEWLIILASLLALALILAVCIAVNSRRRCGQKKKLVINSGNGAVEDRKPSGLNGEASK

>In-frame_LDLRAD3_ENST00000524419_chr11_35965694_+_CD44_ENST00000433354_chr11_35198122_+_708aa
MWLLGPLCLLLSSAADLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSIC
AANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDVSSGSSSERS
STSGGYIFYTFSTVHPIPDEDSPWITDSTDRIPATTLMSTSATATETATKRQETWDWFSWLFLPSESKNHLHTTTQMAGTSSNTISAGWE
PNEENEDERDRHLSFSGSGIDDDEDFISSTISTTPRAFDHTKQNQDWTQWNPSHSNPEVLLQTTTRMTADVDRNGTTAYEGNWNPEAHPP
LIHHEHHEEEETPHSTSTIQATPSSTTEETATQKEQWFGNRWHEGYRQTPKEDSHSTTGTAAASAHTSHPMQGRTTPSPEDSSWTDFFNP
ISHPMGRGHQAGRRMDMDSSHSITLQPTANPNTGLVEDLDRTGPLSMTTRNRNDVTGGRRDPNHSEGSTTLLEGYTSHYPHTKESRTFIP
VTSAKTGSFGVTAVTVGDSNSNVNRSLSGDQDTFHPSGGSHTTHGSESDGHSHGSQEGGANTTSGPIRTPQIPEWLIILASLLALALILA

>In-frame_LDLRAD3_ENST00000524419_chr11_35965694_+_CD44_ENST00000428726_chr11_35198122_+_736aa
MWLLGPLCLLLSSAADLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSIC
AANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDVSSGSSSERS
STSGGYIFYTFSTVHPIPDEDSPWITDSTDRIPATTLMSTSATATETATKRQETWDWFSWLFLPSESKNHLHTTTQMAGTSSNTISAGWE
PNEENEDERDRHLSFSGSGIDDDEDFISSTISTTPRAFDHTKQNQDWTQWNPSHSNPEVLLQTTTRMTDVDRNGTTAYEGNWNPEAHPPL
IHHEHHEEEETPHSTSTIQATPSSTTEETATQKEQWFGNRWHEGYRQTPKEDSHSTTGTAAASAHTSHPMQGRTTPSPEDSSWTDFFNPI
SHPMGRGHQAGRRMDMDSSHSITLQPTANPNTGLVEDLDRTGPLSMTTQQSNSQSFSTSHEGLEEDKDHPTTSTLTSSNRNDVTGGRRDP
NHSEGSTTLLEGYTSHYPHTKESRTFIPVTSAKTGSFGVTAVTVGDSNSNVNRSLSGDQDTFHPSGGSHTTHGSESDGHSHGSQEGGANT
TSGPIRTPQIPEWLIILASLLALALILAVCIAVNSRRRCGQKKKLVINSGNGAVEDRKPSGLNGEASKSQEMVHLVNKESSETPDQFMTA

>In-frame_LDLRAD3_ENST00000524419_chr11_35965694_+_CD44_ENST00000526669_chr11_35198122_+_200aa
MWLLGPLCLLLSSAADLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSIC
GANTTSGPIRTPQIPEWLIILASLLALALILAVCIAVNSRRRCGQKKKLVINSGNGAVEDRKPSGLNGEASKSQEMVHLVNKESSETPDQ

>In-frame_LDLRAD3_ENST00000524419_chr11_35965694_+_CD44_ENST00000433892_chr11_35198122_+_487aa
MWLLGPLCLLLSSAADLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSIC
AANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDVSSGSSSERS
STSGGYIFYTFSTVHPIPDEDSPWITDSTDRIPATNMDSSHSITLQPTANPNTGLVEDLDRTGPLSMTTQQSNSQSFSTSHEGLEEDKDH
PTTSTLTSSNRNDVTGGRRDPNHSEGSTTLLEGYTSHYPHTKESRTFIPVTSAKTGSFGVTAVTVGDSNSNVNRSLSGDQDTFHPSGGSH
TTHGSESDGHSHGSQEGGANTTSGPIRTPQIPEWLIILASLLALALILAVCIAVNSRRRCGQKKKLVINSGNGAVEDRKPSGLNGEASKS

>In-frame_LDLRAD3_ENST00000524419_chr11_35965694_+_CD44_ENST00000278386_chr11_35198122_+_133aa
MWLLGPLCLLLSSAADLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETCSLHCSQQSKKVWAEEKASDQ

>In-frame_LDLRAD3_ENST00000524419_chr11_35965694_+_CD44_ENST00000434472_chr11_35198122_+_423aa
MWLLGPLCLLLSSAADLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSIC
AANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDVSSGSSSERS
STSGGYIFYTFSTVHPIPDEDSPWITDSTDRIPATNRNDVTGGRRDPNHSEGSTTLLEGYTSHYPHTKESRTFIPVTSAKTGSFGVTAVT
VGDSNSNVNRSLSGDQDTFHPSGGSHTTHGSESDGHSHGSQEGGANTTSGPIRTPQIPEWLIILASLLALALILAVCIAVNSRRRCGQKK

>In-frame_LDLRAD3_ENST00000524419_chr11_35965694_+_CD44_ENST00000352818_chr11_35198122_+_334aa
MWLLGPLCLLLSSAADLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSIC
AANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDVSSGSSSERS
STSGGYIFYTFSTVHPIPDEDSPWITDSTDRIPATRHSHGSQEGGANTTSGPIRTPQIPEWLIILASLLALALILAVCIAVNSRRRCGQK

>In-frame_LDLRAD3_ENST00000528989_chr11_35965694_+_CD44_ENST00000263398_chr11_35198122_+_355aa
MWLLGPLCLLLSSAADLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSIC
AANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDVSSGSSSERS
STSGGYIFYTFSTVHPIPDEDSPWITDSTDRIPATRDQDTFHPSGGSHTTHGSESDGHSHGSQEGGANTTSGPIRTPQIPEWLIILASLL

>In-frame_LDLRAD3_ENST00000528989_chr11_35965694_+_CD44_ENST00000449691_chr11_35198122_+_693aa
MWLLGPLCLLLSSAADLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSIC
AANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDVSSGSSSERS
STSGGYIFYTFSTVHPIPDEDSPWITDSTDRIPATTLMSTSATATETATKRQETWDWFSWLFLPSESKNHLHTTTQMAGTSSNTISAGWE
PNEENEDERDRHLSFSGSGIDDDEDFISSTISTTPRAFDHTKQNQDWTQWNPSHSNPEVLLQTTTRMTDVDRNGTTAYEGNWNPEAHPPL
IHHEHHEEEETPHSTSTTASAHTSHPMQGRTTPSPEDSSWTDFFNPISHPMGRGHQAGRRMDMDSSHSITLQPTANPNTGLVEDLDRTGP
LSMTTQQSNSQSFSTSHEGLEEDKDHPTTSTLTSSNRNDVTGGRRDPNHSEGSTTLLEGYTSHYPHTKESRTFIPVTSAKTGSFGVTAVT
VGDSNSNVNRSLSGDQDTFHPSGGSHTTHGSESDGHSHGSQEGGANTTSGPIRTPQIPEWLIILASLLALALILAVCIAVNSRRRCGQKK

>In-frame_LDLRAD3_ENST00000528989_chr11_35965694_+_CD44_ENST00000360158_chr11_35198122_+_390aa
MWLLGPLCLLLSSAADLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSIC
AANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDVSSGSSSERS
STSGGYIFYTFSTVHPIPDEDSPWITDSTDRIPATNMDSSHSITLQPTANPNTGLVEDLDRTGPLSMTTRRDQDTFHPSGGSHTTHGSES
DGHSHGSQEGGANTTSGPIRTPQIPEWLIILASLLALALILAVCIAVNSRRRCGQKKKLVINSGNGAVEDRKPSGLNGEASKSQEMVHLV

>In-frame_LDLRAD3_ENST00000528989_chr11_35965694_+_CD44_ENST00000415148_chr11_35198122_+_693aa
MWLLGPLCLLLSSAADLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSIC
AANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDVSSGSSSERS
STSGGYIFYTFSTVHPIPDEDSPWITDSTDRIPATSTSSNTISAGWEPNEENEDERDRHLSFSGSGIDDDEDFISSTISTTPRAFDHTKQ
NQDWTQWNPSHSNPEVLLQTTTRMTDVDRNGTTAYEGNWNPEAHPPLIHHEHHEEEETPHSTSTIQATPSSTTEETATQKEQWFGNRWHE
GYRQTPKEDSHSTTGTAAASAHTSHPMQGRTTPSPEDSSWTDFFNPISHPMGRGHQAGRRMDMDSSHSITLQPTANPNTGLVEDLDRTGP
LSMTTQQSNSQSFSTSHEGLEEDKDHPTTSTLTSSNRNDVTGGRRDPNHSEGSTTLLEGYTSHYPHTKESRTFIPVTSAKTGSFGVTAVT
VGDSNSNVNRSLSGDQDTFHPSGGSHTTHGSESDGHSHGSQEGGANTTSGPIRTPQIPEWLIILASLLALALILAVCIAVNSRRRCGQKK

>In-frame_LDLRAD3_ENST00000528989_chr11_35965694_+_CD44_ENST00000437706_chr11_35198122_+_668aa
MWLLGPLCLLLSSAADLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSIC
AANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDVSSGSSSERS
STSGGYIFYTFSTVHPIPDEDSPWITDSTDRIPATTLMSTSATATETATKRQETWDWFSWLFLPSESKNHLHTTTQMAGTSSNTISAGWE
PNEENEDERDRHLSFSGSGIDDDEDFISSTISTTPRAFDHTKQNQDWTQWNPSHSNPEVLLQTTTRMTDVDRNGTTAYEGNWNPEAHPPL
IHHEHHEEEETPHSTSTIQATPSSTTEETATQKEQWFGNRWHEGYRQTPKEDSHSTTGTAAASAHTSHPMQGRTTPSPEDSSWTDFFNPI
SHPMGRGHQAGRRMDMDSSHSITLQPTANPNTGLVEDLDRTGPLSMTTQQSNSQSFSTSHEGLEEDKDHPTTSTLTSSRDQDTFHPSGGS
HTTHGSESDGHSHGSQEGGANTTSGPIRTPQIPEWLIILASLLALALILAVCIAVNSRRRCGQKKKLVINSGNGAVEDRKPSGLNGEASK

>In-frame_LDLRAD3_ENST00000528989_chr11_35965694_+_CD44_ENST00000433354_chr11_35198122_+_708aa
MWLLGPLCLLLSSAADLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSIC
AANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDVSSGSSSERS
STSGGYIFYTFSTVHPIPDEDSPWITDSTDRIPATTLMSTSATATETATKRQETWDWFSWLFLPSESKNHLHTTTQMAGTSSNTISAGWE
PNEENEDERDRHLSFSGSGIDDDEDFISSTISTTPRAFDHTKQNQDWTQWNPSHSNPEVLLQTTTRMTADVDRNGTTAYEGNWNPEAHPP
LIHHEHHEEEETPHSTSTIQATPSSTTEETATQKEQWFGNRWHEGYRQTPKEDSHSTTGTAAASAHTSHPMQGRTTPSPEDSSWTDFFNP
ISHPMGRGHQAGRRMDMDSSHSITLQPTANPNTGLVEDLDRTGPLSMTTRNRNDVTGGRRDPNHSEGSTTLLEGYTSHYPHTKESRTFIP
VTSAKTGSFGVTAVTVGDSNSNVNRSLSGDQDTFHPSGGSHTTHGSESDGHSHGSQEGGANTTSGPIRTPQIPEWLIILASLLALALILA

>In-frame_LDLRAD3_ENST00000528989_chr11_35965694_+_CD44_ENST00000428726_chr11_35198122_+_736aa
MWLLGPLCLLLSSAADLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSIC
AANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDVSSGSSSERS
STSGGYIFYTFSTVHPIPDEDSPWITDSTDRIPATTLMSTSATATETATKRQETWDWFSWLFLPSESKNHLHTTTQMAGTSSNTISAGWE
PNEENEDERDRHLSFSGSGIDDDEDFISSTISTTPRAFDHTKQNQDWTQWNPSHSNPEVLLQTTTRMTDVDRNGTTAYEGNWNPEAHPPL
IHHEHHEEEETPHSTSTIQATPSSTTEETATQKEQWFGNRWHEGYRQTPKEDSHSTTGTAAASAHTSHPMQGRTTPSPEDSSWTDFFNPI
SHPMGRGHQAGRRMDMDSSHSITLQPTANPNTGLVEDLDRTGPLSMTTQQSNSQSFSTSHEGLEEDKDHPTTSTLTSSNRNDVTGGRRDP
NHSEGSTTLLEGYTSHYPHTKESRTFIPVTSAKTGSFGVTAVTVGDSNSNVNRSLSGDQDTFHPSGGSHTTHGSESDGHSHGSQEGGANT
TSGPIRTPQIPEWLIILASLLALALILAVCIAVNSRRRCGQKKKLVINSGNGAVEDRKPSGLNGEASKSQEMVHLVNKESSETPDQFMTA

>In-frame_LDLRAD3_ENST00000528989_chr11_35965694_+_CD44_ENST00000526669_chr11_35198122_+_200aa
MWLLGPLCLLLSSAADLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSIC
GANTTSGPIRTPQIPEWLIILASLLALALILAVCIAVNSRRRCGQKKKLVINSGNGAVEDRKPSGLNGEASKSQEMVHLVNKESSETPDQ

>In-frame_LDLRAD3_ENST00000528989_chr11_35965694_+_CD44_ENST00000433892_chr11_35198122_+_487aa
MWLLGPLCLLLSSAADLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSIC
AANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDVSSGSSSERS
STSGGYIFYTFSTVHPIPDEDSPWITDSTDRIPATNMDSSHSITLQPTANPNTGLVEDLDRTGPLSMTTQQSNSQSFSTSHEGLEEDKDH
PTTSTLTSSNRNDVTGGRRDPNHSEGSTTLLEGYTSHYPHTKESRTFIPVTSAKTGSFGVTAVTVGDSNSNVNRSLSGDQDTFHPSGGSH
TTHGSESDGHSHGSQEGGANTTSGPIRTPQIPEWLIILASLLALALILAVCIAVNSRRRCGQKKKLVINSGNGAVEDRKPSGLNGEASKS

>In-frame_LDLRAD3_ENST00000528989_chr11_35965694_+_CD44_ENST00000278386_chr11_35198122_+_133aa
MWLLGPLCLLLSSAADLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETCSLHCSQQSKKVWAEEKASDQ

>In-frame_LDLRAD3_ENST00000528989_chr11_35965694_+_CD44_ENST00000434472_chr11_35198122_+_423aa
MWLLGPLCLLLSSAADLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSIC
AANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDVSSGSSSERS
STSGGYIFYTFSTVHPIPDEDSPWITDSTDRIPATNRNDVTGGRRDPNHSEGSTTLLEGYTSHYPHTKESRTFIPVTSAKTGSFGVTAVT
VGDSNSNVNRSLSGDQDTFHPSGGSHTTHGSESDGHSHGSQEGGANTTSGPIRTPQIPEWLIILASLLALALILAVCIAVNSRRRCGQKK

>In-frame_LDLRAD3_ENST00000528989_chr11_35965694_+_CD44_ENST00000352818_chr11_35198122_+_334aa
MWLLGPLCLLLSSAADLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSIC
AANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDVSSGSSSERS
STSGGYIFYTFSTVHPIPDEDSPWITDSTDRIPATRHSHGSQEGGANTTSGPIRTPQIPEWLIILASLLALALILAVCIAVNSRRRCGQK

>In-frame_LDLRAD3_ENST00000315571_chr11_35965694_+_CD44_ENST00000263398_chr11_35198122_+_355aa
MWLLGPLCLLLSSAADLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSIC
AANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDVSSGSSSERS
STSGGYIFYTFSTVHPIPDEDSPWITDSTDRIPATRDQDTFHPSGGSHTTHGSESDGHSHGSQEGGANTTSGPIRTPQIPEWLIILASLL

>In-frame_LDLRAD3_ENST00000315571_chr11_35965694_+_CD44_ENST00000449691_chr11_35198122_+_693aa
MWLLGPLCLLLSSAADLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSIC
AANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDVSSGSSSERS
STSGGYIFYTFSTVHPIPDEDSPWITDSTDRIPATTLMSTSATATETATKRQETWDWFSWLFLPSESKNHLHTTTQMAGTSSNTISAGWE
PNEENEDERDRHLSFSGSGIDDDEDFISSTISTTPRAFDHTKQNQDWTQWNPSHSNPEVLLQTTTRMTDVDRNGTTAYEGNWNPEAHPPL
IHHEHHEEEETPHSTSTTASAHTSHPMQGRTTPSPEDSSWTDFFNPISHPMGRGHQAGRRMDMDSSHSITLQPTANPNTGLVEDLDRTGP
LSMTTQQSNSQSFSTSHEGLEEDKDHPTTSTLTSSNRNDVTGGRRDPNHSEGSTTLLEGYTSHYPHTKESRTFIPVTSAKTGSFGVTAVT
VGDSNSNVNRSLSGDQDTFHPSGGSHTTHGSESDGHSHGSQEGGANTTSGPIRTPQIPEWLIILASLLALALILAVCIAVNSRRRCGQKK

>In-frame_LDLRAD3_ENST00000315571_chr11_35965694_+_CD44_ENST00000360158_chr11_35198122_+_390aa
MWLLGPLCLLLSSAADLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSIC
AANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDVSSGSSSERS
STSGGYIFYTFSTVHPIPDEDSPWITDSTDRIPATNMDSSHSITLQPTANPNTGLVEDLDRTGPLSMTTRRDQDTFHPSGGSHTTHGSES
DGHSHGSQEGGANTTSGPIRTPQIPEWLIILASLLALALILAVCIAVNSRRRCGQKKKLVINSGNGAVEDRKPSGLNGEASKSQEMVHLV

>In-frame_LDLRAD3_ENST00000315571_chr11_35965694_+_CD44_ENST00000415148_chr11_35198122_+_693aa
MWLLGPLCLLLSSAADLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSIC
AANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDVSSGSSSERS
STSGGYIFYTFSTVHPIPDEDSPWITDSTDRIPATSTSSNTISAGWEPNEENEDERDRHLSFSGSGIDDDEDFISSTISTTPRAFDHTKQ
NQDWTQWNPSHSNPEVLLQTTTRMTDVDRNGTTAYEGNWNPEAHPPLIHHEHHEEEETPHSTSTIQATPSSTTEETATQKEQWFGNRWHE
GYRQTPKEDSHSTTGTAAASAHTSHPMQGRTTPSPEDSSWTDFFNPISHPMGRGHQAGRRMDMDSSHSITLQPTANPNTGLVEDLDRTGP
LSMTTQQSNSQSFSTSHEGLEEDKDHPTTSTLTSSNRNDVTGGRRDPNHSEGSTTLLEGYTSHYPHTKESRTFIPVTSAKTGSFGVTAVT
VGDSNSNVNRSLSGDQDTFHPSGGSHTTHGSESDGHSHGSQEGGANTTSGPIRTPQIPEWLIILASLLALALILAVCIAVNSRRRCGQKK

>In-frame_LDLRAD3_ENST00000315571_chr11_35965694_+_CD44_ENST00000437706_chr11_35198122_+_668aa
MWLLGPLCLLLSSAADLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSIC
AANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDVSSGSSSERS
STSGGYIFYTFSTVHPIPDEDSPWITDSTDRIPATTLMSTSATATETATKRQETWDWFSWLFLPSESKNHLHTTTQMAGTSSNTISAGWE
PNEENEDERDRHLSFSGSGIDDDEDFISSTISTTPRAFDHTKQNQDWTQWNPSHSNPEVLLQTTTRMTDVDRNGTTAYEGNWNPEAHPPL
IHHEHHEEEETPHSTSTIQATPSSTTEETATQKEQWFGNRWHEGYRQTPKEDSHSTTGTAAASAHTSHPMQGRTTPSPEDSSWTDFFNPI
SHPMGRGHQAGRRMDMDSSHSITLQPTANPNTGLVEDLDRTGPLSMTTQQSNSQSFSTSHEGLEEDKDHPTTSTLTSSRDQDTFHPSGGS
HTTHGSESDGHSHGSQEGGANTTSGPIRTPQIPEWLIILASLLALALILAVCIAVNSRRRCGQKKKLVINSGNGAVEDRKPSGLNGEASK

>In-frame_LDLRAD3_ENST00000315571_chr11_35965694_+_CD44_ENST00000433354_chr11_35198122_+_708aa
MWLLGPLCLLLSSAADLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSIC
AANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDVSSGSSSERS
STSGGYIFYTFSTVHPIPDEDSPWITDSTDRIPATTLMSTSATATETATKRQETWDWFSWLFLPSESKNHLHTTTQMAGTSSNTISAGWE
PNEENEDERDRHLSFSGSGIDDDEDFISSTISTTPRAFDHTKQNQDWTQWNPSHSNPEVLLQTTTRMTADVDRNGTTAYEGNWNPEAHPP
LIHHEHHEEEETPHSTSTIQATPSSTTEETATQKEQWFGNRWHEGYRQTPKEDSHSTTGTAAASAHTSHPMQGRTTPSPEDSSWTDFFNP
ISHPMGRGHQAGRRMDMDSSHSITLQPTANPNTGLVEDLDRTGPLSMTTRNRNDVTGGRRDPNHSEGSTTLLEGYTSHYPHTKESRTFIP
VTSAKTGSFGVTAVTVGDSNSNVNRSLSGDQDTFHPSGGSHTTHGSESDGHSHGSQEGGANTTSGPIRTPQIPEWLIILASLLALALILA

>In-frame_LDLRAD3_ENST00000315571_chr11_35965694_+_CD44_ENST00000428726_chr11_35198122_+_736aa
MWLLGPLCLLLSSAADLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSIC
AANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDVSSGSSSERS
STSGGYIFYTFSTVHPIPDEDSPWITDSTDRIPATTLMSTSATATETATKRQETWDWFSWLFLPSESKNHLHTTTQMAGTSSNTISAGWE
PNEENEDERDRHLSFSGSGIDDDEDFISSTISTTPRAFDHTKQNQDWTQWNPSHSNPEVLLQTTTRMTDVDRNGTTAYEGNWNPEAHPPL
IHHEHHEEEETPHSTSTIQATPSSTTEETATQKEQWFGNRWHEGYRQTPKEDSHSTTGTAAASAHTSHPMQGRTTPSPEDSSWTDFFNPI
SHPMGRGHQAGRRMDMDSSHSITLQPTANPNTGLVEDLDRTGPLSMTTQQSNSQSFSTSHEGLEEDKDHPTTSTLTSSNRNDVTGGRRDP
NHSEGSTTLLEGYTSHYPHTKESRTFIPVTSAKTGSFGVTAVTVGDSNSNVNRSLSGDQDTFHPSGGSHTTHGSESDGHSHGSQEGGANT
TSGPIRTPQIPEWLIILASLLALALILAVCIAVNSRRRCGQKKKLVINSGNGAVEDRKPSGLNGEASKSQEMVHLVNKESSETPDQFMTA

>In-frame_LDLRAD3_ENST00000315571_chr11_35965694_+_CD44_ENST00000526669_chr11_35198122_+_200aa
MWLLGPLCLLLSSAADLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSIC
GANTTSGPIRTPQIPEWLIILASLLALALILAVCIAVNSRRRCGQKKKLVINSGNGAVEDRKPSGLNGEASKSQEMVHLVNKESSETPDQ

>In-frame_LDLRAD3_ENST00000315571_chr11_35965694_+_CD44_ENST00000433892_chr11_35198122_+_487aa
MWLLGPLCLLLSSAADLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSIC
AANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDVSSGSSSERS
STSGGYIFYTFSTVHPIPDEDSPWITDSTDRIPATNMDSSHSITLQPTANPNTGLVEDLDRTGPLSMTTQQSNSQSFSTSHEGLEEDKDH
PTTSTLTSSNRNDVTGGRRDPNHSEGSTTLLEGYTSHYPHTKESRTFIPVTSAKTGSFGVTAVTVGDSNSNVNRSLSGDQDTFHPSGGSH
TTHGSESDGHSHGSQEGGANTTSGPIRTPQIPEWLIILASLLALALILAVCIAVNSRRRCGQKKKLVINSGNGAVEDRKPSGLNGEASKS

>In-frame_LDLRAD3_ENST00000315571_chr11_35965694_+_CD44_ENST00000278386_chr11_35198122_+_133aa
MWLLGPLCLLLSSAADLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETCSLHCSQQSKKVWAEEKASDQ

>In-frame_LDLRAD3_ENST00000315571_chr11_35965694_+_CD44_ENST00000434472_chr11_35198122_+_423aa
MWLLGPLCLLLSSAADLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSIC
AANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDVSSGSSSERS
STSGGYIFYTFSTVHPIPDEDSPWITDSTDRIPATNRNDVTGGRRDPNHSEGSTTLLEGYTSHYPHTKESRTFIPVTSAKTGSFGVTAVT
VGDSNSNVNRSLSGDQDTFHPSGGSHTTHGSESDGHSHGSQEGGANTTSGPIRTPQIPEWLIILASLLALALILAVCIAVNSRRRCGQKK

>In-frame_LDLRAD3_ENST00000315571_chr11_35965694_+_CD44_ENST00000352818_chr11_35198122_+_334aa
MWLLGPLCLLLSSAADLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSIC
AANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDVSSGSSSERS
STSGGYIFYTFSTVHPIPDEDSPWITDSTDRIPATRHSHGSQEGGANTTSGPIRTPQIPEWLIILASLLALALILAVCIAVNSRRRCGQK


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_LDLRAD3_ENST00000524419_chr11_35965694_+_CD44_ENST00000263398_chr11_35198122_+_1065nt
ATGTGGCTGCTGGGGCCGCTGTGCCTGCTGCTGAGCAGCGCCGCGGATTTGAATATAACCTGCCGCTTTGCAGGTGTATTCCACGTGGAG
AAAAATGGTCGCTACAGCATCTCTCGGACGGAGGCCGCTGACCTCTGCAAGGCTTTCAATAGCACCTTGCCCACAATGGCCCAGATGGAG
AAAGCTCTGAGCATCGGATTTGAGACCTGCAGGTATGGGTTCATAGAAGGGCACGTGGTGATTCCCCGGATCCACCCCAACTCCATCTGT
GCAGCAAACAACACAGGGGTGTACATCCTCACATCCAACACCTCCCAGTATGACACATATTGCTTCAATGCTTCAGCTCCACCTGAAGAA
GATTGTACATCAGTCACAGACCTGCCCAATGCCTTTGATGGACCAATTACCATAACTATTGTTAACCGTGATGGCACCCGCTATGTCCAG
AAAGGAGAATACAGAACGAATCCTGAAGACATCTACCCCAGCAACCCTACTGATGATGACGTGAGCAGCGGCTCCTCCAGTGAAAGGAGC
AGCACTTCAGGAGGTTACATCTTTTACACCTTTTCTACTGTACACCCCATCCCAGACGAAGACAGTCCCTGGATCACCGACAGCACAGAC
AGAATCCCTGCTACCAGAGACCAAGACACATTCCACCCCAGTGGGGGGTCCCATACCACTCATGGATCTGAATCAGATGGACACTCACAT
GGGAGTCAAGAAGGTGGAGCAAACACAACCTCTGGTCCTATAAGGACACCCCAAATTCCAGAATGGCTGATCATCTTGGCATCCCTCTTG
GCCTTGGCTTTGATTCTTGCAGTTTGCATTGCAGTCAACAGTCGAAGAAGGTGTGGGCAGAAGAAAAAGCTAGTGATCAACAGTGGCAAT
GGAGCTGTGGAGGACAGAAAGCCAAGTGGACTCAACGGAGAGGCCAGCAAGTCTCAGGAAATGGTGCATTTGGTGAACAAGGAGTCGTCA

>In-frame_LDLRAD3_ENST00000524419_chr11_35965694_+_CD44_ENST00000449691_chr11_35198122_+_2079nt
ATGTGGCTGCTGGGGCCGCTGTGCCTGCTGCTGAGCAGCGCCGCGGATTTGAATATAACCTGCCGCTTTGCAGGTGTATTCCACGTGGAG
AAAAATGGTCGCTACAGCATCTCTCGGACGGAGGCCGCTGACCTCTGCAAGGCTTTCAATAGCACCTTGCCCACAATGGCCCAGATGGAG
AAAGCTCTGAGCATCGGATTTGAGACCTGCAGGTATGGGTTCATAGAAGGGCACGTGGTGATTCCCCGGATCCACCCCAACTCCATCTGT
GCAGCAAACAACACAGGGGTGTACATCCTCACATCCAACACCTCCCAGTATGACACATATTGCTTCAATGCTTCAGCTCCACCTGAAGAA
GATTGTACATCAGTCACAGACCTGCCCAATGCCTTTGATGGACCAATTACCATAACTATTGTTAACCGTGATGGCACCCGCTATGTCCAG
AAAGGAGAATACAGAACGAATCCTGAAGACATCTACCCCAGCAACCCTACTGATGATGACGTGAGCAGCGGCTCCTCCAGTGAAAGGAGC
AGCACTTCAGGAGGTTACATCTTTTACACCTTTTCTACTGTACACCCCATCCCAGACGAAGACAGTCCCTGGATCACCGACAGCACAGAC
AGAATCCCTGCTACCACTTTGATGAGCACTAGTGCTACAGCAACTGAGACAGCAACCAAGAGGCAAGAAACCTGGGATTGGTTTTCATGG
TTGTTTCTACCATCAGAGTCAAAGAATCATCTTCACACAACAACACAAATGGCTGGTACGTCTTCAAATACCATCTCAGCAGGCTGGGAG
CCAAATGAAGAAAATGAAGATGAAAGAGACAGACACCTCAGTTTTTCTGGATCAGGCATTGATGATGATGAAGATTTTATCTCCAGCACC
ATTTCAACCACACCACGGGCTTTTGACCACACAAAACAGAACCAGGACTGGACCCAGTGGAACCCAAGCCATTCAAATCCGGAAGTGCTA
CTTCAGACAACCACAAGGATGACTGATGTAGACAGAAATGGCACCACTGCTTATGAAGGAAACTGGAACCCAGAAGCACACCCTCCCCTC
ATTCACCATGAGCATCATGAGGAAGAAGAGACCCCACATTCTACAAGCACAACAGCCTCAGCTCATACCAGCCATCCAATGCAAGGAAGG
ACAACACCAAGCCCAGAGGACAGTTCCTGGACTGATTTCTTCAACCCAATCTCACACCCCATGGGACGAGGTCATCAAGCAGGAAGAAGG
ATGGATATGGACTCCAGTCATAGTATAACGCTTCAGCCTACTGCAAATCCAAACACAGGTTTGGTGGAAGATTTGGACAGGACAGGACCT
CTTTCAATGACAACGCAGCAGAGTAATTCTCAGAGCTTCTCTACATCACATGAAGGCTTGGAAGAAGATAAAGACCATCCAACAACTTCT
ACTCTGACATCAAGCAATAGGAATGATGTCACAGGTGGAAGAAGAGACCCAAATCATTCTGAAGGCTCAACTACTTTACTGGAAGGTTAT
ACCTCTCATTACCCACACACGAAGGAAAGCAGGACCTTCATCCCAGTGACCTCAGCTAAGACTGGGTCCTTTGGAGTTACTGCAGTTACT
GTTGGAGATTCCAACTCTAATGTCAATCGTTCCTTATCAGGAGACCAAGACACATTCCACCCCAGTGGGGGGTCCCATACCACTCATGGA
TCTGAATCAGATGGACACTCACATGGGAGTCAAGAAGGTGGAGCAAACACAACCTCTGGTCCTATAAGGACACCCCAAATTCCAGAATGG
CTGATCATCTTGGCATCCCTCTTGGCCTTGGCTTTGATTCTTGCAGTTTGCATTGCAGTCAACAGTCGAAGAAGGTGTGGGCAGAAGAAA
AAGCTAGTGATCAACAGTGGCAATGGAGCTGTGGAGGACAGAAAGCCAAGTGGACTCAACGGAGAGGCCAGCAAGTCTCAGGAAATGGTG
CATTTGGTGAACAAGGAGTCGTCAGAAACTCCAGACCAGTTTATGACAGCTGATGAGACAAGGAACCTGCAGAATGTGGACATGAAGATT

>In-frame_LDLRAD3_ENST00000524419_chr11_35965694_+_CD44_ENST00000360158_chr11_35198122_+_1170nt
ATGTGGCTGCTGGGGCCGCTGTGCCTGCTGCTGAGCAGCGCCGCGGATTTGAATATAACCTGCCGCTTTGCAGGTGTATTCCACGTGGAG
AAAAATGGTCGCTACAGCATCTCTCGGACGGAGGCCGCTGACCTCTGCAAGGCTTTCAATAGCACCTTGCCCACAATGGCCCAGATGGAG
AAAGCTCTGAGCATCGGATTTGAGACCTGCAGGTATGGGTTCATAGAAGGGCACGTGGTGATTCCCCGGATCCACCCCAACTCCATCTGT
GCAGCAAACAACACAGGGGTGTACATCCTCACATCCAACACCTCCCAGTATGACACATATTGCTTCAATGCTTCAGCTCCACCTGAAGAA
GATTGTACATCAGTCACAGACCTGCCCAATGCCTTTGATGGACCAATTACCATAACTATTGTTAACCGTGATGGCACCCGCTATGTCCAG
AAAGGAGAATACAGAACGAATCCTGAAGACATCTACCCCAGCAACCCTACTGATGATGACGTGAGCAGCGGCTCCTCCAGTGAAAGGAGC
AGCACTTCAGGAGGTTACATCTTTTACACCTTTTCTACTGTACACCCCATCCCAGACGAAGACAGTCCCTGGATCACCGACAGCACAGAC
AGAATCCCTGCTACCAATATGGACTCCAGTCATAGTATAACGCTTCAGCCTACTGCAAATCCAAACACAGGTTTGGTGGAAGATTTGGAC
AGGACAGGACCTCTTTCAATGACAACGCGTAGAGACCAAGACACATTCCACCCCAGTGGGGGGTCCCATACCACTCATGGATCTGAATCA
GATGGACACTCACATGGGAGTCAAGAAGGTGGAGCAAACACAACCTCTGGTCCTATAAGGACACCCCAAATTCCAGAATGGCTGATCATC
TTGGCATCCCTCTTGGCCTTGGCTTTGATTCTTGCAGTTTGCATTGCAGTCAACAGTCGAAGAAGGTGTGGGCAGAAGAAAAAGCTAGTG
ATCAACAGTGGCAATGGAGCTGTGGAGGACAGAAAGCCAAGTGGACTCAACGGAGAGGCCAGCAAGTCTCAGGAAATGGTGCATTTGGTG
AACAAGGAGTCGTCAGAAACTCCAGACCAGTTTATGACAGCTGATGAGACAAGGAACCTGCAGAATGTGGACATGAAGATTGGGGTGTAA

>In-frame_LDLRAD3_ENST00000524419_chr11_35965694_+_CD44_ENST00000415148_chr11_35198122_+_2079nt
ATGTGGCTGCTGGGGCCGCTGTGCCTGCTGCTGAGCAGCGCCGCGGATTTGAATATAACCTGCCGCTTTGCAGGTGTATTCCACGTGGAG
AAAAATGGTCGCTACAGCATCTCTCGGACGGAGGCCGCTGACCTCTGCAAGGCTTTCAATAGCACCTTGCCCACAATGGCCCAGATGGAG
AAAGCTCTGAGCATCGGATTTGAGACCTGCAGGTATGGGTTCATAGAAGGGCACGTGGTGATTCCCCGGATCCACCCCAACTCCATCTGT
GCAGCAAACAACACAGGGGTGTACATCCTCACATCCAACACCTCCCAGTATGACACATATTGCTTCAATGCTTCAGCTCCACCTGAAGAA
GATTGTACATCAGTCACAGACCTGCCCAATGCCTTTGATGGACCAATTACCATAACTATTGTTAACCGTGATGGCACCCGCTATGTCCAG
AAAGGAGAATACAGAACGAATCCTGAAGACATCTACCCCAGCAACCCTACTGATGATGACGTGAGCAGCGGCTCCTCCAGTGAAAGGAGC
AGCACTTCAGGAGGTTACATCTTTTACACCTTTTCTACTGTACACCCCATCCCAGACGAAGACAGTCCCTGGATCACCGACAGCACAGAC
AGAATCCCTGCTACCAGTACGTCTTCAAATACCATCTCAGCAGGCTGGGAGCCAAATGAAGAAAATGAAGATGAAAGAGACAGACACCTC
AGTTTTTCTGGATCAGGCATTGATGATGATGAAGATTTTATCTCCAGCACCATTTCAACCACACCACGGGCTTTTGACCACACAAAACAG
AACCAGGACTGGACCCAGTGGAACCCAAGCCATTCAAATCCGGAAGTGCTACTTCAGACAACCACAAGGATGACTGATGTAGACAGAAAT
GGCACCACTGCTTATGAAGGAAACTGGAACCCAGAAGCACACCCTCCCCTCATTCACCATGAGCATCATGAGGAAGAAGAGACCCCACAT
TCTACAAGCACAATCCAGGCAACTCCTAGTAGTACAACGGAAGAAACAGCTACCCAGAAGGAACAGTGGTTTGGCAACAGATGGCATGAG
GGATATCGCCAAACACCCAAAGAAGACTCCCATTCGACAACAGGGACAGCTGCAGCCTCAGCTCATACCAGCCATCCAATGCAAGGAAGG
ACAACACCAAGCCCAGAGGACAGTTCCTGGACTGATTTCTTCAACCCAATCTCACACCCCATGGGACGAGGTCATCAAGCAGGAAGAAGG
ATGGATATGGACTCCAGTCATAGTATAACGCTTCAGCCTACTGCAAATCCAAACACAGGTTTGGTGGAAGATTTGGACAGGACAGGACCT
CTTTCAATGACAACGCAGCAGAGTAATTCTCAGAGCTTCTCTACATCACATGAAGGCTTGGAAGAAGATAAAGACCATCCAACAACTTCT
ACTCTGACATCAAGCAATAGGAATGATGTCACAGGTGGAAGAAGAGACCCAAATCATTCTGAAGGCTCAACTACTTTACTGGAAGGTTAT
ACCTCTCATTACCCACACACGAAGGAAAGCAGGACCTTCATCCCAGTGACCTCAGCTAAGACTGGGTCCTTTGGAGTTACTGCAGTTACT
GTTGGAGATTCCAACTCTAATGTCAATCGTTCCTTATCAGGAGACCAAGACACATTCCACCCCAGTGGGGGGTCCCATACCACTCATGGA
TCTGAATCAGATGGACACTCACATGGGAGTCAAGAAGGTGGAGCAAACACAACCTCTGGTCCTATAAGGACACCCCAAATTCCAGAATGG
CTGATCATCTTGGCATCCCTCTTGGCCTTGGCTTTGATTCTTGCAGTTTGCATTGCAGTCAACAGTCGAAGAAGGTGTGGGCAGAAGAAA
AAGCTAGTGATCAACAGTGGCAATGGAGCTGTGGAGGACAGAAAGCCAAGTGGACTCAACGGAGAGGCCAGCAAGTCTCAGGAAATGGTG
CATTTGGTGAACAAGGAGTCGTCAGAAACTCCAGACCAGTTTATGACAGCTGATGAGACAAGGAACCTGCAGAATGTGGACATGAAGATT

>In-frame_LDLRAD3_ENST00000524419_chr11_35965694_+_CD44_ENST00000437706_chr11_35198122_+_2004nt
ATGTGGCTGCTGGGGCCGCTGTGCCTGCTGCTGAGCAGCGCCGCGGATTTGAATATAACCTGCCGCTTTGCAGGTGTATTCCACGTGGAG
AAAAATGGTCGCTACAGCATCTCTCGGACGGAGGCCGCTGACCTCTGCAAGGCTTTCAATAGCACCTTGCCCACAATGGCCCAGATGGAG
AAAGCTCTGAGCATCGGATTTGAGACCTGCAGGTATGGGTTCATAGAAGGGCACGTGGTGATTCCCCGGATCCACCCCAACTCCATCTGT
GCAGCAAACAACACAGGGGTGTACATCCTCACATCCAACACCTCCCAGTATGACACATATTGCTTCAATGCTTCAGCTCCACCTGAAGAA
GATTGTACATCAGTCACAGACCTGCCCAATGCCTTTGATGGACCAATTACCATAACTATTGTTAACCGTGATGGCACCCGCTATGTCCAG
AAAGGAGAATACAGAACGAATCCTGAAGACATCTACCCCAGCAACCCTACTGATGATGACGTGAGCAGCGGCTCCTCCAGTGAAAGGAGC
AGCACTTCAGGAGGTTACATCTTTTACACCTTTTCTACTGTACACCCCATCCCAGACGAAGACAGTCCCTGGATCACCGACAGCACAGAC
AGAATCCCTGCTACCACTTTGATGAGCACTAGTGCTACAGCAACTGAGACAGCAACCAAGAGGCAAGAAACCTGGGATTGGTTTTCATGG
TTGTTTCTACCATCAGAGTCAAAGAATCATCTTCACACAACAACACAAATGGCTGGTACGTCTTCAAATACCATCTCAGCAGGCTGGGAG
CCAAATGAAGAAAATGAAGATGAAAGAGACAGACACCTCAGTTTTTCTGGATCAGGCATTGATGATGATGAAGATTTTATCTCCAGCACC
ATTTCAACCACACCACGGGCTTTTGACCACACAAAACAGAACCAGGACTGGACCCAGTGGAACCCAAGCCATTCAAATCCGGAAGTGCTA
CTTCAGACAACCACAAGGATGACTGATGTAGACAGAAATGGCACCACTGCTTATGAAGGAAACTGGAACCCAGAAGCACACCCTCCCCTC
ATTCACCATGAGCATCATGAGGAAGAAGAGACCCCACATTCTACAAGCACAATCCAGGCAACTCCTAGTAGTACAACGGAAGAAACAGCT
ACCCAGAAGGAACAGTGGTTTGGCAACAGATGGCATGAGGGATATCGCCAAACACCCAAAGAAGACTCCCATTCGACAACAGGGACAGCT
GCAGCCTCAGCTCATACCAGCCATCCAATGCAAGGAAGGACAACACCAAGCCCAGAGGACAGTTCCTGGACTGATTTCTTCAACCCAATC
TCACACCCCATGGGACGAGGTCATCAAGCAGGAAGAAGGATGGATATGGACTCCAGTCATAGTATAACGCTTCAGCCTACTGCAAATCCA
AACACAGGTTTGGTGGAAGATTTGGACAGGACAGGACCTCTTTCAATGACAACGCAGCAGAGTAATTCTCAGAGCTTCTCTACATCACAT
GAAGGCTTGGAAGAAGATAAAGACCATCCAACAACTTCTACTCTGACATCAAGCAGAGACCAAGACACATTCCACCCCAGTGGGGGGTCC
CATACCACTCATGGATCTGAATCAGATGGACACTCACATGGGAGTCAAGAAGGTGGAGCAAACACAACCTCTGGTCCTATAAGGACACCC
CAAATTCCAGAATGGCTGATCATCTTGGCATCCCTCTTGGCCTTGGCTTTGATTCTTGCAGTTTGCATTGCAGTCAACAGTCGAAGAAGG
TGTGGGCAGAAGAAAAAGCTAGTGATCAACAGTGGCAATGGAGCTGTGGAGGACAGAAAGCCAAGTGGACTCAACGGAGAGGCCAGCAAG
TCTCAGGAAATGGTGCATTTGGTGAACAAGGAGTCGTCAGAAACTCCAGACCAGTTTATGACAGCTGATGAGACAAGGAACCTGCAGAAT

>In-frame_LDLRAD3_ENST00000524419_chr11_35965694_+_CD44_ENST00000433354_chr11_35198122_+_2124nt
ATGTGGCTGCTGGGGCCGCTGTGCCTGCTGCTGAGCAGCGCCGCGGATTTGAATATAACCTGCCGCTTTGCAGGTGTATTCCACGTGGAG
AAAAATGGTCGCTACAGCATCTCTCGGACGGAGGCCGCTGACCTCTGCAAGGCTTTCAATAGCACCTTGCCCACAATGGCCCAGATGGAG
AAAGCTCTGAGCATCGGATTTGAGACCTGCAGGTATGGGTTCATAGAAGGGCACGTGGTGATTCCCCGGATCCACCCCAACTCCATCTGT
GCAGCAAACAACACAGGGGTGTACATCCTCACATCCAACACCTCCCAGTATGACACATATTGCTTCAATGCTTCAGCTCCACCTGAAGAA
GATTGTACATCAGTCACAGACCTGCCCAATGCCTTTGATGGACCAATTACCATAACTATTGTTAACCGTGATGGCACCCGCTATGTCCAG
AAAGGAGAATACAGAACGAATCCTGAAGACATCTACCCCAGCAACCCTACTGATGATGACGTGAGCAGCGGCTCCTCCAGTGAAAGGAGC
AGCACTTCAGGAGGTTACATCTTTTACACCTTTTCTACTGTACACCCCATCCCAGACGAAGACAGTCCCTGGATCACCGACAGCACAGAC
AGAATCCCTGCTACCACTTTGATGAGCACTAGTGCTACAGCAACTGAGACAGCAACCAAGAGGCAAGAAACCTGGGATTGGTTTTCATGG
TTGTTTCTACCATCAGAGTCAAAGAATCATCTTCACACAACAACACAAATGGCTGGTACGTCTTCAAATACCATCTCAGCAGGCTGGGAG
CCAAATGAAGAAAATGAAGATGAAAGAGACAGACACCTCAGTTTTTCTGGATCAGGCATTGATGATGATGAAGATTTTATCTCCAGCACC
ATTTCAACCACACCACGGGCTTTTGACCACACAAAACAGAACCAGGACTGGACCCAGTGGAACCCAAGCCATTCAAATCCGGAAGTGCTA
CTTCAGACAACCACAAGGATGACTGCAGATGTAGACAGAAATGGCACCACTGCTTATGAAGGAAACTGGAACCCAGAAGCACACCCTCCC
CTCATTCACCATGAGCATCATGAGGAAGAAGAGACCCCACATTCTACAAGCACAATCCAGGCAACTCCTAGTAGTACAACGGAAGAAACA
GCTACCCAGAAGGAACAGTGGTTTGGCAACAGATGGCATGAGGGATATCGCCAAACACCCAAAGAAGACTCCCATTCGACAACAGGGACA
GCTGCAGCCTCAGCTCATACCAGCCATCCAATGCAAGGAAGGACAACACCAAGCCCAGAGGACAGTTCCTGGACTGATTTCTTCAACCCA
ATCTCACACCCCATGGGACGAGGTCATCAAGCAGGAAGAAGGATGGATATGGACTCCAGTCATAGTATAACGCTTCAGCCTACTGCAAAT
CCAAACACAGGTTTGGTGGAAGATTTGGACAGGACAGGACCTCTTTCAATGACAACGCGTAATAGGAATGATGTCACAGGTGGAAGAAGA
GACCCAAATCATTCTGAAGGCTCAACTACTTTACTGGAAGGTTATACCTCTCATTACCCACACACGAAGGAAAGCAGGACCTTCATCCCA
GTGACCTCAGCTAAGACTGGGTCCTTTGGAGTTACTGCAGTTACTGTTGGAGATTCCAACTCTAATGTCAATCGTTCCTTATCAGGAGAC
CAAGACACATTCCACCCCAGTGGGGGGTCCCATACCACTCATGGATCTGAATCAGATGGACACTCACATGGGAGTCAAGAAGGTGGAGCA
AACACAACCTCTGGTCCTATAAGGACACCCCAAATTCCAGAATGGCTGATCATCTTGGCATCCCTCTTGGCCTTGGCTTTGATTCTTGCA
GTTTGCATTGCAGTCAACAGTCGAAGAAGGTGTGGGCAGAAGAAAAAGCTAGTGATCAACAGTGGCAATGGAGCTGTGGAGGACAGAAAG
CCAAGTGGACTCAACGGAGAGGCCAGCAAGTCTCAGGAAATGGTGCATTTGGTGAACAAGGAGTCGTCAGAAACTCCAGACCAGTTTATG

>In-frame_LDLRAD3_ENST00000524419_chr11_35965694_+_CD44_ENST00000428726_chr11_35198122_+_2208nt
ATGTGGCTGCTGGGGCCGCTGTGCCTGCTGCTGAGCAGCGCCGCGGATTTGAATATAACCTGCCGCTTTGCAGGTGTATTCCACGTGGAG
AAAAATGGTCGCTACAGCATCTCTCGGACGGAGGCCGCTGACCTCTGCAAGGCTTTCAATAGCACCTTGCCCACAATGGCCCAGATGGAG
AAAGCTCTGAGCATCGGATTTGAGACCTGCAGGTATGGGTTCATAGAAGGGCACGTGGTGATTCCCCGGATCCACCCCAACTCCATCTGT
GCAGCAAACAACACAGGGGTGTACATCCTCACATCCAACACCTCCCAGTATGACACATATTGCTTCAATGCTTCAGCTCCACCTGAAGAA
GATTGTACATCAGTCACAGACCTGCCCAATGCCTTTGATGGACCAATTACCATAACTATTGTTAACCGTGATGGCACCCGCTATGTCCAG
AAAGGAGAATACAGAACGAATCCTGAAGACATCTACCCCAGCAACCCTACTGATGATGACGTGAGCAGCGGCTCCTCCAGTGAAAGGAGC
AGCACTTCAGGAGGTTACATCTTTTACACCTTTTCTACTGTACACCCCATCCCAGACGAAGACAGTCCCTGGATCACCGACAGCACAGAC
AGAATCCCTGCTACCACTTTGATGAGCACTAGTGCTACAGCAACTGAGACAGCAACCAAGAGGCAAGAAACCTGGGATTGGTTTTCATGG
TTGTTTCTACCATCAGAGTCAAAGAATCATCTTCACACAACAACACAAATGGCTGGTACGTCTTCAAATACCATCTCAGCAGGCTGGGAG
CCAAATGAAGAAAATGAAGATGAAAGAGACAGACACCTCAGTTTTTCTGGATCAGGCATTGATGATGATGAAGATTTTATCTCCAGCACC
ATTTCAACCACACCACGGGCTTTTGACCACACAAAACAGAACCAGGACTGGACCCAGTGGAACCCAAGCCATTCAAATCCGGAAGTGCTA
CTTCAGACAACCACAAGGATGACTGATGTAGACAGAAATGGCACCACTGCTTATGAAGGAAACTGGAACCCAGAAGCACACCCTCCCCTC
ATTCACCATGAGCATCATGAGGAAGAAGAGACCCCACATTCTACAAGCACAATCCAGGCAACTCCTAGTAGTACAACGGAAGAAACAGCT
ACCCAGAAGGAACAGTGGTTTGGCAACAGATGGCATGAGGGATATCGCCAAACACCCAAAGAAGACTCCCATTCGACAACAGGGACAGCT
GCAGCCTCAGCTCATACCAGCCATCCAATGCAAGGAAGGACAACACCAAGCCCAGAGGACAGTTCCTGGACTGATTTCTTCAACCCAATC
TCACACCCCATGGGACGAGGTCATCAAGCAGGAAGAAGGATGGATATGGACTCCAGTCATAGTATAACGCTTCAGCCTACTGCAAATCCA
AACACAGGTTTGGTGGAAGATTTGGACAGGACAGGACCTCTTTCAATGACAACGCAGCAGAGTAATTCTCAGAGCTTCTCTACATCACAT
GAAGGCTTGGAAGAAGATAAAGACCATCCAACAACTTCTACTCTGACATCAAGCAATAGGAATGATGTCACAGGTGGAAGAAGAGACCCA
AATCATTCTGAAGGCTCAACTACTTTACTGGAAGGTTATACCTCTCATTACCCACACACGAAGGAAAGCAGGACCTTCATCCCAGTGACC
TCAGCTAAGACTGGGTCCTTTGGAGTTACTGCAGTTACTGTTGGAGATTCCAACTCTAATGTCAATCGTTCCTTATCAGGAGACCAAGAC
ACATTCCACCCCAGTGGGGGGTCCCATACCACTCATGGATCTGAATCAGATGGACACTCACATGGGAGTCAAGAAGGTGGAGCAAACACA
ACCTCTGGTCCTATAAGGACACCCCAAATTCCAGAATGGCTGATCATCTTGGCATCCCTCTTGGCCTTGGCTTTGATTCTTGCAGTTTGC
ATTGCAGTCAACAGTCGAAGAAGGTGTGGGCAGAAGAAAAAGCTAGTGATCAACAGTGGCAATGGAGCTGTGGAGGACAGAAAGCCAAGT
GGACTCAACGGAGAGGCCAGCAAGTCTCAGGAAATGGTGCATTTGGTGAACAAGGAGTCGTCAGAAACTCCAGACCAGTTTATGACAGCT

>In-frame_LDLRAD3_ENST00000524419_chr11_35965694_+_CD44_ENST00000526669_chr11_35198122_+_600nt
ATGTGGCTGCTGGGGCCGCTGTGCCTGCTGCTGAGCAGCGCCGCGGATTTGAATATAACCTGCCGCTTTGCAGGTGTATTCCACGTGGAG
AAAAATGGTCGCTACAGCATCTCTCGGACGGAGGCCGCTGACCTCTGCAAGGCTTTCAATAGCACCTTGCCCACAATGGCCCAGATGGAG
AAAGCTCTGAGCATCGGATTTGAGACCTGCAGGTATGGGTTCATAGAAGGGCACGTGGTGATTCCCCGGATCCACCCCAACTCCATCTGT
GGAGCAAACACAACCTCTGGTCCTATAAGGACACCCCAAATTCCAGAATGGCTGATCATCTTGGCATCCCTCTTGGCCTTGGCTTTGATT
CTTGCAGTTTGCATTGCAGTCAACAGTCGAAGAAGGTGTGGGCAGAAGAAAAAGCTAGTGATCAACAGTGGCAATGGAGCTGTGGAGGAC
AGAAAGCCAAGTGGACTCAACGGAGAGGCCAGCAAGTCTCAGGAAATGGTGCATTTGGTGAACAAGGAGTCGTCAGAAACTCCAGACCAG

>In-frame_LDLRAD3_ENST00000524419_chr11_35965694_+_CD44_ENST00000433892_chr11_35198122_+_1461nt
ATGTGGCTGCTGGGGCCGCTGTGCCTGCTGCTGAGCAGCGCCGCGGATTTGAATATAACCTGCCGCTTTGCAGGTGTATTCCACGTGGAG
AAAAATGGTCGCTACAGCATCTCTCGGACGGAGGCCGCTGACCTCTGCAAGGCTTTCAATAGCACCTTGCCCACAATGGCCCAGATGGAG
AAAGCTCTGAGCATCGGATTTGAGACCTGCAGGTATGGGTTCATAGAAGGGCACGTGGTGATTCCCCGGATCCACCCCAACTCCATCTGT
GCAGCAAACAACACAGGGGTGTACATCCTCACATCCAACACCTCCCAGTATGACACATATTGCTTCAATGCTTCAGCTCCACCTGAAGAA
GATTGTACATCAGTCACAGACCTGCCCAATGCCTTTGATGGACCAATTACCATAACTATTGTTAACCGTGATGGCACCCGCTATGTCCAG
AAAGGAGAATACAGAACGAATCCTGAAGACATCTACCCCAGCAACCCTACTGATGATGACGTGAGCAGCGGCTCCTCCAGTGAAAGGAGC
AGCACTTCAGGAGGTTACATCTTTTACACCTTTTCTACTGTACACCCCATCCCAGACGAAGACAGTCCCTGGATCACCGACAGCACAGAC
AGAATCCCTGCTACCAATATGGACTCCAGTCATAGTATAACGCTTCAGCCTACTGCAAATCCAAACACAGGTTTGGTGGAAGATTTGGAC
AGGACAGGACCTCTTTCAATGACAACGCAGCAGAGTAATTCTCAGAGCTTCTCTACATCACATGAAGGCTTGGAAGAAGATAAAGACCAT
CCAACAACTTCTACTCTGACATCAAGCAATAGGAATGATGTCACAGGTGGAAGAAGAGACCCAAATCATTCTGAAGGCTCAACTACTTTA
CTGGAAGGTTATACCTCTCATTACCCACACACGAAGGAAAGCAGGACCTTCATCCCAGTGACCTCAGCTAAGACTGGGTCCTTTGGAGTT
ACTGCAGTTACTGTTGGAGATTCCAACTCTAATGTCAATCGTTCCTTATCAGGAGACCAAGACACATTCCACCCCAGTGGGGGGTCCCAT
ACCACTCATGGATCTGAATCAGATGGACACTCACATGGGAGTCAAGAAGGTGGAGCAAACACAACCTCTGGTCCTATAAGGACACCCCAA
ATTCCAGAATGGCTGATCATCTTGGCATCCCTCTTGGCCTTGGCTTTGATTCTTGCAGTTTGCATTGCAGTCAACAGTCGAAGAAGGTGT
GGGCAGAAGAAAAAGCTAGTGATCAACAGTGGCAATGGAGCTGTGGAGGACAGAAAGCCAAGTGGACTCAACGGAGAGGCCAGCAAGTCT
CAGGAAATGGTGCATTTGGTGAACAAGGAGTCGTCAGAAACTCCAGACCAGTTTATGACAGCTGATGAGACAAGGAACCTGCAGAATGTG

>In-frame_LDLRAD3_ENST00000524419_chr11_35965694_+_CD44_ENST00000278386_chr11_35198122_+_399nt
ATGTGGCTGCTGGGGCCGCTGTGCCTGCTGCTGAGCAGCGCCGCGGATTTGAATATAACCTGCCGCTTTGCAGGTGTATTCCACGTGGAG
AAAAATGGTCGCTACAGCATCTCTCGGACGGAGGCCGCTGACCTCTGCAAGGCTTTCAATAGCACCTTGCCCACAATGGCCCAGATGGAG
AAAGCTCTGAGCATCGGATTTGAGACCTGCAGTTTGCATTGCAGTCAACAGTCGAAGAAGGTGTGGGCAGAAGAAAAAGCTAGTGATCAA
CAGTGGCAATGGAGCTGTGGAGGACAGAAAGCCAAGTGGACTCAACGGAGAGGCCAGCAAGTCTCAGGAAATGGTGCATTTGGTGAACAA

>In-frame_LDLRAD3_ENST00000524419_chr11_35965694_+_CD44_ENST00000434472_chr11_35198122_+_1269nt
ATGTGGCTGCTGGGGCCGCTGTGCCTGCTGCTGAGCAGCGCCGCGGATTTGAATATAACCTGCCGCTTTGCAGGTGTATTCCACGTGGAG
AAAAATGGTCGCTACAGCATCTCTCGGACGGAGGCCGCTGACCTCTGCAAGGCTTTCAATAGCACCTTGCCCACAATGGCCCAGATGGAG
AAAGCTCTGAGCATCGGATTTGAGACCTGCAGGTATGGGTTCATAGAAGGGCACGTGGTGATTCCCCGGATCCACCCCAACTCCATCTGT
GCAGCAAACAACACAGGGGTGTACATCCTCACATCCAACACCTCCCAGTATGACACATATTGCTTCAATGCTTCAGCTCCACCTGAAGAA
GATTGTACATCAGTCACAGACCTGCCCAATGCCTTTGATGGACCAATTACCATAACTATTGTTAACCGTGATGGCACCCGCTATGTCCAG
AAAGGAGAATACAGAACGAATCCTGAAGACATCTACCCCAGCAACCCTACTGATGATGACGTGAGCAGCGGCTCCTCCAGTGAAAGGAGC
AGCACTTCAGGAGGTTACATCTTTTACACCTTTTCTACTGTACACCCCATCCCAGACGAAGACAGTCCCTGGATCACCGACAGCACAGAC
AGAATCCCTGCTACCAATAGGAATGATGTCACAGGTGGAAGAAGAGACCCAAATCATTCTGAAGGCTCAACTACTTTACTGGAAGGTTAT
ACCTCTCATTACCCACACACGAAGGAAAGCAGGACCTTCATCCCAGTGACCTCAGCTAAGACTGGGTCCTTTGGAGTTACTGCAGTTACT
GTTGGAGATTCCAACTCTAATGTCAATCGTTCCTTATCAGGAGACCAAGACACATTCCACCCCAGTGGGGGGTCCCATACCACTCATGGA
TCTGAATCAGATGGACACTCACATGGGAGTCAAGAAGGTGGAGCAAACACAACCTCTGGTCCTATAAGGACACCCCAAATTCCAGAATGG
CTGATCATCTTGGCATCCCTCTTGGCCTTGGCTTTGATTCTTGCAGTTTGCATTGCAGTCAACAGTCGAAGAAGGTGTGGGCAGAAGAAA
AAGCTAGTGATCAACAGTGGCAATGGAGCTGTGGAGGACAGAAAGCCAAGTGGACTCAACGGAGAGGCCAGCAAGTCTCAGGAAATGGTG
CATTTGGTGAACAAGGAGTCGTCAGAAACTCCAGACCAGTTTATGACAGCTGATGAGACAAGGAACCTGCAGAATGTGGACATGAAGATT

>In-frame_LDLRAD3_ENST00000524419_chr11_35965694_+_CD44_ENST00000352818_chr11_35198122_+_1002nt
ATGTGGCTGCTGGGGCCGCTGTGCCTGCTGCTGAGCAGCGCCGCGGATTTGAATATAACCTGCCGCTTTGCAGGTGTATTCCACGTGGAG
AAAAATGGTCGCTACAGCATCTCTCGGACGGAGGCCGCTGACCTCTGCAAGGCTTTCAATAGCACCTTGCCCACAATGGCCCAGATGGAG
AAAGCTCTGAGCATCGGATTTGAGACCTGCAGGTATGGGTTCATAGAAGGGCACGTGGTGATTCCCCGGATCCACCCCAACTCCATCTGT
GCAGCAAACAACACAGGGGTGTACATCCTCACATCCAACACCTCCCAGTATGACACATATTGCTTCAATGCTTCAGCTCCACCTGAAGAA
GATTGTACATCAGTCACAGACCTGCCCAATGCCTTTGATGGACCAATTACCATAACTATTGTTAACCGTGATGGCACCCGCTATGTCCAG
AAAGGAGAATACAGAACGAATCCTGAAGACATCTACCCCAGCAACCCTACTGATGATGACGTGAGCAGCGGCTCCTCCAGTGAAAGGAGC
AGCACTTCAGGAGGTTACATCTTTTACACCTTTTCTACTGTACACCCCATCCCAGACGAAGACAGTCCCTGGATCACCGACAGCACAGAC
AGAATCCCTGCTACCAGACACTCACATGGGAGTCAAGAAGGTGGAGCAAACACAACCTCTGGTCCTATAAGGACACCCCAAATTCCAGAA
TGGCTGATCATCTTGGCATCCCTCTTGGCCTTGGCTTTGATTCTTGCAGTTTGCATTGCAGTCAACAGTCGAAGAAGGTGTGGGCAGAAG
AAAAAGCTAGTGATCAACAGTGGCAATGGAGCTGTGGAGGACAGAAAGCCAAGTGGACTCAACGGAGAGGCCAGCAAGTCTCAGGAAATG
GTGCATTTGGTGAACAAGGAGTCGTCAGAAACTCCAGACCAGTTTATGACAGCTGATGAGACAAGGAACCTGCAGAATGTGGACATGAAG

>In-frame_LDLRAD3_ENST00000528989_chr11_35965694_+_CD44_ENST00000263398_chr11_35198122_+_1065nt
ATGTGGCTGCTGGGGCCGCTGTGCCTGCTGCTGAGCAGCGCCGCGGATTTGAATATAACCTGCCGCTTTGCAGGTGTATTCCACGTGGAG
AAAAATGGTCGCTACAGCATCTCTCGGACGGAGGCCGCTGACCTCTGCAAGGCTTTCAATAGCACCTTGCCCACAATGGCCCAGATGGAG
AAAGCTCTGAGCATCGGATTTGAGACCTGCAGGTATGGGTTCATAGAAGGGCACGTGGTGATTCCCCGGATCCACCCCAACTCCATCTGT
GCAGCAAACAACACAGGGGTGTACATCCTCACATCCAACACCTCCCAGTATGACACATATTGCTTCAATGCTTCAGCTCCACCTGAAGAA
GATTGTACATCAGTCACAGACCTGCCCAATGCCTTTGATGGACCAATTACCATAACTATTGTTAACCGTGATGGCACCCGCTATGTCCAG
AAAGGAGAATACAGAACGAATCCTGAAGACATCTACCCCAGCAACCCTACTGATGATGACGTGAGCAGCGGCTCCTCCAGTGAAAGGAGC
AGCACTTCAGGAGGTTACATCTTTTACACCTTTTCTACTGTACACCCCATCCCAGACGAAGACAGTCCCTGGATCACCGACAGCACAGAC
AGAATCCCTGCTACCAGAGACCAAGACACATTCCACCCCAGTGGGGGGTCCCATACCACTCATGGATCTGAATCAGATGGACACTCACAT
GGGAGTCAAGAAGGTGGAGCAAACACAACCTCTGGTCCTATAAGGACACCCCAAATTCCAGAATGGCTGATCATCTTGGCATCCCTCTTG
GCCTTGGCTTTGATTCTTGCAGTTTGCATTGCAGTCAACAGTCGAAGAAGGTGTGGGCAGAAGAAAAAGCTAGTGATCAACAGTGGCAAT
GGAGCTGTGGAGGACAGAAAGCCAAGTGGACTCAACGGAGAGGCCAGCAAGTCTCAGGAAATGGTGCATTTGGTGAACAAGGAGTCGTCA

>In-frame_LDLRAD3_ENST00000528989_chr11_35965694_+_CD44_ENST00000449691_chr11_35198122_+_2079nt
ATGTGGCTGCTGGGGCCGCTGTGCCTGCTGCTGAGCAGCGCCGCGGATTTGAATATAACCTGCCGCTTTGCAGGTGTATTCCACGTGGAG
AAAAATGGTCGCTACAGCATCTCTCGGACGGAGGCCGCTGACCTCTGCAAGGCTTTCAATAGCACCTTGCCCACAATGGCCCAGATGGAG
AAAGCTCTGAGCATCGGATTTGAGACCTGCAGGTATGGGTTCATAGAAGGGCACGTGGTGATTCCCCGGATCCACCCCAACTCCATCTGT
GCAGCAAACAACACAGGGGTGTACATCCTCACATCCAACACCTCCCAGTATGACACATATTGCTTCAATGCTTCAGCTCCACCTGAAGAA
GATTGTACATCAGTCACAGACCTGCCCAATGCCTTTGATGGACCAATTACCATAACTATTGTTAACCGTGATGGCACCCGCTATGTCCAG
AAAGGAGAATACAGAACGAATCCTGAAGACATCTACCCCAGCAACCCTACTGATGATGACGTGAGCAGCGGCTCCTCCAGTGAAAGGAGC
AGCACTTCAGGAGGTTACATCTTTTACACCTTTTCTACTGTACACCCCATCCCAGACGAAGACAGTCCCTGGATCACCGACAGCACAGAC
AGAATCCCTGCTACCACTTTGATGAGCACTAGTGCTACAGCAACTGAGACAGCAACCAAGAGGCAAGAAACCTGGGATTGGTTTTCATGG
TTGTTTCTACCATCAGAGTCAAAGAATCATCTTCACACAACAACACAAATGGCTGGTACGTCTTCAAATACCATCTCAGCAGGCTGGGAG
CCAAATGAAGAAAATGAAGATGAAAGAGACAGACACCTCAGTTTTTCTGGATCAGGCATTGATGATGATGAAGATTTTATCTCCAGCACC
ATTTCAACCACACCACGGGCTTTTGACCACACAAAACAGAACCAGGACTGGACCCAGTGGAACCCAAGCCATTCAAATCCGGAAGTGCTA
CTTCAGACAACCACAAGGATGACTGATGTAGACAGAAATGGCACCACTGCTTATGAAGGAAACTGGAACCCAGAAGCACACCCTCCCCTC
ATTCACCATGAGCATCATGAGGAAGAAGAGACCCCACATTCTACAAGCACAACAGCCTCAGCTCATACCAGCCATCCAATGCAAGGAAGG
ACAACACCAAGCCCAGAGGACAGTTCCTGGACTGATTTCTTCAACCCAATCTCACACCCCATGGGACGAGGTCATCAAGCAGGAAGAAGG
ATGGATATGGACTCCAGTCATAGTATAACGCTTCAGCCTACTGCAAATCCAAACACAGGTTTGGTGGAAGATTTGGACAGGACAGGACCT
CTTTCAATGACAACGCAGCAGAGTAATTCTCAGAGCTTCTCTACATCACATGAAGGCTTGGAAGAAGATAAAGACCATCCAACAACTTCT
ACTCTGACATCAAGCAATAGGAATGATGTCACAGGTGGAAGAAGAGACCCAAATCATTCTGAAGGCTCAACTACTTTACTGGAAGGTTAT
ACCTCTCATTACCCACACACGAAGGAAAGCAGGACCTTCATCCCAGTGACCTCAGCTAAGACTGGGTCCTTTGGAGTTACTGCAGTTACT
GTTGGAGATTCCAACTCTAATGTCAATCGTTCCTTATCAGGAGACCAAGACACATTCCACCCCAGTGGGGGGTCCCATACCACTCATGGA
TCTGAATCAGATGGACACTCACATGGGAGTCAAGAAGGTGGAGCAAACACAACCTCTGGTCCTATAAGGACACCCCAAATTCCAGAATGG
CTGATCATCTTGGCATCCCTCTTGGCCTTGGCTTTGATTCTTGCAGTTTGCATTGCAGTCAACAGTCGAAGAAGGTGTGGGCAGAAGAAA
AAGCTAGTGATCAACAGTGGCAATGGAGCTGTGGAGGACAGAAAGCCAAGTGGACTCAACGGAGAGGCCAGCAAGTCTCAGGAAATGGTG
CATTTGGTGAACAAGGAGTCGTCAGAAACTCCAGACCAGTTTATGACAGCTGATGAGACAAGGAACCTGCAGAATGTGGACATGAAGATT

>In-frame_LDLRAD3_ENST00000528989_chr11_35965694_+_CD44_ENST00000360158_chr11_35198122_+_1170nt
ATGTGGCTGCTGGGGCCGCTGTGCCTGCTGCTGAGCAGCGCCGCGGATTTGAATATAACCTGCCGCTTTGCAGGTGTATTCCACGTGGAG
AAAAATGGTCGCTACAGCATCTCTCGGACGGAGGCCGCTGACCTCTGCAAGGCTTTCAATAGCACCTTGCCCACAATGGCCCAGATGGAG
AAAGCTCTGAGCATCGGATTTGAGACCTGCAGGTATGGGTTCATAGAAGGGCACGTGGTGATTCCCCGGATCCACCCCAACTCCATCTGT
GCAGCAAACAACACAGGGGTGTACATCCTCACATCCAACACCTCCCAGTATGACACATATTGCTTCAATGCTTCAGCTCCACCTGAAGAA
GATTGTACATCAGTCACAGACCTGCCCAATGCCTTTGATGGACCAATTACCATAACTATTGTTAACCGTGATGGCACCCGCTATGTCCAG
AAAGGAGAATACAGAACGAATCCTGAAGACATCTACCCCAGCAACCCTACTGATGATGACGTGAGCAGCGGCTCCTCCAGTGAAAGGAGC
AGCACTTCAGGAGGTTACATCTTTTACACCTTTTCTACTGTACACCCCATCCCAGACGAAGACAGTCCCTGGATCACCGACAGCACAGAC
AGAATCCCTGCTACCAATATGGACTCCAGTCATAGTATAACGCTTCAGCCTACTGCAAATCCAAACACAGGTTTGGTGGAAGATTTGGAC
AGGACAGGACCTCTTTCAATGACAACGCGTAGAGACCAAGACACATTCCACCCCAGTGGGGGGTCCCATACCACTCATGGATCTGAATCA
GATGGACACTCACATGGGAGTCAAGAAGGTGGAGCAAACACAACCTCTGGTCCTATAAGGACACCCCAAATTCCAGAATGGCTGATCATC
TTGGCATCCCTCTTGGCCTTGGCTTTGATTCTTGCAGTTTGCATTGCAGTCAACAGTCGAAGAAGGTGTGGGCAGAAGAAAAAGCTAGTG
ATCAACAGTGGCAATGGAGCTGTGGAGGACAGAAAGCCAAGTGGACTCAACGGAGAGGCCAGCAAGTCTCAGGAAATGGTGCATTTGGTG
AACAAGGAGTCGTCAGAAACTCCAGACCAGTTTATGACAGCTGATGAGACAAGGAACCTGCAGAATGTGGACATGAAGATTGGGGTGTAA

>In-frame_LDLRAD3_ENST00000528989_chr11_35965694_+_CD44_ENST00000415148_chr11_35198122_+_2079nt
ATGTGGCTGCTGGGGCCGCTGTGCCTGCTGCTGAGCAGCGCCGCGGATTTGAATATAACCTGCCGCTTTGCAGGTGTATTCCACGTGGAG
AAAAATGGTCGCTACAGCATCTCTCGGACGGAGGCCGCTGACCTCTGCAAGGCTTTCAATAGCACCTTGCCCACAATGGCCCAGATGGAG
AAAGCTCTGAGCATCGGATTTGAGACCTGCAGGTATGGGTTCATAGAAGGGCACGTGGTGATTCCCCGGATCCACCCCAACTCCATCTGT
GCAGCAAACAACACAGGGGTGTACATCCTCACATCCAACACCTCCCAGTATGACACATATTGCTTCAATGCTTCAGCTCCACCTGAAGAA
GATTGTACATCAGTCACAGACCTGCCCAATGCCTTTGATGGACCAATTACCATAACTATTGTTAACCGTGATGGCACCCGCTATGTCCAG
AAAGGAGAATACAGAACGAATCCTGAAGACATCTACCCCAGCAACCCTACTGATGATGACGTGAGCAGCGGCTCCTCCAGTGAAAGGAGC
AGCACTTCAGGAGGTTACATCTTTTACACCTTTTCTACTGTACACCCCATCCCAGACGAAGACAGTCCCTGGATCACCGACAGCACAGAC
AGAATCCCTGCTACCAGTACGTCTTCAAATACCATCTCAGCAGGCTGGGAGCCAAATGAAGAAAATGAAGATGAAAGAGACAGACACCTC
AGTTTTTCTGGATCAGGCATTGATGATGATGAAGATTTTATCTCCAGCACCATTTCAACCACACCACGGGCTTTTGACCACACAAAACAG
AACCAGGACTGGACCCAGTGGAACCCAAGCCATTCAAATCCGGAAGTGCTACTTCAGACAACCACAAGGATGACTGATGTAGACAGAAAT
GGCACCACTGCTTATGAAGGAAACTGGAACCCAGAAGCACACCCTCCCCTCATTCACCATGAGCATCATGAGGAAGAAGAGACCCCACAT
TCTACAAGCACAATCCAGGCAACTCCTAGTAGTACAACGGAAGAAACAGCTACCCAGAAGGAACAGTGGTTTGGCAACAGATGGCATGAG
GGATATCGCCAAACACCCAAAGAAGACTCCCATTCGACAACAGGGACAGCTGCAGCCTCAGCTCATACCAGCCATCCAATGCAAGGAAGG
ACAACACCAAGCCCAGAGGACAGTTCCTGGACTGATTTCTTCAACCCAATCTCACACCCCATGGGACGAGGTCATCAAGCAGGAAGAAGG
ATGGATATGGACTCCAGTCATAGTATAACGCTTCAGCCTACTGCAAATCCAAACACAGGTTTGGTGGAAGATTTGGACAGGACAGGACCT
CTTTCAATGACAACGCAGCAGAGTAATTCTCAGAGCTTCTCTACATCACATGAAGGCTTGGAAGAAGATAAAGACCATCCAACAACTTCT
ACTCTGACATCAAGCAATAGGAATGATGTCACAGGTGGAAGAAGAGACCCAAATCATTCTGAAGGCTCAACTACTTTACTGGAAGGTTAT
ACCTCTCATTACCCACACACGAAGGAAAGCAGGACCTTCATCCCAGTGACCTCAGCTAAGACTGGGTCCTTTGGAGTTACTGCAGTTACT
GTTGGAGATTCCAACTCTAATGTCAATCGTTCCTTATCAGGAGACCAAGACACATTCCACCCCAGTGGGGGGTCCCATACCACTCATGGA
TCTGAATCAGATGGACACTCACATGGGAGTCAAGAAGGTGGAGCAAACACAACCTCTGGTCCTATAAGGACACCCCAAATTCCAGAATGG
CTGATCATCTTGGCATCCCTCTTGGCCTTGGCTTTGATTCTTGCAGTTTGCATTGCAGTCAACAGTCGAAGAAGGTGTGGGCAGAAGAAA
AAGCTAGTGATCAACAGTGGCAATGGAGCTGTGGAGGACAGAAAGCCAAGTGGACTCAACGGAGAGGCCAGCAAGTCTCAGGAAATGGTG
CATTTGGTGAACAAGGAGTCGTCAGAAACTCCAGACCAGTTTATGACAGCTGATGAGACAAGGAACCTGCAGAATGTGGACATGAAGATT

>In-frame_LDLRAD3_ENST00000528989_chr11_35965694_+_CD44_ENST00000437706_chr11_35198122_+_2004nt
ATGTGGCTGCTGGGGCCGCTGTGCCTGCTGCTGAGCAGCGCCGCGGATTTGAATATAACCTGCCGCTTTGCAGGTGTATTCCACGTGGAG
AAAAATGGTCGCTACAGCATCTCTCGGACGGAGGCCGCTGACCTCTGCAAGGCTTTCAATAGCACCTTGCCCACAATGGCCCAGATGGAG
AAAGCTCTGAGCATCGGATTTGAGACCTGCAGGTATGGGTTCATAGAAGGGCACGTGGTGATTCCCCGGATCCACCCCAACTCCATCTGT
GCAGCAAACAACACAGGGGTGTACATCCTCACATCCAACACCTCCCAGTATGACACATATTGCTTCAATGCTTCAGCTCCACCTGAAGAA
GATTGTACATCAGTCACAGACCTGCCCAATGCCTTTGATGGACCAATTACCATAACTATTGTTAACCGTGATGGCACCCGCTATGTCCAG
AAAGGAGAATACAGAACGAATCCTGAAGACATCTACCCCAGCAACCCTACTGATGATGACGTGAGCAGCGGCTCCTCCAGTGAAAGGAGC
AGCACTTCAGGAGGTTACATCTTTTACACCTTTTCTACTGTACACCCCATCCCAGACGAAGACAGTCCCTGGATCACCGACAGCACAGAC
AGAATCCCTGCTACCACTTTGATGAGCACTAGTGCTACAGCAACTGAGACAGCAACCAAGAGGCAAGAAACCTGGGATTGGTTTTCATGG
TTGTTTCTACCATCAGAGTCAAAGAATCATCTTCACACAACAACACAAATGGCTGGTACGTCTTCAAATACCATCTCAGCAGGCTGGGAG
CCAAATGAAGAAAATGAAGATGAAAGAGACAGACACCTCAGTTTTTCTGGATCAGGCATTGATGATGATGAAGATTTTATCTCCAGCACC
ATTTCAACCACACCACGGGCTTTTGACCACACAAAACAGAACCAGGACTGGACCCAGTGGAACCCAAGCCATTCAAATCCGGAAGTGCTA
CTTCAGACAACCACAAGGATGACTGATGTAGACAGAAATGGCACCACTGCTTATGAAGGAAACTGGAACCCAGAAGCACACCCTCCCCTC
ATTCACCATGAGCATCATGAGGAAGAAGAGACCCCACATTCTACAAGCACAATCCAGGCAACTCCTAGTAGTACAACGGAAGAAACAGCT
ACCCAGAAGGAACAGTGGTTTGGCAACAGATGGCATGAGGGATATCGCCAAACACCCAAAGAAGACTCCCATTCGACAACAGGGACAGCT
GCAGCCTCAGCTCATACCAGCCATCCAATGCAAGGAAGGACAACACCAAGCCCAGAGGACAGTTCCTGGACTGATTTCTTCAACCCAATC
TCACACCCCATGGGACGAGGTCATCAAGCAGGAAGAAGGATGGATATGGACTCCAGTCATAGTATAACGCTTCAGCCTACTGCAAATCCA
AACACAGGTTTGGTGGAAGATTTGGACAGGACAGGACCTCTTTCAATGACAACGCAGCAGAGTAATTCTCAGAGCTTCTCTACATCACAT
GAAGGCTTGGAAGAAGATAAAGACCATCCAACAACTTCTACTCTGACATCAAGCAGAGACCAAGACACATTCCACCCCAGTGGGGGGTCC
CATACCACTCATGGATCTGAATCAGATGGACACTCACATGGGAGTCAAGAAGGTGGAGCAAACACAACCTCTGGTCCTATAAGGACACCC
CAAATTCCAGAATGGCTGATCATCTTGGCATCCCTCTTGGCCTTGGCTTTGATTCTTGCAGTTTGCATTGCAGTCAACAGTCGAAGAAGG
TGTGGGCAGAAGAAAAAGCTAGTGATCAACAGTGGCAATGGAGCTGTGGAGGACAGAAAGCCAAGTGGACTCAACGGAGAGGCCAGCAAG
TCTCAGGAAATGGTGCATTTGGTGAACAAGGAGTCGTCAGAAACTCCAGACCAGTTTATGACAGCTGATGAGACAAGGAACCTGCAGAAT

>In-frame_LDLRAD3_ENST00000528989_chr11_35965694_+_CD44_ENST00000433354_chr11_35198122_+_2124nt
ATGTGGCTGCTGGGGCCGCTGTGCCTGCTGCTGAGCAGCGCCGCGGATTTGAATATAACCTGCCGCTTTGCAGGTGTATTCCACGTGGAG
AAAAATGGTCGCTACAGCATCTCTCGGACGGAGGCCGCTGACCTCTGCAAGGCTTTCAATAGCACCTTGCCCACAATGGCCCAGATGGAG
AAAGCTCTGAGCATCGGATTTGAGACCTGCAGGTATGGGTTCATAGAAGGGCACGTGGTGATTCCCCGGATCCACCCCAACTCCATCTGT
GCAGCAAACAACACAGGGGTGTACATCCTCACATCCAACACCTCCCAGTATGACACATATTGCTTCAATGCTTCAGCTCCACCTGAAGAA
GATTGTACATCAGTCACAGACCTGCCCAATGCCTTTGATGGACCAATTACCATAACTATTGTTAACCGTGATGGCACCCGCTATGTCCAG
AAAGGAGAATACAGAACGAATCCTGAAGACATCTACCCCAGCAACCCTACTGATGATGACGTGAGCAGCGGCTCCTCCAGTGAAAGGAGC
AGCACTTCAGGAGGTTACATCTTTTACACCTTTTCTACTGTACACCCCATCCCAGACGAAGACAGTCCCTGGATCACCGACAGCACAGAC
AGAATCCCTGCTACCACTTTGATGAGCACTAGTGCTACAGCAACTGAGACAGCAACCAAGAGGCAAGAAACCTGGGATTGGTTTTCATGG
TTGTTTCTACCATCAGAGTCAAAGAATCATCTTCACACAACAACACAAATGGCTGGTACGTCTTCAAATACCATCTCAGCAGGCTGGGAG
CCAAATGAAGAAAATGAAGATGAAAGAGACAGACACCTCAGTTTTTCTGGATCAGGCATTGATGATGATGAAGATTTTATCTCCAGCACC
ATTTCAACCACACCACGGGCTTTTGACCACACAAAACAGAACCAGGACTGGACCCAGTGGAACCCAAGCCATTCAAATCCGGAAGTGCTA
CTTCAGACAACCACAAGGATGACTGCAGATGTAGACAGAAATGGCACCACTGCTTATGAAGGAAACTGGAACCCAGAAGCACACCCTCCC
CTCATTCACCATGAGCATCATGAGGAAGAAGAGACCCCACATTCTACAAGCACAATCCAGGCAACTCCTAGTAGTACAACGGAAGAAACA
GCTACCCAGAAGGAACAGTGGTTTGGCAACAGATGGCATGAGGGATATCGCCAAACACCCAAAGAAGACTCCCATTCGACAACAGGGACA
GCTGCAGCCTCAGCTCATACCAGCCATCCAATGCAAGGAAGGACAACACCAAGCCCAGAGGACAGTTCCTGGACTGATTTCTTCAACCCA
ATCTCACACCCCATGGGACGAGGTCATCAAGCAGGAAGAAGGATGGATATGGACTCCAGTCATAGTATAACGCTTCAGCCTACTGCAAAT
CCAAACACAGGTTTGGTGGAAGATTTGGACAGGACAGGACCTCTTTCAATGACAACGCGTAATAGGAATGATGTCACAGGTGGAAGAAGA
GACCCAAATCATTCTGAAGGCTCAACTACTTTACTGGAAGGTTATACCTCTCATTACCCACACACGAAGGAAAGCAGGACCTTCATCCCA
GTGACCTCAGCTAAGACTGGGTCCTTTGGAGTTACTGCAGTTACTGTTGGAGATTCCAACTCTAATGTCAATCGTTCCTTATCAGGAGAC
CAAGACACATTCCACCCCAGTGGGGGGTCCCATACCACTCATGGATCTGAATCAGATGGACACTCACATGGGAGTCAAGAAGGTGGAGCA
AACACAACCTCTGGTCCTATAAGGACACCCCAAATTCCAGAATGGCTGATCATCTTGGCATCCCTCTTGGCCTTGGCTTTGATTCTTGCA
GTTTGCATTGCAGTCAACAGTCGAAGAAGGTGTGGGCAGAAGAAAAAGCTAGTGATCAACAGTGGCAATGGAGCTGTGGAGGACAGAAAG
CCAAGTGGACTCAACGGAGAGGCCAGCAAGTCTCAGGAAATGGTGCATTTGGTGAACAAGGAGTCGTCAGAAACTCCAGACCAGTTTATG

>In-frame_LDLRAD3_ENST00000528989_chr11_35965694_+_CD44_ENST00000428726_chr11_35198122_+_2208nt
ATGTGGCTGCTGGGGCCGCTGTGCCTGCTGCTGAGCAGCGCCGCGGATTTGAATATAACCTGCCGCTTTGCAGGTGTATTCCACGTGGAG
AAAAATGGTCGCTACAGCATCTCTCGGACGGAGGCCGCTGACCTCTGCAAGGCTTTCAATAGCACCTTGCCCACAATGGCCCAGATGGAG
AAAGCTCTGAGCATCGGATTTGAGACCTGCAGGTATGGGTTCATAGAAGGGCACGTGGTGATTCCCCGGATCCACCCCAACTCCATCTGT
GCAGCAAACAACACAGGGGTGTACATCCTCACATCCAACACCTCCCAGTATGACACATATTGCTTCAATGCTTCAGCTCCACCTGAAGAA
GATTGTACATCAGTCACAGACCTGCCCAATGCCTTTGATGGACCAATTACCATAACTATTGTTAACCGTGATGGCACCCGCTATGTCCAG
AAAGGAGAATACAGAACGAATCCTGAAGACATCTACCCCAGCAACCCTACTGATGATGACGTGAGCAGCGGCTCCTCCAGTGAAAGGAGC
AGCACTTCAGGAGGTTACATCTTTTACACCTTTTCTACTGTACACCCCATCCCAGACGAAGACAGTCCCTGGATCACCGACAGCACAGAC
AGAATCCCTGCTACCACTTTGATGAGCACTAGTGCTACAGCAACTGAGACAGCAACCAAGAGGCAAGAAACCTGGGATTGGTTTTCATGG
TTGTTTCTACCATCAGAGTCAAAGAATCATCTTCACACAACAACACAAATGGCTGGTACGTCTTCAAATACCATCTCAGCAGGCTGGGAG
CCAAATGAAGAAAATGAAGATGAAAGAGACAGACACCTCAGTTTTTCTGGATCAGGCATTGATGATGATGAAGATTTTATCTCCAGCACC
ATTTCAACCACACCACGGGCTTTTGACCACACAAAACAGAACCAGGACTGGACCCAGTGGAACCCAAGCCATTCAAATCCGGAAGTGCTA
CTTCAGACAACCACAAGGATGACTGATGTAGACAGAAATGGCACCACTGCTTATGAAGGAAACTGGAACCCAGAAGCACACCCTCCCCTC
ATTCACCATGAGCATCATGAGGAAGAAGAGACCCCACATTCTACAAGCACAATCCAGGCAACTCCTAGTAGTACAACGGAAGAAACAGCT
ACCCAGAAGGAACAGTGGTTTGGCAACAGATGGCATGAGGGATATCGCCAAACACCCAAAGAAGACTCCCATTCGACAACAGGGACAGCT
GCAGCCTCAGCTCATACCAGCCATCCAATGCAAGGAAGGACAACACCAAGCCCAGAGGACAGTTCCTGGACTGATTTCTTCAACCCAATC
TCACACCCCATGGGACGAGGTCATCAAGCAGGAAGAAGGATGGATATGGACTCCAGTCATAGTATAACGCTTCAGCCTACTGCAAATCCA
AACACAGGTTTGGTGGAAGATTTGGACAGGACAGGACCTCTTTCAATGACAACGCAGCAGAGTAATTCTCAGAGCTTCTCTACATCACAT
GAAGGCTTGGAAGAAGATAAAGACCATCCAACAACTTCTACTCTGACATCAAGCAATAGGAATGATGTCACAGGTGGAAGAAGAGACCCA
AATCATTCTGAAGGCTCAACTACTTTACTGGAAGGTTATACCTCTCATTACCCACACACGAAGGAAAGCAGGACCTTCATCCCAGTGACC
TCAGCTAAGACTGGGTCCTTTGGAGTTACTGCAGTTACTGTTGGAGATTCCAACTCTAATGTCAATCGTTCCTTATCAGGAGACCAAGAC
ACATTCCACCCCAGTGGGGGGTCCCATACCACTCATGGATCTGAATCAGATGGACACTCACATGGGAGTCAAGAAGGTGGAGCAAACACA
ACCTCTGGTCCTATAAGGACACCCCAAATTCCAGAATGGCTGATCATCTTGGCATCCCTCTTGGCCTTGGCTTTGATTCTTGCAGTTTGC
ATTGCAGTCAACAGTCGAAGAAGGTGTGGGCAGAAGAAAAAGCTAGTGATCAACAGTGGCAATGGAGCTGTGGAGGACAGAAAGCCAAGT
GGACTCAACGGAGAGGCCAGCAAGTCTCAGGAAATGGTGCATTTGGTGAACAAGGAGTCGTCAGAAACTCCAGACCAGTTTATGACAGCT

>In-frame_LDLRAD3_ENST00000528989_chr11_35965694_+_CD44_ENST00000526669_chr11_35198122_+_600nt
ATGTGGCTGCTGGGGCCGCTGTGCCTGCTGCTGAGCAGCGCCGCGGATTTGAATATAACCTGCCGCTTTGCAGGTGTATTCCACGTGGAG
AAAAATGGTCGCTACAGCATCTCTCGGACGGAGGCCGCTGACCTCTGCAAGGCTTTCAATAGCACCTTGCCCACAATGGCCCAGATGGAG
AAAGCTCTGAGCATCGGATTTGAGACCTGCAGGTATGGGTTCATAGAAGGGCACGTGGTGATTCCCCGGATCCACCCCAACTCCATCTGT
GGAGCAAACACAACCTCTGGTCCTATAAGGACACCCCAAATTCCAGAATGGCTGATCATCTTGGCATCCCTCTTGGCCTTGGCTTTGATT
CTTGCAGTTTGCATTGCAGTCAACAGTCGAAGAAGGTGTGGGCAGAAGAAAAAGCTAGTGATCAACAGTGGCAATGGAGCTGTGGAGGAC
AGAAAGCCAAGTGGACTCAACGGAGAGGCCAGCAAGTCTCAGGAAATGGTGCATTTGGTGAACAAGGAGTCGTCAGAAACTCCAGACCAG

>In-frame_LDLRAD3_ENST00000528989_chr11_35965694_+_CD44_ENST00000433892_chr11_35198122_+_1461nt
ATGTGGCTGCTGGGGCCGCTGTGCCTGCTGCTGAGCAGCGCCGCGGATTTGAATATAACCTGCCGCTTTGCAGGTGTATTCCACGTGGAG
AAAAATGGTCGCTACAGCATCTCTCGGACGGAGGCCGCTGACCTCTGCAAGGCTTTCAATAGCACCTTGCCCACAATGGCCCAGATGGAG
AAAGCTCTGAGCATCGGATTTGAGACCTGCAGGTATGGGTTCATAGAAGGGCACGTGGTGATTCCCCGGATCCACCCCAACTCCATCTGT
GCAGCAAACAACACAGGGGTGTACATCCTCACATCCAACACCTCCCAGTATGACACATATTGCTTCAATGCTTCAGCTCCACCTGAAGAA
GATTGTACATCAGTCACAGACCTGCCCAATGCCTTTGATGGACCAATTACCATAACTATTGTTAACCGTGATGGCACCCGCTATGTCCAG
AAAGGAGAATACAGAACGAATCCTGAAGACATCTACCCCAGCAACCCTACTGATGATGACGTGAGCAGCGGCTCCTCCAGTGAAAGGAGC
AGCACTTCAGGAGGTTACATCTTTTACACCTTTTCTACTGTACACCCCATCCCAGACGAAGACAGTCCCTGGATCACCGACAGCACAGAC
AGAATCCCTGCTACCAATATGGACTCCAGTCATAGTATAACGCTTCAGCCTACTGCAAATCCAAACACAGGTTTGGTGGAAGATTTGGAC
AGGACAGGACCTCTTTCAATGACAACGCAGCAGAGTAATTCTCAGAGCTTCTCTACATCACATGAAGGCTTGGAAGAAGATAAAGACCAT
CCAACAACTTCTACTCTGACATCAAGCAATAGGAATGATGTCACAGGTGGAAGAAGAGACCCAAATCATTCTGAAGGCTCAACTACTTTA
CTGGAAGGTTATACCTCTCATTACCCACACACGAAGGAAAGCAGGACCTTCATCCCAGTGACCTCAGCTAAGACTGGGTCCTTTGGAGTT
ACTGCAGTTACTGTTGGAGATTCCAACTCTAATGTCAATCGTTCCTTATCAGGAGACCAAGACACATTCCACCCCAGTGGGGGGTCCCAT
ACCACTCATGGATCTGAATCAGATGGACACTCACATGGGAGTCAAGAAGGTGGAGCAAACACAACCTCTGGTCCTATAAGGACACCCCAA
ATTCCAGAATGGCTGATCATCTTGGCATCCCTCTTGGCCTTGGCTTTGATTCTTGCAGTTTGCATTGCAGTCAACAGTCGAAGAAGGTGT
GGGCAGAAGAAAAAGCTAGTGATCAACAGTGGCAATGGAGCTGTGGAGGACAGAAAGCCAAGTGGACTCAACGGAGAGGCCAGCAAGTCT
CAGGAAATGGTGCATTTGGTGAACAAGGAGTCGTCAGAAACTCCAGACCAGTTTATGACAGCTGATGAGACAAGGAACCTGCAGAATGTG

>In-frame_LDLRAD3_ENST00000528989_chr11_35965694_+_CD44_ENST00000278386_chr11_35198122_+_399nt
ATGTGGCTGCTGGGGCCGCTGTGCCTGCTGCTGAGCAGCGCCGCGGATTTGAATATAACCTGCCGCTTTGCAGGTGTATTCCACGTGGAG
AAAAATGGTCGCTACAGCATCTCTCGGACGGAGGCCGCTGACCTCTGCAAGGCTTTCAATAGCACCTTGCCCACAATGGCCCAGATGGAG
AAAGCTCTGAGCATCGGATTTGAGACCTGCAGTTTGCATTGCAGTCAACAGTCGAAGAAGGTGTGGGCAGAAGAAAAAGCTAGTGATCAA
CAGTGGCAATGGAGCTGTGGAGGACAGAAAGCCAAGTGGACTCAACGGAGAGGCCAGCAAGTCTCAGGAAATGGTGCATTTGGTGAACAA

>In-frame_LDLRAD3_ENST00000528989_chr11_35965694_+_CD44_ENST00000434472_chr11_35198122_+_1269nt
ATGTGGCTGCTGGGGCCGCTGTGCCTGCTGCTGAGCAGCGCCGCGGATTTGAATATAACCTGCCGCTTTGCAGGTGTATTCCACGTGGAG
AAAAATGGTCGCTACAGCATCTCTCGGACGGAGGCCGCTGACCTCTGCAAGGCTTTCAATAGCACCTTGCCCACAATGGCCCAGATGGAG
AAAGCTCTGAGCATCGGATTTGAGACCTGCAGGTATGGGTTCATAGAAGGGCACGTGGTGATTCCCCGGATCCACCCCAACTCCATCTGT
GCAGCAAACAACACAGGGGTGTACATCCTCACATCCAACACCTCCCAGTATGACACATATTGCTTCAATGCTTCAGCTCCACCTGAAGAA
GATTGTACATCAGTCACAGACCTGCCCAATGCCTTTGATGGACCAATTACCATAACTATTGTTAACCGTGATGGCACCCGCTATGTCCAG
AAAGGAGAATACAGAACGAATCCTGAAGACATCTACCCCAGCAACCCTACTGATGATGACGTGAGCAGCGGCTCCTCCAGTGAAAGGAGC
AGCACTTCAGGAGGTTACATCTTTTACACCTTTTCTACTGTACACCCCATCCCAGACGAAGACAGTCCCTGGATCACCGACAGCACAGAC
AGAATCCCTGCTACCAATAGGAATGATGTCACAGGTGGAAGAAGAGACCCAAATCATTCTGAAGGCTCAACTACTTTACTGGAAGGTTAT
ACCTCTCATTACCCACACACGAAGGAAAGCAGGACCTTCATCCCAGTGACCTCAGCTAAGACTGGGTCCTTTGGAGTTACTGCAGTTACT
GTTGGAGATTCCAACTCTAATGTCAATCGTTCCTTATCAGGAGACCAAGACACATTCCACCCCAGTGGGGGGTCCCATACCACTCATGGA
TCTGAATCAGATGGACACTCACATGGGAGTCAAGAAGGTGGAGCAAACACAACCTCTGGTCCTATAAGGACACCCCAAATTCCAGAATGG
CTGATCATCTTGGCATCCCTCTTGGCCTTGGCTTTGATTCTTGCAGTTTGCATTGCAGTCAACAGTCGAAGAAGGTGTGGGCAGAAGAAA
AAGCTAGTGATCAACAGTGGCAATGGAGCTGTGGAGGACAGAAAGCCAAGTGGACTCAACGGAGAGGCCAGCAAGTCTCAGGAAATGGTG
CATTTGGTGAACAAGGAGTCGTCAGAAACTCCAGACCAGTTTATGACAGCTGATGAGACAAGGAACCTGCAGAATGTGGACATGAAGATT

>In-frame_LDLRAD3_ENST00000528989_chr11_35965694_+_CD44_ENST00000352818_chr11_35198122_+_1002nt
ATGTGGCTGCTGGGGCCGCTGTGCCTGCTGCTGAGCAGCGCCGCGGATTTGAATATAACCTGCCGCTTTGCAGGTGTATTCCACGTGGAG
AAAAATGGTCGCTACAGCATCTCTCGGACGGAGGCCGCTGACCTCTGCAAGGCTTTCAATAGCACCTTGCCCACAATGGCCCAGATGGAG
AAAGCTCTGAGCATCGGATTTGAGACCTGCAGGTATGGGTTCATAGAAGGGCACGTGGTGATTCCCCGGATCCACCCCAACTCCATCTGT
GCAGCAAACAACACAGGGGTGTACATCCTCACATCCAACACCTCCCAGTATGACACATATTGCTTCAATGCTTCAGCTCCACCTGAAGAA
GATTGTACATCAGTCACAGACCTGCCCAATGCCTTTGATGGACCAATTACCATAACTATTGTTAACCGTGATGGCACCCGCTATGTCCAG
AAAGGAGAATACAGAACGAATCCTGAAGACATCTACCCCAGCAACCCTACTGATGATGACGTGAGCAGCGGCTCCTCCAGTGAAAGGAGC
AGCACTTCAGGAGGTTACATCTTTTACACCTTTTCTACTGTACACCCCATCCCAGACGAAGACAGTCCCTGGATCACCGACAGCACAGAC
AGAATCCCTGCTACCAGACACTCACATGGGAGTCAAGAAGGTGGAGCAAACACAACCTCTGGTCCTATAAGGACACCCCAAATTCCAGAA
TGGCTGATCATCTTGGCATCCCTCTTGGCCTTGGCTTTGATTCTTGCAGTTTGCATTGCAGTCAACAGTCGAAGAAGGTGTGGGCAGAAG
AAAAAGCTAGTGATCAACAGTGGCAATGGAGCTGTGGAGGACAGAAAGCCAAGTGGACTCAACGGAGAGGCCAGCAAGTCTCAGGAAATG
GTGCATTTGGTGAACAAGGAGTCGTCAGAAACTCCAGACCAGTTTATGACAGCTGATGAGACAAGGAACCTGCAGAATGTGGACATGAAG

>In-frame_LDLRAD3_ENST00000315571_chr11_35965694_+_CD44_ENST00000263398_chr11_35198122_+_1065nt
ATGTGGCTGCTGGGGCCGCTGTGCCTGCTGCTGAGCAGCGCCGCGGATTTGAATATAACCTGCCGCTTTGCAGGTGTATTCCACGTGGAG
AAAAATGGTCGCTACAGCATCTCTCGGACGGAGGCCGCTGACCTCTGCAAGGCTTTCAATAGCACCTTGCCCACAATGGCCCAGATGGAG
AAAGCTCTGAGCATCGGATTTGAGACCTGCAGGTATGGGTTCATAGAAGGGCACGTGGTGATTCCCCGGATCCACCCCAACTCCATCTGT
GCAGCAAACAACACAGGGGTGTACATCCTCACATCCAACACCTCCCAGTATGACACATATTGCTTCAATGCTTCAGCTCCACCTGAAGAA
GATTGTACATCAGTCACAGACCTGCCCAATGCCTTTGATGGACCAATTACCATAACTATTGTTAACCGTGATGGCACCCGCTATGTCCAG
AAAGGAGAATACAGAACGAATCCTGAAGACATCTACCCCAGCAACCCTACTGATGATGACGTGAGCAGCGGCTCCTCCAGTGAAAGGAGC
AGCACTTCAGGAGGTTACATCTTTTACACCTTTTCTACTGTACACCCCATCCCAGACGAAGACAGTCCCTGGATCACCGACAGCACAGAC
AGAATCCCTGCTACCAGAGACCAAGACACATTCCACCCCAGTGGGGGGTCCCATACCACTCATGGATCTGAATCAGATGGACACTCACAT
GGGAGTCAAGAAGGTGGAGCAAACACAACCTCTGGTCCTATAAGGACACCCCAAATTCCAGAATGGCTGATCATCTTGGCATCCCTCTTG
GCCTTGGCTTTGATTCTTGCAGTTTGCATTGCAGTCAACAGTCGAAGAAGGTGTGGGCAGAAGAAAAAGCTAGTGATCAACAGTGGCAAT
GGAGCTGTGGAGGACAGAAAGCCAAGTGGACTCAACGGAGAGGCCAGCAAGTCTCAGGAAATGGTGCATTTGGTGAACAAGGAGTCGTCA

>In-frame_LDLRAD3_ENST00000315571_chr11_35965694_+_CD44_ENST00000449691_chr11_35198122_+_2079nt
ATGTGGCTGCTGGGGCCGCTGTGCCTGCTGCTGAGCAGCGCCGCGGATTTGAATATAACCTGCCGCTTTGCAGGTGTATTCCACGTGGAG
AAAAATGGTCGCTACAGCATCTCTCGGACGGAGGCCGCTGACCTCTGCAAGGCTTTCAATAGCACCTTGCCCACAATGGCCCAGATGGAG
AAAGCTCTGAGCATCGGATTTGAGACCTGCAGGTATGGGTTCATAGAAGGGCACGTGGTGATTCCCCGGATCCACCCCAACTCCATCTGT
GCAGCAAACAACACAGGGGTGTACATCCTCACATCCAACACCTCCCAGTATGACACATATTGCTTCAATGCTTCAGCTCCACCTGAAGAA
GATTGTACATCAGTCACAGACCTGCCCAATGCCTTTGATGGACCAATTACCATAACTATTGTTAACCGTGATGGCACCCGCTATGTCCAG
AAAGGAGAATACAGAACGAATCCTGAAGACATCTACCCCAGCAACCCTACTGATGATGACGTGAGCAGCGGCTCCTCCAGTGAAAGGAGC
AGCACTTCAGGAGGTTACATCTTTTACACCTTTTCTACTGTACACCCCATCCCAGACGAAGACAGTCCCTGGATCACCGACAGCACAGAC
AGAATCCCTGCTACCACTTTGATGAGCACTAGTGCTACAGCAACTGAGACAGCAACCAAGAGGCAAGAAACCTGGGATTGGTTTTCATGG
TTGTTTCTACCATCAGAGTCAAAGAATCATCTTCACACAACAACACAAATGGCTGGTACGTCTTCAAATACCATCTCAGCAGGCTGGGAG
CCAAATGAAGAAAATGAAGATGAAAGAGACAGACACCTCAGTTTTTCTGGATCAGGCATTGATGATGATGAAGATTTTATCTCCAGCACC
ATTTCAACCACACCACGGGCTTTTGACCACACAAAACAGAACCAGGACTGGACCCAGTGGAACCCAAGCCATTCAAATCCGGAAGTGCTA
CTTCAGACAACCACAAGGATGACTGATGTAGACAGAAATGGCACCACTGCTTATGAAGGAAACTGGAACCCAGAAGCACACCCTCCCCTC
ATTCACCATGAGCATCATGAGGAAGAAGAGACCCCACATTCTACAAGCACAACAGCCTCAGCTCATACCAGCCATCCAATGCAAGGAAGG
ACAACACCAAGCCCAGAGGACAGTTCCTGGACTGATTTCTTCAACCCAATCTCACACCCCATGGGACGAGGTCATCAAGCAGGAAGAAGG
ATGGATATGGACTCCAGTCATAGTATAACGCTTCAGCCTACTGCAAATCCAAACACAGGTTTGGTGGAAGATTTGGACAGGACAGGACCT
CTTTCAATGACAACGCAGCAGAGTAATTCTCAGAGCTTCTCTACATCACATGAAGGCTTGGAAGAAGATAAAGACCATCCAACAACTTCT
ACTCTGACATCAAGCAATAGGAATGATGTCACAGGTGGAAGAAGAGACCCAAATCATTCTGAAGGCTCAACTACTTTACTGGAAGGTTAT
ACCTCTCATTACCCACACACGAAGGAAAGCAGGACCTTCATCCCAGTGACCTCAGCTAAGACTGGGTCCTTTGGAGTTACTGCAGTTACT
GTTGGAGATTCCAACTCTAATGTCAATCGTTCCTTATCAGGAGACCAAGACACATTCCACCCCAGTGGGGGGTCCCATACCACTCATGGA
TCTGAATCAGATGGACACTCACATGGGAGTCAAGAAGGTGGAGCAAACACAACCTCTGGTCCTATAAGGACACCCCAAATTCCAGAATGG
CTGATCATCTTGGCATCCCTCTTGGCCTTGGCTTTGATTCTTGCAGTTTGCATTGCAGTCAACAGTCGAAGAAGGTGTGGGCAGAAGAAA
AAGCTAGTGATCAACAGTGGCAATGGAGCTGTGGAGGACAGAAAGCCAAGTGGACTCAACGGAGAGGCCAGCAAGTCTCAGGAAATGGTG
CATTTGGTGAACAAGGAGTCGTCAGAAACTCCAGACCAGTTTATGACAGCTGATGAGACAAGGAACCTGCAGAATGTGGACATGAAGATT

>In-frame_LDLRAD3_ENST00000315571_chr11_35965694_+_CD44_ENST00000360158_chr11_35198122_+_1170nt
ATGTGGCTGCTGGGGCCGCTGTGCCTGCTGCTGAGCAGCGCCGCGGATTTGAATATAACCTGCCGCTTTGCAGGTGTATTCCACGTGGAG
AAAAATGGTCGCTACAGCATCTCTCGGACGGAGGCCGCTGACCTCTGCAAGGCTTTCAATAGCACCTTGCCCACAATGGCCCAGATGGAG
AAAGCTCTGAGCATCGGATTTGAGACCTGCAGGTATGGGTTCATAGAAGGGCACGTGGTGATTCCCCGGATCCACCCCAACTCCATCTGT
GCAGCAAACAACACAGGGGTGTACATCCTCACATCCAACACCTCCCAGTATGACACATATTGCTTCAATGCTTCAGCTCCACCTGAAGAA
GATTGTACATCAGTCACAGACCTGCCCAATGCCTTTGATGGACCAATTACCATAACTATTGTTAACCGTGATGGCACCCGCTATGTCCAG
AAAGGAGAATACAGAACGAATCCTGAAGACATCTACCCCAGCAACCCTACTGATGATGACGTGAGCAGCGGCTCCTCCAGTGAAAGGAGC
AGCACTTCAGGAGGTTACATCTTTTACACCTTTTCTACTGTACACCCCATCCCAGACGAAGACAGTCCCTGGATCACCGACAGCACAGAC
AGAATCCCTGCTACCAATATGGACTCCAGTCATAGTATAACGCTTCAGCCTACTGCAAATCCAAACACAGGTTTGGTGGAAGATTTGGAC
AGGACAGGACCTCTTTCAATGACAACGCGTAGAGACCAAGACACATTCCACCCCAGTGGGGGGTCCCATACCACTCATGGATCTGAATCA
GATGGACACTCACATGGGAGTCAAGAAGGTGGAGCAAACACAACCTCTGGTCCTATAAGGACACCCCAAATTCCAGAATGGCTGATCATC
TTGGCATCCCTCTTGGCCTTGGCTTTGATTCTTGCAGTTTGCATTGCAGTCAACAGTCGAAGAAGGTGTGGGCAGAAGAAAAAGCTAGTG
ATCAACAGTGGCAATGGAGCTGTGGAGGACAGAAAGCCAAGTGGACTCAACGGAGAGGCCAGCAAGTCTCAGGAAATGGTGCATTTGGTG
AACAAGGAGTCGTCAGAAACTCCAGACCAGTTTATGACAGCTGATGAGACAAGGAACCTGCAGAATGTGGACATGAAGATTGGGGTGTAA

>In-frame_LDLRAD3_ENST00000315571_chr11_35965694_+_CD44_ENST00000415148_chr11_35198122_+_2079nt
ATGTGGCTGCTGGGGCCGCTGTGCCTGCTGCTGAGCAGCGCCGCGGATTTGAATATAACCTGCCGCTTTGCAGGTGTATTCCACGTGGAG
AAAAATGGTCGCTACAGCATCTCTCGGACGGAGGCCGCTGACCTCTGCAAGGCTTTCAATAGCACCTTGCCCACAATGGCCCAGATGGAG
AAAGCTCTGAGCATCGGATTTGAGACCTGCAGGTATGGGTTCATAGAAGGGCACGTGGTGATTCCCCGGATCCACCCCAACTCCATCTGT
GCAGCAAACAACACAGGGGTGTACATCCTCACATCCAACACCTCCCAGTATGACACATATTGCTTCAATGCTTCAGCTCCACCTGAAGAA
GATTGTACATCAGTCACAGACCTGCCCAATGCCTTTGATGGACCAATTACCATAACTATTGTTAACCGTGATGGCACCCGCTATGTCCAG
AAAGGAGAATACAGAACGAATCCTGAAGACATCTACCCCAGCAACCCTACTGATGATGACGTGAGCAGCGGCTCCTCCAGTGAAAGGAGC
AGCACTTCAGGAGGTTACATCTTTTACACCTTTTCTACTGTACACCCCATCCCAGACGAAGACAGTCCCTGGATCACCGACAGCACAGAC
AGAATCCCTGCTACCAGTACGTCTTCAAATACCATCTCAGCAGGCTGGGAGCCAAATGAAGAAAATGAAGATGAAAGAGACAGACACCTC
AGTTTTTCTGGATCAGGCATTGATGATGATGAAGATTTTATCTCCAGCACCATTTCAACCACACCACGGGCTTTTGACCACACAAAACAG
AACCAGGACTGGACCCAGTGGAACCCAAGCCATTCAAATCCGGAAGTGCTACTTCAGACAACCACAAGGATGACTGATGTAGACAGAAAT
GGCACCACTGCTTATGAAGGAAACTGGAACCCAGAAGCACACCCTCCCCTCATTCACCATGAGCATCATGAGGAAGAAGAGACCCCACAT
TCTACAAGCACAATCCAGGCAACTCCTAGTAGTACAACGGAAGAAACAGCTACCCAGAAGGAACAGTGGTTTGGCAACAGATGGCATGAG
GGATATCGCCAAACACCCAAAGAAGACTCCCATTCGACAACAGGGACAGCTGCAGCCTCAGCTCATACCAGCCATCCAATGCAAGGAAGG
ACAACACCAAGCCCAGAGGACAGTTCCTGGACTGATTTCTTCAACCCAATCTCACACCCCATGGGACGAGGTCATCAAGCAGGAAGAAGG
ATGGATATGGACTCCAGTCATAGTATAACGCTTCAGCCTACTGCAAATCCAAACACAGGTTTGGTGGAAGATTTGGACAGGACAGGACCT
CTTTCAATGACAACGCAGCAGAGTAATTCTCAGAGCTTCTCTACATCACATGAAGGCTTGGAAGAAGATAAAGACCATCCAACAACTTCT
ACTCTGACATCAAGCAATAGGAATGATGTCACAGGTGGAAGAAGAGACCCAAATCATTCTGAAGGCTCAACTACTTTACTGGAAGGTTAT
ACCTCTCATTACCCACACACGAAGGAAAGCAGGACCTTCATCCCAGTGACCTCAGCTAAGACTGGGTCCTTTGGAGTTACTGCAGTTACT
GTTGGAGATTCCAACTCTAATGTCAATCGTTCCTTATCAGGAGACCAAGACACATTCCACCCCAGTGGGGGGTCCCATACCACTCATGGA
TCTGAATCAGATGGACACTCACATGGGAGTCAAGAAGGTGGAGCAAACACAACCTCTGGTCCTATAAGGACACCCCAAATTCCAGAATGG
CTGATCATCTTGGCATCCCTCTTGGCCTTGGCTTTGATTCTTGCAGTTTGCATTGCAGTCAACAGTCGAAGAAGGTGTGGGCAGAAGAAA
AAGCTAGTGATCAACAGTGGCAATGGAGCTGTGGAGGACAGAAAGCCAAGTGGACTCAACGGAGAGGCCAGCAAGTCTCAGGAAATGGTG
CATTTGGTGAACAAGGAGTCGTCAGAAACTCCAGACCAGTTTATGACAGCTGATGAGACAAGGAACCTGCAGAATGTGGACATGAAGATT

>In-frame_LDLRAD3_ENST00000315571_chr11_35965694_+_CD44_ENST00000437706_chr11_35198122_+_2004nt
ATGTGGCTGCTGGGGCCGCTGTGCCTGCTGCTGAGCAGCGCCGCGGATTTGAATATAACCTGCCGCTTTGCAGGTGTATTCCACGTGGAG
AAAAATGGTCGCTACAGCATCTCTCGGACGGAGGCCGCTGACCTCTGCAAGGCTTTCAATAGCACCTTGCCCACAATGGCCCAGATGGAG
AAAGCTCTGAGCATCGGATTTGAGACCTGCAGGTATGGGTTCATAGAAGGGCACGTGGTGATTCCCCGGATCCACCCCAACTCCATCTGT
GCAGCAAACAACACAGGGGTGTACATCCTCACATCCAACACCTCCCAGTATGACACATATTGCTTCAATGCTTCAGCTCCACCTGAAGAA
GATTGTACATCAGTCACAGACCTGCCCAATGCCTTTGATGGACCAATTACCATAACTATTGTTAACCGTGATGGCACCCGCTATGTCCAG
AAAGGAGAATACAGAACGAATCCTGAAGACATCTACCCCAGCAACCCTACTGATGATGACGTGAGCAGCGGCTCCTCCAGTGAAAGGAGC
AGCACTTCAGGAGGTTACATCTTTTACACCTTTTCTACTGTACACCCCATCCCAGACGAAGACAGTCCCTGGATCACCGACAGCACAGAC
AGAATCCCTGCTACCACTTTGATGAGCACTAGTGCTACAGCAACTGAGACAGCAACCAAGAGGCAAGAAACCTGGGATTGGTTTTCATGG
TTGTTTCTACCATCAGAGTCAAAGAATCATCTTCACACAACAACACAAATGGCTGGTACGTCTTCAAATACCATCTCAGCAGGCTGGGAG
CCAAATGAAGAAAATGAAGATGAAAGAGACAGACACCTCAGTTTTTCTGGATCAGGCATTGATGATGATGAAGATTTTATCTCCAGCACC
ATTTCAACCACACCACGGGCTTTTGACCACACAAAACAGAACCAGGACTGGACCCAGTGGAACCCAAGCCATTCAAATCCGGAAGTGCTA
CTTCAGACAACCACAAGGATGACTGATGTAGACAGAAATGGCACCACTGCTTATGAAGGAAACTGGAACCCAGAAGCACACCCTCCCCTC
ATTCACCATGAGCATCATGAGGAAGAAGAGACCCCACATTCTACAAGCACAATCCAGGCAACTCCTAGTAGTACAACGGAAGAAACAGCT
ACCCAGAAGGAACAGTGGTTTGGCAACAGATGGCATGAGGGATATCGCCAAACACCCAAAGAAGACTCCCATTCGACAACAGGGACAGCT
GCAGCCTCAGCTCATACCAGCCATCCAATGCAAGGAAGGACAACACCAAGCCCAGAGGACAGTTCCTGGACTGATTTCTTCAACCCAATC
TCACACCCCATGGGACGAGGTCATCAAGCAGGAAGAAGGATGGATATGGACTCCAGTCATAGTATAACGCTTCAGCCTACTGCAAATCCA
AACACAGGTTTGGTGGAAGATTTGGACAGGACAGGACCTCTTTCAATGACAACGCAGCAGAGTAATTCTCAGAGCTTCTCTACATCACAT
GAAGGCTTGGAAGAAGATAAAGACCATCCAACAACTTCTACTCTGACATCAAGCAGAGACCAAGACACATTCCACCCCAGTGGGGGGTCC
CATACCACTCATGGATCTGAATCAGATGGACACTCACATGGGAGTCAAGAAGGTGGAGCAAACACAACCTCTGGTCCTATAAGGACACCC
CAAATTCCAGAATGGCTGATCATCTTGGCATCCCTCTTGGCCTTGGCTTTGATTCTTGCAGTTTGCATTGCAGTCAACAGTCGAAGAAGG
TGTGGGCAGAAGAAAAAGCTAGTGATCAACAGTGGCAATGGAGCTGTGGAGGACAGAAAGCCAAGTGGACTCAACGGAGAGGCCAGCAAG
TCTCAGGAAATGGTGCATTTGGTGAACAAGGAGTCGTCAGAAACTCCAGACCAGTTTATGACAGCTGATGAGACAAGGAACCTGCAGAAT

>In-frame_LDLRAD3_ENST00000315571_chr11_35965694_+_CD44_ENST00000433354_chr11_35198122_+_2124nt
ATGTGGCTGCTGGGGCCGCTGTGCCTGCTGCTGAGCAGCGCCGCGGATTTGAATATAACCTGCCGCTTTGCAGGTGTATTCCACGTGGAG
AAAAATGGTCGCTACAGCATCTCTCGGACGGAGGCCGCTGACCTCTGCAAGGCTTTCAATAGCACCTTGCCCACAATGGCCCAGATGGAG
AAAGCTCTGAGCATCGGATTTGAGACCTGCAGGTATGGGTTCATAGAAGGGCACGTGGTGATTCCCCGGATCCACCCCAACTCCATCTGT
GCAGCAAACAACACAGGGGTGTACATCCTCACATCCAACACCTCCCAGTATGACACATATTGCTTCAATGCTTCAGCTCCACCTGAAGAA
GATTGTACATCAGTCACAGACCTGCCCAATGCCTTTGATGGACCAATTACCATAACTATTGTTAACCGTGATGGCACCCGCTATGTCCAG
AAAGGAGAATACAGAACGAATCCTGAAGACATCTACCCCAGCAACCCTACTGATGATGACGTGAGCAGCGGCTCCTCCAGTGAAAGGAGC
AGCACTTCAGGAGGTTACATCTTTTACACCTTTTCTACTGTACACCCCATCCCAGACGAAGACAGTCCCTGGATCACCGACAGCACAGAC
AGAATCCCTGCTACCACTTTGATGAGCACTAGTGCTACAGCAACTGAGACAGCAACCAAGAGGCAAGAAACCTGGGATTGGTTTTCATGG
TTGTTTCTACCATCAGAGTCAAAGAATCATCTTCACACAACAACACAAATGGCTGGTACGTCTTCAAATACCATCTCAGCAGGCTGGGAG
CCAAATGAAGAAAATGAAGATGAAAGAGACAGACACCTCAGTTTTTCTGGATCAGGCATTGATGATGATGAAGATTTTATCTCCAGCACC
ATTTCAACCACACCACGGGCTTTTGACCACACAAAACAGAACCAGGACTGGACCCAGTGGAACCCAAGCCATTCAAATCCGGAAGTGCTA
CTTCAGACAACCACAAGGATGACTGCAGATGTAGACAGAAATGGCACCACTGCTTATGAAGGAAACTGGAACCCAGAAGCACACCCTCCC
CTCATTCACCATGAGCATCATGAGGAAGAAGAGACCCCACATTCTACAAGCACAATCCAGGCAACTCCTAGTAGTACAACGGAAGAAACA
GCTACCCAGAAGGAACAGTGGTTTGGCAACAGATGGCATGAGGGATATCGCCAAACACCCAAAGAAGACTCCCATTCGACAACAGGGACA
GCTGCAGCCTCAGCTCATACCAGCCATCCAATGCAAGGAAGGACAACACCAAGCCCAGAGGACAGTTCCTGGACTGATTTCTTCAACCCA
ATCTCACACCCCATGGGACGAGGTCATCAAGCAGGAAGAAGGATGGATATGGACTCCAGTCATAGTATAACGCTTCAGCCTACTGCAAAT
CCAAACACAGGTTTGGTGGAAGATTTGGACAGGACAGGACCTCTTTCAATGACAACGCGTAATAGGAATGATGTCACAGGTGGAAGAAGA
GACCCAAATCATTCTGAAGGCTCAACTACTTTACTGGAAGGTTATACCTCTCATTACCCACACACGAAGGAAAGCAGGACCTTCATCCCA
GTGACCTCAGCTAAGACTGGGTCCTTTGGAGTTACTGCAGTTACTGTTGGAGATTCCAACTCTAATGTCAATCGTTCCTTATCAGGAGAC
CAAGACACATTCCACCCCAGTGGGGGGTCCCATACCACTCATGGATCTGAATCAGATGGACACTCACATGGGAGTCAAGAAGGTGGAGCA
AACACAACCTCTGGTCCTATAAGGACACCCCAAATTCCAGAATGGCTGATCATCTTGGCATCCCTCTTGGCCTTGGCTTTGATTCTTGCA
GTTTGCATTGCAGTCAACAGTCGAAGAAGGTGTGGGCAGAAGAAAAAGCTAGTGATCAACAGTGGCAATGGAGCTGTGGAGGACAGAAAG
CCAAGTGGACTCAACGGAGAGGCCAGCAAGTCTCAGGAAATGGTGCATTTGGTGAACAAGGAGTCGTCAGAAACTCCAGACCAGTTTATG

>In-frame_LDLRAD3_ENST00000315571_chr11_35965694_+_CD44_ENST00000428726_chr11_35198122_+_2208nt
ATGTGGCTGCTGGGGCCGCTGTGCCTGCTGCTGAGCAGCGCCGCGGATTTGAATATAACCTGCCGCTTTGCAGGTGTATTCCACGTGGAG
AAAAATGGTCGCTACAGCATCTCTCGGACGGAGGCCGCTGACCTCTGCAAGGCTTTCAATAGCACCTTGCCCACAATGGCCCAGATGGAG
AAAGCTCTGAGCATCGGATTTGAGACCTGCAGGTATGGGTTCATAGAAGGGCACGTGGTGATTCCCCGGATCCACCCCAACTCCATCTGT
GCAGCAAACAACACAGGGGTGTACATCCTCACATCCAACACCTCCCAGTATGACACATATTGCTTCAATGCTTCAGCTCCACCTGAAGAA
GATTGTACATCAGTCACAGACCTGCCCAATGCCTTTGATGGACCAATTACCATAACTATTGTTAACCGTGATGGCACCCGCTATGTCCAG
AAAGGAGAATACAGAACGAATCCTGAAGACATCTACCCCAGCAACCCTACTGATGATGACGTGAGCAGCGGCTCCTCCAGTGAAAGGAGC
AGCACTTCAGGAGGTTACATCTTTTACACCTTTTCTACTGTACACCCCATCCCAGACGAAGACAGTCCCTGGATCACCGACAGCACAGAC
AGAATCCCTGCTACCACTTTGATGAGCACTAGTGCTACAGCAACTGAGACAGCAACCAAGAGGCAAGAAACCTGGGATTGGTTTTCATGG
TTGTTTCTACCATCAGAGTCAAAGAATCATCTTCACACAACAACACAAATGGCTGGTACGTCTTCAAATACCATCTCAGCAGGCTGGGAG
CCAAATGAAGAAAATGAAGATGAAAGAGACAGACACCTCAGTTTTTCTGGATCAGGCATTGATGATGATGAAGATTTTATCTCCAGCACC
ATTTCAACCACACCACGGGCTTTTGACCACACAAAACAGAACCAGGACTGGACCCAGTGGAACCCAAGCCATTCAAATCCGGAAGTGCTA
CTTCAGACAACCACAAGGATGACTGATGTAGACAGAAATGGCACCACTGCTTATGAAGGAAACTGGAACCCAGAAGCACACCCTCCCCTC
ATTCACCATGAGCATCATGAGGAAGAAGAGACCCCACATTCTACAAGCACAATCCAGGCAACTCCTAGTAGTACAACGGAAGAAACAGCT
ACCCAGAAGGAACAGTGGTTTGGCAACAGATGGCATGAGGGATATCGCCAAACACCCAAAGAAGACTCCCATTCGACAACAGGGACAGCT
GCAGCCTCAGCTCATACCAGCCATCCAATGCAAGGAAGGACAACACCAAGCCCAGAGGACAGTTCCTGGACTGATTTCTTCAACCCAATC
TCACACCCCATGGGACGAGGTCATCAAGCAGGAAGAAGGATGGATATGGACTCCAGTCATAGTATAACGCTTCAGCCTACTGCAAATCCA
AACACAGGTTTGGTGGAAGATTTGGACAGGACAGGACCTCTTTCAATGACAACGCAGCAGAGTAATTCTCAGAGCTTCTCTACATCACAT
GAAGGCTTGGAAGAAGATAAAGACCATCCAACAACTTCTACTCTGACATCAAGCAATAGGAATGATGTCACAGGTGGAAGAAGAGACCCA
AATCATTCTGAAGGCTCAACTACTTTACTGGAAGGTTATACCTCTCATTACCCACACACGAAGGAAAGCAGGACCTTCATCCCAGTGACC
TCAGCTAAGACTGGGTCCTTTGGAGTTACTGCAGTTACTGTTGGAGATTCCAACTCTAATGTCAATCGTTCCTTATCAGGAGACCAAGAC
ACATTCCACCCCAGTGGGGGGTCCCATACCACTCATGGATCTGAATCAGATGGACACTCACATGGGAGTCAAGAAGGTGGAGCAAACACA
ACCTCTGGTCCTATAAGGACACCCCAAATTCCAGAATGGCTGATCATCTTGGCATCCCTCTTGGCCTTGGCTTTGATTCTTGCAGTTTGC
ATTGCAGTCAACAGTCGAAGAAGGTGTGGGCAGAAGAAAAAGCTAGTGATCAACAGTGGCAATGGAGCTGTGGAGGACAGAAAGCCAAGT
GGACTCAACGGAGAGGCCAGCAAGTCTCAGGAAATGGTGCATTTGGTGAACAAGGAGTCGTCAGAAACTCCAGACCAGTTTATGACAGCT

>In-frame_LDLRAD3_ENST00000315571_chr11_35965694_+_CD44_ENST00000526669_chr11_35198122_+_600nt
ATGTGGCTGCTGGGGCCGCTGTGCCTGCTGCTGAGCAGCGCCGCGGATTTGAATATAACCTGCCGCTTTGCAGGTGTATTCCACGTGGAG
AAAAATGGTCGCTACAGCATCTCTCGGACGGAGGCCGCTGACCTCTGCAAGGCTTTCAATAGCACCTTGCCCACAATGGCCCAGATGGAG
AAAGCTCTGAGCATCGGATTTGAGACCTGCAGGTATGGGTTCATAGAAGGGCACGTGGTGATTCCCCGGATCCACCCCAACTCCATCTGT
GGAGCAAACACAACCTCTGGTCCTATAAGGACACCCCAAATTCCAGAATGGCTGATCATCTTGGCATCCCTCTTGGCCTTGGCTTTGATT
CTTGCAGTTTGCATTGCAGTCAACAGTCGAAGAAGGTGTGGGCAGAAGAAAAAGCTAGTGATCAACAGTGGCAATGGAGCTGTGGAGGAC
AGAAAGCCAAGTGGACTCAACGGAGAGGCCAGCAAGTCTCAGGAAATGGTGCATTTGGTGAACAAGGAGTCGTCAGAAACTCCAGACCAG

>In-frame_LDLRAD3_ENST00000315571_chr11_35965694_+_CD44_ENST00000433892_chr11_35198122_+_1461nt
ATGTGGCTGCTGGGGCCGCTGTGCCTGCTGCTGAGCAGCGCCGCGGATTTGAATATAACCTGCCGCTTTGCAGGTGTATTCCACGTGGAG
AAAAATGGTCGCTACAGCATCTCTCGGACGGAGGCCGCTGACCTCTGCAAGGCTTTCAATAGCACCTTGCCCACAATGGCCCAGATGGAG
AAAGCTCTGAGCATCGGATTTGAGACCTGCAGGTATGGGTTCATAGAAGGGCACGTGGTGATTCCCCGGATCCACCCCAACTCCATCTGT
GCAGCAAACAACACAGGGGTGTACATCCTCACATCCAACACCTCCCAGTATGACACATATTGCTTCAATGCTTCAGCTCCACCTGAAGAA
GATTGTACATCAGTCACAGACCTGCCCAATGCCTTTGATGGACCAATTACCATAACTATTGTTAACCGTGATGGCACCCGCTATGTCCAG
AAAGGAGAATACAGAACGAATCCTGAAGACATCTACCCCAGCAACCCTACTGATGATGACGTGAGCAGCGGCTCCTCCAGTGAAAGGAGC
AGCACTTCAGGAGGTTACATCTTTTACACCTTTTCTACTGTACACCCCATCCCAGACGAAGACAGTCCCTGGATCACCGACAGCACAGAC
AGAATCCCTGCTACCAATATGGACTCCAGTCATAGTATAACGCTTCAGCCTACTGCAAATCCAAACACAGGTTTGGTGGAAGATTTGGAC
AGGACAGGACCTCTTTCAATGACAACGCAGCAGAGTAATTCTCAGAGCTTCTCTACATCACATGAAGGCTTGGAAGAAGATAAAGACCAT
CCAACAACTTCTACTCTGACATCAAGCAATAGGAATGATGTCACAGGTGGAAGAAGAGACCCAAATCATTCTGAAGGCTCAACTACTTTA
CTGGAAGGTTATACCTCTCATTACCCACACACGAAGGAAAGCAGGACCTTCATCCCAGTGACCTCAGCTAAGACTGGGTCCTTTGGAGTT
ACTGCAGTTACTGTTGGAGATTCCAACTCTAATGTCAATCGTTCCTTATCAGGAGACCAAGACACATTCCACCCCAGTGGGGGGTCCCAT
ACCACTCATGGATCTGAATCAGATGGACACTCACATGGGAGTCAAGAAGGTGGAGCAAACACAACCTCTGGTCCTATAAGGACACCCCAA
ATTCCAGAATGGCTGATCATCTTGGCATCCCTCTTGGCCTTGGCTTTGATTCTTGCAGTTTGCATTGCAGTCAACAGTCGAAGAAGGTGT
GGGCAGAAGAAAAAGCTAGTGATCAACAGTGGCAATGGAGCTGTGGAGGACAGAAAGCCAAGTGGACTCAACGGAGAGGCCAGCAAGTCT
CAGGAAATGGTGCATTTGGTGAACAAGGAGTCGTCAGAAACTCCAGACCAGTTTATGACAGCTGATGAGACAAGGAACCTGCAGAATGTG

>In-frame_LDLRAD3_ENST00000315571_chr11_35965694_+_CD44_ENST00000278386_chr11_35198122_+_399nt
ATGTGGCTGCTGGGGCCGCTGTGCCTGCTGCTGAGCAGCGCCGCGGATTTGAATATAACCTGCCGCTTTGCAGGTGTATTCCACGTGGAG
AAAAATGGTCGCTACAGCATCTCTCGGACGGAGGCCGCTGACCTCTGCAAGGCTTTCAATAGCACCTTGCCCACAATGGCCCAGATGGAG
AAAGCTCTGAGCATCGGATTTGAGACCTGCAGTTTGCATTGCAGTCAACAGTCGAAGAAGGTGTGGGCAGAAGAAAAAGCTAGTGATCAA
CAGTGGCAATGGAGCTGTGGAGGACAGAAAGCCAAGTGGACTCAACGGAGAGGCCAGCAAGTCTCAGGAAATGGTGCATTTGGTGAACAA

>In-frame_LDLRAD3_ENST00000315571_chr11_35965694_+_CD44_ENST00000434472_chr11_35198122_+_1269nt
ATGTGGCTGCTGGGGCCGCTGTGCCTGCTGCTGAGCAGCGCCGCGGATTTGAATATAACCTGCCGCTTTGCAGGTGTATTCCACGTGGAG
AAAAATGGTCGCTACAGCATCTCTCGGACGGAGGCCGCTGACCTCTGCAAGGCTTTCAATAGCACCTTGCCCACAATGGCCCAGATGGAG
AAAGCTCTGAGCATCGGATTTGAGACCTGCAGGTATGGGTTCATAGAAGGGCACGTGGTGATTCCCCGGATCCACCCCAACTCCATCTGT
GCAGCAAACAACACAGGGGTGTACATCCTCACATCCAACACCTCCCAGTATGACACATATTGCTTCAATGCTTCAGCTCCACCTGAAGAA
GATTGTACATCAGTCACAGACCTGCCCAATGCCTTTGATGGACCAATTACCATAACTATTGTTAACCGTGATGGCACCCGCTATGTCCAG
AAAGGAGAATACAGAACGAATCCTGAAGACATCTACCCCAGCAACCCTACTGATGATGACGTGAGCAGCGGCTCCTCCAGTGAAAGGAGC
AGCACTTCAGGAGGTTACATCTTTTACACCTTTTCTACTGTACACCCCATCCCAGACGAAGACAGTCCCTGGATCACCGACAGCACAGAC
AGAATCCCTGCTACCAATAGGAATGATGTCACAGGTGGAAGAAGAGACCCAAATCATTCTGAAGGCTCAACTACTTTACTGGAAGGTTAT
ACCTCTCATTACCCACACACGAAGGAAAGCAGGACCTTCATCCCAGTGACCTCAGCTAAGACTGGGTCCTTTGGAGTTACTGCAGTTACT
GTTGGAGATTCCAACTCTAATGTCAATCGTTCCTTATCAGGAGACCAAGACACATTCCACCCCAGTGGGGGGTCCCATACCACTCATGGA
TCTGAATCAGATGGACACTCACATGGGAGTCAAGAAGGTGGAGCAAACACAACCTCTGGTCCTATAAGGACACCCCAAATTCCAGAATGG
CTGATCATCTTGGCATCCCTCTTGGCCTTGGCTTTGATTCTTGCAGTTTGCATTGCAGTCAACAGTCGAAGAAGGTGTGGGCAGAAGAAA
AAGCTAGTGATCAACAGTGGCAATGGAGCTGTGGAGGACAGAAAGCCAAGTGGACTCAACGGAGAGGCCAGCAAGTCTCAGGAAATGGTG
CATTTGGTGAACAAGGAGTCGTCAGAAACTCCAGACCAGTTTATGACAGCTGATGAGACAAGGAACCTGCAGAATGTGGACATGAAGATT

>In-frame_LDLRAD3_ENST00000315571_chr11_35965694_+_CD44_ENST00000352818_chr11_35198122_+_1002nt
ATGTGGCTGCTGGGGCCGCTGTGCCTGCTGCTGAGCAGCGCCGCGGATTTGAATATAACCTGCCGCTTTGCAGGTGTATTCCACGTGGAG
AAAAATGGTCGCTACAGCATCTCTCGGACGGAGGCCGCTGACCTCTGCAAGGCTTTCAATAGCACCTTGCCCACAATGGCCCAGATGGAG
AAAGCTCTGAGCATCGGATTTGAGACCTGCAGGTATGGGTTCATAGAAGGGCACGTGGTGATTCCCCGGATCCACCCCAACTCCATCTGT
GCAGCAAACAACACAGGGGTGTACATCCTCACATCCAACACCTCCCAGTATGACACATATTGCTTCAATGCTTCAGCTCCACCTGAAGAA
GATTGTACATCAGTCACAGACCTGCCCAATGCCTTTGATGGACCAATTACCATAACTATTGTTAACCGTGATGGCACCCGCTATGTCCAG
AAAGGAGAATACAGAACGAATCCTGAAGACATCTACCCCAGCAACCCTACTGATGATGACGTGAGCAGCGGCTCCTCCAGTGAAAGGAGC
AGCACTTCAGGAGGTTACATCTTTTACACCTTTTCTACTGTACACCCCATCCCAGACGAAGACAGTCCCTGGATCACCGACAGCACAGAC
AGAATCCCTGCTACCAGACACTCACATGGGAGTCAAGAAGGTGGAGCAAACACAACCTCTGGTCCTATAAGGACACCCCAAATTCCAGAA
TGGCTGATCATCTTGGCATCCCTCTTGGCCTTGGCTTTGATTCTTGCAGTTTGCATTGCAGTCAACAGTCGAAGAAGGTGTGGGCAGAAG
AAAAAGCTAGTGATCAACAGTGGCAATGGAGCTGTGGAGGACAGAAAGCCAAGTGGACTCAACGGAGAGGCCAGCAAGTCTCAGGAAATG
GTGCATTTGGTGAACAAGGAGTCGTCAGAAACTCCAGACCAGTTTATGACAGCTGATGAGACAAGGAACCTGCAGAATGTGGACATGAAG


* Fusion transcript sequences (Full-length transcript).
>In-frame_LDLRAD3_ENST00000524419_chr11_35965694_+_CD44_ENST00000263398_chr11_35198122_+_4252nt
GAAGGCGGGAGGGAGGAGGGCCAGGCGGGAGGGCGGGGACGGCGCGGCGAGGGGCGGGGTCAGCGCCGAGGCCGCGGGGGCAGCAACGAC
GCCGGGCAGCGGGAGCGGCGGCCGCGCCATGTGGCTGCTGGGGCCGCTGTGCCTGCTGCTGAGCAGCGCCGCGGATTTGAATATAACCTG
CCGCTTTGCAGGTGTATTCCACGTGGAGAAAAATGGTCGCTACAGCATCTCTCGGACGGAGGCCGCTGACCTCTGCAAGGCTTTCAATAG
CACCTTGCCCACAATGGCCCAGATGGAGAAAGCTCTGAGCATCGGATTTGAGACCTGCAGGTATGGGTTCATAGAAGGGCACGTGGTGAT
TCCCCGGATCCACCCCAACTCCATCTGTGCAGCAAACAACACAGGGGTGTACATCCTCACATCCAACACCTCCCAGTATGACACATATTG
CTTCAATGCTTCAGCTCCACCTGAAGAAGATTGTACATCAGTCACAGACCTGCCCAATGCCTTTGATGGACCAATTACCATAACTATTGT
TAACCGTGATGGCACCCGCTATGTCCAGAAAGGAGAATACAGAACGAATCCTGAAGACATCTACCCCAGCAACCCTACTGATGATGACGT
GAGCAGCGGCTCCTCCAGTGAAAGGAGCAGCACTTCAGGAGGTTACATCTTTTACACCTTTTCTACTGTACACCCCATCCCAGACGAAGA
CAGTCCCTGGATCACCGACAGCACAGACAGAATCCCTGCTACCAGAGACCAAGACACATTCCACCCCAGTGGGGGGTCCCATACCACTCA
TGGATCTGAATCAGATGGACACTCACATGGGAGTCAAGAAGGTGGAGCAAACACAACCTCTGGTCCTATAAGGACACCCCAAATTCCAGA
ATGGCTGATCATCTTGGCATCCCTCTTGGCCTTGGCTTTGATTCTTGCAGTTTGCATTGCAGTCAACAGTCGAAGAAGGTGTGGGCAGAA
GAAAAAGCTAGTGATCAACAGTGGCAATGGAGCTGTGGAGGACAGAAAGCCAAGTGGACTCAACGGAGAGGCCAGCAAGTCTCAGGAAAT
GGTGCATTTGGTGAACAAGGAGTCGTCAGAAACTCCAGACCAGTTTATGACAGCTGATGAGACAAGGAACCTGCAGAATGTGGACATGAA
GATTGGGGTGTAACACCTACACCATTATCTTGGAAAGAAACAACCGTTGGAAACATAACCATTACAGGGAGCTGGGACACTTAACAGATG
CAATGTGCTACTGATTGTTTCATTGCGAATCTTTTTTAGCATAAAATTTTCTACTCTTTTTGTTTTTTGTGTTTTGTTCTTTAAAGTCAG
GTCCAATTTGTAAAAACAGCATTGCTTTCTGAAATTAGGGCCCAATTAATAATCAGCAAGAATTTGATCGTTCCAGTTCCCACTTGGAGG
CCTTTCATCCCTCGGGTGTGCTATGGATGGCTTCTAACAAAAACTACACATATGTATTCCTGATCGCCAACCTTTCCCCCACCAGCTAAG
GACATTTCCCAGGGTTAATAGGGCCTGGTCCCTGGGAGGAAATTTGAATGGGTCCATTTTGCCCTTCCATAGCCTAATCCCTGGGCATTG
CTTTCCACTGAGGTTGGGGGTTGGGGTGTACTAGTTACACATCTTCAACAGACCCCCTCTAGAAATTTTTCAGATGCTTCTGGGAGACAC
CCAAAGGGTGAAGCTATTTATCTGTAGTAAACTATTTATCTGTGTTTTTGAAATATTAAACCCTGGATCAGTCCTTTGATCAGTATAATT
TTTTAAAGTTACTTTGTCAGAGGCACAAAAGGGTTTAAACTGATTCATAATAAATATCTGTACTTCTTCGATCTTCACCTTTTGTGCTGT
GATTCTTCAGTTTCTAAACCAGCACTGTCTGGGTCCCTACAATGTATCAGGAAGAGCTGAGAATGGTAAGGAGACTCTTCTAAGTCTTCA
TCTCAGAGACCCTGAGTTCCCACTCAGACCCACTCAGCCAAATCTCATGGAAGACCAAGGAGGGCAGCACTGTTTTTGTTTTTTGTTTTT
TGTTTTTTTTTTTTGACACTGTCCAAAGGTTTTCCATCCTGTCCTGGAATCAGAGTTGGAAGCTGAGGAGCTTCAGCCTCTTTTATGGTT
TAATGGCCACCTGTTCTCTCCTGTGAAAGGCTTTGCAAAGTCACATTAAGTTTGCATGACCTGTTATCCCTGGGGCCCTATTTCATAGAG
GCTGGCCCTATTAGTGATTTCCAAAAACAATATGGAAGTGCCTTTTGATGTCTTACAATAAGAGAAGAAGCCAATGGAAATGAAAGAGAT
TGGCAAAGGGGAAGGATGATGCCATGTAGATCCTGTTTGACATTTTTATGGCTGTATTTGTAAACTTAAACACACCAGTGTCTGTTCTTG
ATGCAGTTGCTATTTAGGATGAGTTAAGTGCCTGGGGAGTCCCTCAAAAGGTTAAAGGGATTCCCATCATTGGAATCTTATCACCAGATA
GGCAAGTTTATGACCAAACAAGAGAGTACTGGCTTTATCCTCTAACCTCATATTTTCTCCCACTTGGCAAGTCCTTTGTGGCATTTATTC
ATCAGTCAGGGTGTCCGATTGGTCCTAGAACTTCCAAAGGCTGCTTGTCATAGAAGCCATTGCATCTATAAAGCAACGGCTCCTGTTAAA
TGGTATCTCCTTTCTGAGGCTCCTACTAAAAGTCATTTGTTACCTAAACTTATGTGCTTAACAGGCAATGCTTCTCAGACCACAAAGCAG
AAAGAAGAAGAAAAGCTCCTGACTAAATCAGGGCTGGGCTTAGACAGAGTTGATCTGTAGAATATCTTTAAAGGAGAGATGTCAACTTTC
TGCACTATTCCCAGCCTCTGCTCCTCCCTGTCTACCCTCTCCCCTCCCTCTCTCCCTCCACTTCACCCCACAATCTTGAAAAACTTCCTT
TCTCTTCTGTGAACATCATTGGCCAGATCCATTTTCAGTGGTCTGGATTTCTTTTTATTTTCTTTTCAACTTGAAAGAAACTGGACATTA
GGCCACTATGTGTTGTTACTGCCACTAGTGTTCAAGTGCCTCTTGTTTTCCCAGAGATTTCCTGGGTCTGCCAGAGGCCCAGACAGGCTC
ACTCAAGCTCTTTAACTGAAAAGCAACAAGCCACTCCAGGACAAGGTTCAAAATGGTTACAACAGCCTCTACCTGTCGCCCCAGGGAGAA
AGGGGTAGTGATACAAGTCTCATAGCCAGAGATGGTTTTCCACTCCTTCTAGATATTCCCAAAAAGAGGCTGAGACAGGAGGTTATTTTC
AATTTTATTTTGGAATTAAATACTTTTTTCCCTTTATTACTGTTGTAGTCCCTCACTTGGATATACCTCTGTTTTCACGATAGAAATAAG
GGAGGTCTAGAGCTTCTATTCCTTGGCCATTGTCAACGGAGAGCTGGCCAAGTCTTCACAAACCCTTGCAACATTGCCTGAAGTTTATGG
AATAAGATGTATTCTCACTCCCTTGATCTCAAGGGCGTAACTCTGGAAGCACAGCTTGACTACACGTCATTTTTACCAATGATTTTCAGG
TGACCTGGGCTAAGTCATTTAAACTGGGTCTTTATAAAAGTAAAAGGCCAACATTTAATTATTTTGCAAAGCAACCTAAGAGCTAAAGAT
GTAATTTTTCTTGCAATTGTAAATCTTTTGTGTCTCCTGAAGACTTCCCTTAAAATTAGCTCTGAGTGAAAAATCAAAAGAGACAAAAGA
CATCTTCGAATCCATATTTCAAGCCTGGTAGAATTGGCTTTTCTAGCAGAACCTTTCCAAAAGTTTTATATTGAGATTCATAACAACACC
AAGAATTGATTTTGTAGCCAACATTCATTCAATACTGTTATATCAGAGGAGTAGGAGAGAGGAAACATTTGACTTATCTGGAAAAGCAAA
ATGTACTTAAGAATAAGAATAACATGGTCCATTCACCTTTATGTTATAGATATGTCTTTGTGTAAATCATTTGTTTTGAGTTTTCAAAGA
ATAGCCCATTGTTCATTCTTGTGCTGTACAATGACCACTGTTATTGTTACTTTGACTTTTCAGAGCACACCCTTCCTCTGGTTTTTGTAT
ATTTATTGATGGATCAATAATAATGAGGAAAGCATGATATGTATATTGCTGAGTTGAAAGCACTTATTGGAAAATATTAAAAGGCTAACA

>In-frame_LDLRAD3_ENST00000524419_chr11_35965694_+_CD44_ENST00000449691_chr11_35198122_+_2332nt
GAAGGCGGGAGGGAGGAGGGCCAGGCGGGAGGGCGGGGACGGCGCGGCGAGGGGCGGGGTCAGCGCCGAGGCCGCGGGGGCAGCAACGAC
GCCGGGCAGCGGGAGCGGCGGCCGCGCCATGTGGCTGCTGGGGCCGCTGTGCCTGCTGCTGAGCAGCGCCGCGGATTTGAATATAACCTG
CCGCTTTGCAGGTGTATTCCACGTGGAGAAAAATGGTCGCTACAGCATCTCTCGGACGGAGGCCGCTGACCTCTGCAAGGCTTTCAATAG
CACCTTGCCCACAATGGCCCAGATGGAGAAAGCTCTGAGCATCGGATTTGAGACCTGCAGGTATGGGTTCATAGAAGGGCACGTGGTGAT
TCCCCGGATCCACCCCAACTCCATCTGTGCAGCAAACAACACAGGGGTGTACATCCTCACATCCAACACCTCCCAGTATGACACATATTG
CTTCAATGCTTCAGCTCCACCTGAAGAAGATTGTACATCAGTCACAGACCTGCCCAATGCCTTTGATGGACCAATTACCATAACTATTGT
TAACCGTGATGGCACCCGCTATGTCCAGAAAGGAGAATACAGAACGAATCCTGAAGACATCTACCCCAGCAACCCTACTGATGATGACGT
GAGCAGCGGCTCCTCCAGTGAAAGGAGCAGCACTTCAGGAGGTTACATCTTTTACACCTTTTCTACTGTACACCCCATCCCAGACGAAGA
CAGTCCCTGGATCACCGACAGCACAGACAGAATCCCTGCTACCACTTTGATGAGCACTAGTGCTACAGCAACTGAGACAGCAACCAAGAG
GCAAGAAACCTGGGATTGGTTTTCATGGTTGTTTCTACCATCAGAGTCAAAGAATCATCTTCACACAACAACACAAATGGCTGGTACGTC
TTCAAATACCATCTCAGCAGGCTGGGAGCCAAATGAAGAAAATGAAGATGAAAGAGACAGACACCTCAGTTTTTCTGGATCAGGCATTGA
TGATGATGAAGATTTTATCTCCAGCACCATTTCAACCACACCACGGGCTTTTGACCACACAAAACAGAACCAGGACTGGACCCAGTGGAA
CCCAAGCCATTCAAATCCGGAAGTGCTACTTCAGACAACCACAAGGATGACTGATGTAGACAGAAATGGCACCACTGCTTATGAAGGAAA
CTGGAACCCAGAAGCACACCCTCCCCTCATTCACCATGAGCATCATGAGGAAGAAGAGACCCCACATTCTACAAGCACAACAGCCTCAGC
TCATACCAGCCATCCAATGCAAGGAAGGACAACACCAAGCCCAGAGGACAGTTCCTGGACTGATTTCTTCAACCCAATCTCACACCCCAT
GGGACGAGGTCATCAAGCAGGAAGAAGGATGGATATGGACTCCAGTCATAGTATAACGCTTCAGCCTACTGCAAATCCAAACACAGGTTT
GGTGGAAGATTTGGACAGGACAGGACCTCTTTCAATGACAACGCAGCAGAGTAATTCTCAGAGCTTCTCTACATCACATGAAGGCTTGGA
AGAAGATAAAGACCATCCAACAACTTCTACTCTGACATCAAGCAATAGGAATGATGTCACAGGTGGAAGAAGAGACCCAAATCATTCTGA
AGGCTCAACTACTTTACTGGAAGGTTATACCTCTCATTACCCACACACGAAGGAAAGCAGGACCTTCATCCCAGTGACCTCAGCTAAGAC
TGGGTCCTTTGGAGTTACTGCAGTTACTGTTGGAGATTCCAACTCTAATGTCAATCGTTCCTTATCAGGAGACCAAGACACATTCCACCC
CAGTGGGGGGTCCCATACCACTCATGGATCTGAATCAGATGGACACTCACATGGGAGTCAAGAAGGTGGAGCAAACACAACCTCTGGTCC
TATAAGGACACCCCAAATTCCAGAATGGCTGATCATCTTGGCATCCCTCTTGGCCTTGGCTTTGATTCTTGCAGTTTGCATTGCAGTCAA
CAGTCGAAGAAGGTGTGGGCAGAAGAAAAAGCTAGTGATCAACAGTGGCAATGGAGCTGTGGAGGACAGAAAGCCAAGTGGACTCAACGG
AGAGGCCAGCAAGTCTCAGGAAATGGTGCATTTGGTGAACAAGGAGTCGTCAGAAACTCCAGACCAGTTTATGACAGCTGATGAGACAAG
GAACCTGCAGAATGTGGACATGAAGATTGGGGTGTAACACCTACACCATTATCTTGGAAAGAAACAACCGTTGGAAACATAACCATTACA

>In-frame_LDLRAD3_ENST00000524419_chr11_35965694_+_CD44_ENST00000360158_chr11_35198122_+_1423nt
GAAGGCGGGAGGGAGGAGGGCCAGGCGGGAGGGCGGGGACGGCGCGGCGAGGGGCGGGGTCAGCGCCGAGGCCGCGGGGGCAGCAACGAC
GCCGGGCAGCGGGAGCGGCGGCCGCGCCATGTGGCTGCTGGGGCCGCTGTGCCTGCTGCTGAGCAGCGCCGCGGATTTGAATATAACCTG
CCGCTTTGCAGGTGTATTCCACGTGGAGAAAAATGGTCGCTACAGCATCTCTCGGACGGAGGCCGCTGACCTCTGCAAGGCTTTCAATAG
CACCTTGCCCACAATGGCCCAGATGGAGAAAGCTCTGAGCATCGGATTTGAGACCTGCAGGTATGGGTTCATAGAAGGGCACGTGGTGAT
TCCCCGGATCCACCCCAACTCCATCTGTGCAGCAAACAACACAGGGGTGTACATCCTCACATCCAACACCTCCCAGTATGACACATATTG
CTTCAATGCTTCAGCTCCACCTGAAGAAGATTGTACATCAGTCACAGACCTGCCCAATGCCTTTGATGGACCAATTACCATAACTATTGT
TAACCGTGATGGCACCCGCTATGTCCAGAAAGGAGAATACAGAACGAATCCTGAAGACATCTACCCCAGCAACCCTACTGATGATGACGT
GAGCAGCGGCTCCTCCAGTGAAAGGAGCAGCACTTCAGGAGGTTACATCTTTTACACCTTTTCTACTGTACACCCCATCCCAGACGAAGA
CAGTCCCTGGATCACCGACAGCACAGACAGAATCCCTGCTACCAATATGGACTCCAGTCATAGTATAACGCTTCAGCCTACTGCAAATCC
AAACACAGGTTTGGTGGAAGATTTGGACAGGACAGGACCTCTTTCAATGACAACGCGTAGAGACCAAGACACATTCCACCCCAGTGGGGG
GTCCCATACCACTCATGGATCTGAATCAGATGGACACTCACATGGGAGTCAAGAAGGTGGAGCAAACACAACCTCTGGTCCTATAAGGAC
ACCCCAAATTCCAGAATGGCTGATCATCTTGGCATCCCTCTTGGCCTTGGCTTTGATTCTTGCAGTTTGCATTGCAGTCAACAGTCGAAG
AAGGTGTGGGCAGAAGAAAAAGCTAGTGATCAACAGTGGCAATGGAGCTGTGGAGGACAGAAAGCCAAGTGGACTCAACGGAGAGGCCAG
CAAGTCTCAGGAAATGGTGCATTTGGTGAACAAGGAGTCGTCAGAAACTCCAGACCAGTTTATGACAGCTGATGAGACAAGGAACCTGCA
GAATGTGGACATGAAGATTGGGGTGTAACACCTACACCATTATCTTGGAAAGAAACAACCGTTGGAAACATAACCATTACAGGGAGCTGG

>In-frame_LDLRAD3_ENST00000524419_chr11_35965694_+_CD44_ENST00000415148_chr11_35198122_+_2332nt
GAAGGCGGGAGGGAGGAGGGCCAGGCGGGAGGGCGGGGACGGCGCGGCGAGGGGCGGGGTCAGCGCCGAGGCCGCGGGGGCAGCAACGAC
GCCGGGCAGCGGGAGCGGCGGCCGCGCCATGTGGCTGCTGGGGCCGCTGTGCCTGCTGCTGAGCAGCGCCGCGGATTTGAATATAACCTG
CCGCTTTGCAGGTGTATTCCACGTGGAGAAAAATGGTCGCTACAGCATCTCTCGGACGGAGGCCGCTGACCTCTGCAAGGCTTTCAATAG
CACCTTGCCCACAATGGCCCAGATGGAGAAAGCTCTGAGCATCGGATTTGAGACCTGCAGGTATGGGTTCATAGAAGGGCACGTGGTGAT
TCCCCGGATCCACCCCAACTCCATCTGTGCAGCAAACAACACAGGGGTGTACATCCTCACATCCAACACCTCCCAGTATGACACATATTG
CTTCAATGCTTCAGCTCCACCTGAAGAAGATTGTACATCAGTCACAGACCTGCCCAATGCCTTTGATGGACCAATTACCATAACTATTGT
TAACCGTGATGGCACCCGCTATGTCCAGAAAGGAGAATACAGAACGAATCCTGAAGACATCTACCCCAGCAACCCTACTGATGATGACGT
GAGCAGCGGCTCCTCCAGTGAAAGGAGCAGCACTTCAGGAGGTTACATCTTTTACACCTTTTCTACTGTACACCCCATCCCAGACGAAGA
CAGTCCCTGGATCACCGACAGCACAGACAGAATCCCTGCTACCAGTACGTCTTCAAATACCATCTCAGCAGGCTGGGAGCCAAATGAAGA
AAATGAAGATGAAAGAGACAGACACCTCAGTTTTTCTGGATCAGGCATTGATGATGATGAAGATTTTATCTCCAGCACCATTTCAACCAC
ACCACGGGCTTTTGACCACACAAAACAGAACCAGGACTGGACCCAGTGGAACCCAAGCCATTCAAATCCGGAAGTGCTACTTCAGACAAC
CACAAGGATGACTGATGTAGACAGAAATGGCACCACTGCTTATGAAGGAAACTGGAACCCAGAAGCACACCCTCCCCTCATTCACCATGA
GCATCATGAGGAAGAAGAGACCCCACATTCTACAAGCACAATCCAGGCAACTCCTAGTAGTACAACGGAAGAAACAGCTACCCAGAAGGA
ACAGTGGTTTGGCAACAGATGGCATGAGGGATATCGCCAAACACCCAAAGAAGACTCCCATTCGACAACAGGGACAGCTGCAGCCTCAGC
TCATACCAGCCATCCAATGCAAGGAAGGACAACACCAAGCCCAGAGGACAGTTCCTGGACTGATTTCTTCAACCCAATCTCACACCCCAT
GGGACGAGGTCATCAAGCAGGAAGAAGGATGGATATGGACTCCAGTCATAGTATAACGCTTCAGCCTACTGCAAATCCAAACACAGGTTT
GGTGGAAGATTTGGACAGGACAGGACCTCTTTCAATGACAACGCAGCAGAGTAATTCTCAGAGCTTCTCTACATCACATGAAGGCTTGGA
AGAAGATAAAGACCATCCAACAACTTCTACTCTGACATCAAGCAATAGGAATGATGTCACAGGTGGAAGAAGAGACCCAAATCATTCTGA
AGGCTCAACTACTTTACTGGAAGGTTATACCTCTCATTACCCACACACGAAGGAAAGCAGGACCTTCATCCCAGTGACCTCAGCTAAGAC
TGGGTCCTTTGGAGTTACTGCAGTTACTGTTGGAGATTCCAACTCTAATGTCAATCGTTCCTTATCAGGAGACCAAGACACATTCCACCC
CAGTGGGGGGTCCCATACCACTCATGGATCTGAATCAGATGGACACTCACATGGGAGTCAAGAAGGTGGAGCAAACACAACCTCTGGTCC
TATAAGGACACCCCAAATTCCAGAATGGCTGATCATCTTGGCATCCCTCTTGGCCTTGGCTTTGATTCTTGCAGTTTGCATTGCAGTCAA
CAGTCGAAGAAGGTGTGGGCAGAAGAAAAAGCTAGTGATCAACAGTGGCAATGGAGCTGTGGAGGACAGAAAGCCAAGTGGACTCAACGG
AGAGGCCAGCAAGTCTCAGGAAATGGTGCATTTGGTGAACAAGGAGTCGTCAGAAACTCCAGACCAGTTTATGACAGCTGATGAGACAAG
GAACCTGCAGAATGTGGACATGAAGATTGGGGTGTAACACCTACACCATTATCTTGGAAAGAAACAACCGTTGGAAACATAACCATTACA

>In-frame_LDLRAD3_ENST00000524419_chr11_35965694_+_CD44_ENST00000437706_chr11_35198122_+_2257nt
GAAGGCGGGAGGGAGGAGGGCCAGGCGGGAGGGCGGGGACGGCGCGGCGAGGGGCGGGGTCAGCGCCGAGGCCGCGGGGGCAGCAACGAC
GCCGGGCAGCGGGAGCGGCGGCCGCGCCATGTGGCTGCTGGGGCCGCTGTGCCTGCTGCTGAGCAGCGCCGCGGATTTGAATATAACCTG
CCGCTTTGCAGGTGTATTCCACGTGGAGAAAAATGGTCGCTACAGCATCTCTCGGACGGAGGCCGCTGACCTCTGCAAGGCTTTCAATAG
CACCTTGCCCACAATGGCCCAGATGGAGAAAGCTCTGAGCATCGGATTTGAGACCTGCAGGTATGGGTTCATAGAAGGGCACGTGGTGAT
TCCCCGGATCCACCCCAACTCCATCTGTGCAGCAAACAACACAGGGGTGTACATCCTCACATCCAACACCTCCCAGTATGACACATATTG
CTTCAATGCTTCAGCTCCACCTGAAGAAGATTGTACATCAGTCACAGACCTGCCCAATGCCTTTGATGGACCAATTACCATAACTATTGT
TAACCGTGATGGCACCCGCTATGTCCAGAAAGGAGAATACAGAACGAATCCTGAAGACATCTACCCCAGCAACCCTACTGATGATGACGT
GAGCAGCGGCTCCTCCAGTGAAAGGAGCAGCACTTCAGGAGGTTACATCTTTTACACCTTTTCTACTGTACACCCCATCCCAGACGAAGA
CAGTCCCTGGATCACCGACAGCACAGACAGAATCCCTGCTACCACTTTGATGAGCACTAGTGCTACAGCAACTGAGACAGCAACCAAGAG
GCAAGAAACCTGGGATTGGTTTTCATGGTTGTTTCTACCATCAGAGTCAAAGAATCATCTTCACACAACAACACAAATGGCTGGTACGTC
TTCAAATACCATCTCAGCAGGCTGGGAGCCAAATGAAGAAAATGAAGATGAAAGAGACAGACACCTCAGTTTTTCTGGATCAGGCATTGA
TGATGATGAAGATTTTATCTCCAGCACCATTTCAACCACACCACGGGCTTTTGACCACACAAAACAGAACCAGGACTGGACCCAGTGGAA
CCCAAGCCATTCAAATCCGGAAGTGCTACTTCAGACAACCACAAGGATGACTGATGTAGACAGAAATGGCACCACTGCTTATGAAGGAAA
CTGGAACCCAGAAGCACACCCTCCCCTCATTCACCATGAGCATCATGAGGAAGAAGAGACCCCACATTCTACAAGCACAATCCAGGCAAC
TCCTAGTAGTACAACGGAAGAAACAGCTACCCAGAAGGAACAGTGGTTTGGCAACAGATGGCATGAGGGATATCGCCAAACACCCAAAGA
AGACTCCCATTCGACAACAGGGACAGCTGCAGCCTCAGCTCATACCAGCCATCCAATGCAAGGAAGGACAACACCAAGCCCAGAGGACAG
TTCCTGGACTGATTTCTTCAACCCAATCTCACACCCCATGGGACGAGGTCATCAAGCAGGAAGAAGGATGGATATGGACTCCAGTCATAG
TATAACGCTTCAGCCTACTGCAAATCCAAACACAGGTTTGGTGGAAGATTTGGACAGGACAGGACCTCTTTCAATGACAACGCAGCAGAG
TAATTCTCAGAGCTTCTCTACATCACATGAAGGCTTGGAAGAAGATAAAGACCATCCAACAACTTCTACTCTGACATCAAGCAGAGACCA
AGACACATTCCACCCCAGTGGGGGGTCCCATACCACTCATGGATCTGAATCAGATGGACACTCACATGGGAGTCAAGAAGGTGGAGCAAA
CACAACCTCTGGTCCTATAAGGACACCCCAAATTCCAGAATGGCTGATCATCTTGGCATCCCTCTTGGCCTTGGCTTTGATTCTTGCAGT
TTGCATTGCAGTCAACAGTCGAAGAAGGTGTGGGCAGAAGAAAAAGCTAGTGATCAACAGTGGCAATGGAGCTGTGGAGGACAGAAAGCC
AAGTGGACTCAACGGAGAGGCCAGCAAGTCTCAGGAAATGGTGCATTTGGTGAACAAGGAGTCGTCAGAAACTCCAGACCAGTTTATGAC
AGCTGATGAGACAAGGAACCTGCAGAATGTGGACATGAAGATTGGGGTGTAACACCTACACCATTATCTTGGAAAGAAACAACCGTTGGA
AACATAACCATTACAGGGAGCTGGGACACTTAACAGATGCAATGTGCTACTGATTGTTTCATTGCGAATCTTTTTTAGCATAAAATTTTC

>In-frame_LDLRAD3_ENST00000524419_chr11_35965694_+_CD44_ENST00000433354_chr11_35198122_+_2377nt
GAAGGCGGGAGGGAGGAGGGCCAGGCGGGAGGGCGGGGACGGCGCGGCGAGGGGCGGGGTCAGCGCCGAGGCCGCGGGGGCAGCAACGAC
GCCGGGCAGCGGGAGCGGCGGCCGCGCCATGTGGCTGCTGGGGCCGCTGTGCCTGCTGCTGAGCAGCGCCGCGGATTTGAATATAACCTG
CCGCTTTGCAGGTGTATTCCACGTGGAGAAAAATGGTCGCTACAGCATCTCTCGGACGGAGGCCGCTGACCTCTGCAAGGCTTTCAATAG
CACCTTGCCCACAATGGCCCAGATGGAGAAAGCTCTGAGCATCGGATTTGAGACCTGCAGGTATGGGTTCATAGAAGGGCACGTGGTGAT
TCCCCGGATCCACCCCAACTCCATCTGTGCAGCAAACAACACAGGGGTGTACATCCTCACATCCAACACCTCCCAGTATGACACATATTG
CTTCAATGCTTCAGCTCCACCTGAAGAAGATTGTACATCAGTCACAGACCTGCCCAATGCCTTTGATGGACCAATTACCATAACTATTGT
TAACCGTGATGGCACCCGCTATGTCCAGAAAGGAGAATACAGAACGAATCCTGAAGACATCTACCCCAGCAACCCTACTGATGATGACGT
GAGCAGCGGCTCCTCCAGTGAAAGGAGCAGCACTTCAGGAGGTTACATCTTTTACACCTTTTCTACTGTACACCCCATCCCAGACGAAGA
CAGTCCCTGGATCACCGACAGCACAGACAGAATCCCTGCTACCACTTTGATGAGCACTAGTGCTACAGCAACTGAGACAGCAACCAAGAG
GCAAGAAACCTGGGATTGGTTTTCATGGTTGTTTCTACCATCAGAGTCAAAGAATCATCTTCACACAACAACACAAATGGCTGGTACGTC
TTCAAATACCATCTCAGCAGGCTGGGAGCCAAATGAAGAAAATGAAGATGAAAGAGACAGACACCTCAGTTTTTCTGGATCAGGCATTGA
TGATGATGAAGATTTTATCTCCAGCACCATTTCAACCACACCACGGGCTTTTGACCACACAAAACAGAACCAGGACTGGACCCAGTGGAA
CCCAAGCCATTCAAATCCGGAAGTGCTACTTCAGACAACCACAAGGATGACTGCAGATGTAGACAGAAATGGCACCACTGCTTATGAAGG
AAACTGGAACCCAGAAGCACACCCTCCCCTCATTCACCATGAGCATCATGAGGAAGAAGAGACCCCACATTCTACAAGCACAATCCAGGC
AACTCCTAGTAGTACAACGGAAGAAACAGCTACCCAGAAGGAACAGTGGTTTGGCAACAGATGGCATGAGGGATATCGCCAAACACCCAA
AGAAGACTCCCATTCGACAACAGGGACAGCTGCAGCCTCAGCTCATACCAGCCATCCAATGCAAGGAAGGACAACACCAAGCCCAGAGGA
CAGTTCCTGGACTGATTTCTTCAACCCAATCTCACACCCCATGGGACGAGGTCATCAAGCAGGAAGAAGGATGGATATGGACTCCAGTCA
TAGTATAACGCTTCAGCCTACTGCAAATCCAAACACAGGTTTGGTGGAAGATTTGGACAGGACAGGACCTCTTTCAATGACAACGCGTAA
TAGGAATGATGTCACAGGTGGAAGAAGAGACCCAAATCATTCTGAAGGCTCAACTACTTTACTGGAAGGTTATACCTCTCATTACCCACA
CACGAAGGAAAGCAGGACCTTCATCCCAGTGACCTCAGCTAAGACTGGGTCCTTTGGAGTTACTGCAGTTACTGTTGGAGATTCCAACTC
TAATGTCAATCGTTCCTTATCAGGAGACCAAGACACATTCCACCCCAGTGGGGGGTCCCATACCACTCATGGATCTGAATCAGATGGACA
CTCACATGGGAGTCAAGAAGGTGGAGCAAACACAACCTCTGGTCCTATAAGGACACCCCAAATTCCAGAATGGCTGATCATCTTGGCATC
CCTCTTGGCCTTGGCTTTGATTCTTGCAGTTTGCATTGCAGTCAACAGTCGAAGAAGGTGTGGGCAGAAGAAAAAGCTAGTGATCAACAG
TGGCAATGGAGCTGTGGAGGACAGAAAGCCAAGTGGACTCAACGGAGAGGCCAGCAAGTCTCAGGAAATGGTGCATTTGGTGAACAAGGA
GTCGTCAGAAACTCCAGACCAGTTTATGACAGCTGATGAGACAAGGAACCTGCAGAATGTGGACATGAAGATTGGGGTGTAACACCTACA
CCATTATCTTGGAAAGAAACAACCGTTGGAAACATAACCATTACAGGGAGCTGGGACACTTAACAGATGCAATGTGCTACTGATTGTTTC

>In-frame_LDLRAD3_ENST00000524419_chr11_35965694_+_CD44_ENST00000428726_chr11_35198122_+_3020nt
GAAGGCGGGAGGGAGGAGGGCCAGGCGGGAGGGCGGGGACGGCGCGGCGAGGGGCGGGGTCAGCGCCGAGGCCGCGGGGGCAGCAACGAC
GCCGGGCAGCGGGAGCGGCGGCCGCGCCATGTGGCTGCTGGGGCCGCTGTGCCTGCTGCTGAGCAGCGCCGCGGATTTGAATATAACCTG
CCGCTTTGCAGGTGTATTCCACGTGGAGAAAAATGGTCGCTACAGCATCTCTCGGACGGAGGCCGCTGACCTCTGCAAGGCTTTCAATAG
CACCTTGCCCACAATGGCCCAGATGGAGAAAGCTCTGAGCATCGGATTTGAGACCTGCAGGTATGGGTTCATAGAAGGGCACGTGGTGAT
TCCCCGGATCCACCCCAACTCCATCTGTGCAGCAAACAACACAGGGGTGTACATCCTCACATCCAACACCTCCCAGTATGACACATATTG
CTTCAATGCTTCAGCTCCACCTGAAGAAGATTGTACATCAGTCACAGACCTGCCCAATGCCTTTGATGGACCAATTACCATAACTATTGT
TAACCGTGATGGCACCCGCTATGTCCAGAAAGGAGAATACAGAACGAATCCTGAAGACATCTACCCCAGCAACCCTACTGATGATGACGT
GAGCAGCGGCTCCTCCAGTGAAAGGAGCAGCACTTCAGGAGGTTACATCTTTTACACCTTTTCTACTGTACACCCCATCCCAGACGAAGA
CAGTCCCTGGATCACCGACAGCACAGACAGAATCCCTGCTACCACTTTGATGAGCACTAGTGCTACAGCAACTGAGACAGCAACCAAGAG
GCAAGAAACCTGGGATTGGTTTTCATGGTTGTTTCTACCATCAGAGTCAAAGAATCATCTTCACACAACAACACAAATGGCTGGTACGTC
TTCAAATACCATCTCAGCAGGCTGGGAGCCAAATGAAGAAAATGAAGATGAAAGAGACAGACACCTCAGTTTTTCTGGATCAGGCATTGA
TGATGATGAAGATTTTATCTCCAGCACCATTTCAACCACACCACGGGCTTTTGACCACACAAAACAGAACCAGGACTGGACCCAGTGGAA
CCCAAGCCATTCAAATCCGGAAGTGCTACTTCAGACAACCACAAGGATGACTGATGTAGACAGAAATGGCACCACTGCTTATGAAGGAAA
CTGGAACCCAGAAGCACACCCTCCCCTCATTCACCATGAGCATCATGAGGAAGAAGAGACCCCACATTCTACAAGCACAATCCAGGCAAC
TCCTAGTAGTACAACGGAAGAAACAGCTACCCAGAAGGAACAGTGGTTTGGCAACAGATGGCATGAGGGATATCGCCAAACACCCAAAGA
AGACTCCCATTCGACAACAGGGACAGCTGCAGCCTCAGCTCATACCAGCCATCCAATGCAAGGAAGGACAACACCAAGCCCAGAGGACAG
TTCCTGGACTGATTTCTTCAACCCAATCTCACACCCCATGGGACGAGGTCATCAAGCAGGAAGAAGGATGGATATGGACTCCAGTCATAG
TATAACGCTTCAGCCTACTGCAAATCCAAACACAGGTTTGGTGGAAGATTTGGACAGGACAGGACCTCTTTCAATGACAACGCAGCAGAG
TAATTCTCAGAGCTTCTCTACATCACATGAAGGCTTGGAAGAAGATAAAGACCATCCAACAACTTCTACTCTGACATCAAGCAATAGGAA
TGATGTCACAGGTGGAAGAAGAGACCCAAATCATTCTGAAGGCTCAACTACTTTACTGGAAGGTTATACCTCTCATTACCCACACACGAA
GGAAAGCAGGACCTTCATCCCAGTGACCTCAGCTAAGACTGGGTCCTTTGGAGTTACTGCAGTTACTGTTGGAGATTCCAACTCTAATGT
CAATCGTTCCTTATCAGGAGACCAAGACACATTCCACCCCAGTGGGGGGTCCCATACCACTCATGGATCTGAATCAGATGGACACTCACA
TGGGAGTCAAGAAGGTGGAGCAAACACAACCTCTGGTCCTATAAGGACACCCCAAATTCCAGAATGGCTGATCATCTTGGCATCCCTCTT
GGCCTTGGCTTTGATTCTTGCAGTTTGCATTGCAGTCAACAGTCGAAGAAGGTGTGGGCAGAAGAAAAAGCTAGTGATCAACAGTGGCAA
TGGAGCTGTGGAGGACAGAAAGCCAAGTGGACTCAACGGAGAGGCCAGCAAGTCTCAGGAAATGGTGCATTTGGTGAACAAGGAGTCGTC
AGAAACTCCAGACCAGTTTATGACAGCTGATGAGACAAGGAACCTGCAGAATGTGGACATGAAGATTGGGGTGTAACACCTACACCATTA
TCTTGGAAAGAAACAACCGTTGGAAACATAACCATTACAGGGAGCTGGGACACTTAACAGATGCAATGTGCTACTGATTGTTTCATTGCG
AATCTTTTTTAGCATAAAATTTTCTACTCTTTTTGTTTTTTGTGTTTTGTTCTTTAAAGTCAGGTCCAATTTGTAAAAACAGCATTGCTT
TCTGAAATTAGGGCCCAATTAATAATCAGCAAGAATTTGATCGTTCCAGTTCCCACTTGGAGGCCTTTCATCCCTCGGGTGTGCTATGGA
TGGCTTCTAACAAAAACTACACATATGTATTCCTGATCGCCAACCTTTCCCCCACCAGCTAAGGACATTTCCCAGGGTTAATAGGGCCTG
GTCCCTGGGAGGAAATTTGAATGGGTCCATTTTGCCCTTCCATAGCCTAATCCCTGGGCATTGCTTTCCACTGAGGTTGGGGGTTGGGGT
GTACTAGTTACACATCTTCAACAGACCCCCTCTAGAAATTTTTCAGATGCTTCTGGGAGACACCCAAAGGGTGAAGCTATTTATCTGTAG
TAAACTATTTATCTGTGTTTTTGAAATATTAAACCCTGGATCAGTCCTTTGATCAGTATAATTTTTTAAAGTTACTTTGTCAGAGGCACA

>In-frame_LDLRAD3_ENST00000524419_chr11_35965694_+_CD44_ENST00000526669_chr11_35198122_+_845nt
GAAGGCGGGAGGGAGGAGGGCCAGGCGGGAGGGCGGGGACGGCGCGGCGAGGGGCGGGGTCAGCGCCGAGGCCGCGGGGGCAGCAACGAC
GCCGGGCAGCGGGAGCGGCGGCCGCGCCATGTGGCTGCTGGGGCCGCTGTGCCTGCTGCTGAGCAGCGCCGCGGATTTGAATATAACCTG
CCGCTTTGCAGGTGTATTCCACGTGGAGAAAAATGGTCGCTACAGCATCTCTCGGACGGAGGCCGCTGACCTCTGCAAGGCTTTCAATAG
CACCTTGCCCACAATGGCCCAGATGGAGAAAGCTCTGAGCATCGGATTTGAGACCTGCAGGTATGGGTTCATAGAAGGGCACGTGGTGAT
TCCCCGGATCCACCCCAACTCCATCTGTGGAGCAAACACAACCTCTGGTCCTATAAGGACACCCCAAATTCCAGAATGGCTGATCATCTT
GGCATCCCTCTTGGCCTTGGCTTTGATTCTTGCAGTTTGCATTGCAGTCAACAGTCGAAGAAGGTGTGGGCAGAAGAAAAAGCTAGTGAT
CAACAGTGGCAATGGAGCTGTGGAGGACAGAAAGCCAAGTGGACTCAACGGAGAGGCCAGCAAGTCTCAGGAAATGGTGCATTTGGTGAA
CAAGGAGTCGTCAGAAACTCCAGACCAGTTTATGACAGCTGATGAGACAAGGAACCTGCAGAATGTGGACATGAAGATTGGGGTGTAACA
CCTACACCATTATCTTGGAAAGAAACAACCGTTGGAAACATAACCATTACAGGGAGCTGGGACACTTAACAGATGCAATGTGCTACTGAT

>In-frame_LDLRAD3_ENST00000524419_chr11_35965694_+_CD44_ENST00000433892_chr11_35198122_+_2273nt
GAAGGCGGGAGGGAGGAGGGCCAGGCGGGAGGGCGGGGACGGCGCGGCGAGGGGCGGGGTCAGCGCCGAGGCCGCGGGGGCAGCAACGAC
GCCGGGCAGCGGGAGCGGCGGCCGCGCCATGTGGCTGCTGGGGCCGCTGTGCCTGCTGCTGAGCAGCGCCGCGGATTTGAATATAACCTG
CCGCTTTGCAGGTGTATTCCACGTGGAGAAAAATGGTCGCTACAGCATCTCTCGGACGGAGGCCGCTGACCTCTGCAAGGCTTTCAATAG
CACCTTGCCCACAATGGCCCAGATGGAGAAAGCTCTGAGCATCGGATTTGAGACCTGCAGGTATGGGTTCATAGAAGGGCACGTGGTGAT
TCCCCGGATCCACCCCAACTCCATCTGTGCAGCAAACAACACAGGGGTGTACATCCTCACATCCAACACCTCCCAGTATGACACATATTG
CTTCAATGCTTCAGCTCCACCTGAAGAAGATTGTACATCAGTCACAGACCTGCCCAATGCCTTTGATGGACCAATTACCATAACTATTGT
TAACCGTGATGGCACCCGCTATGTCCAGAAAGGAGAATACAGAACGAATCCTGAAGACATCTACCCCAGCAACCCTACTGATGATGACGT
GAGCAGCGGCTCCTCCAGTGAAAGGAGCAGCACTTCAGGAGGTTACATCTTTTACACCTTTTCTACTGTACACCCCATCCCAGACGAAGA
CAGTCCCTGGATCACCGACAGCACAGACAGAATCCCTGCTACCAATATGGACTCCAGTCATAGTATAACGCTTCAGCCTACTGCAAATCC
AAACACAGGTTTGGTGGAAGATTTGGACAGGACAGGACCTCTTTCAATGACAACGCAGCAGAGTAATTCTCAGAGCTTCTCTACATCACA
TGAAGGCTTGGAAGAAGATAAAGACCATCCAACAACTTCTACTCTGACATCAAGCAATAGGAATGATGTCACAGGTGGAAGAAGAGACCC
AAATCATTCTGAAGGCTCAACTACTTTACTGGAAGGTTATACCTCTCATTACCCACACACGAAGGAAAGCAGGACCTTCATCCCAGTGAC
CTCAGCTAAGACTGGGTCCTTTGGAGTTACTGCAGTTACTGTTGGAGATTCCAACTCTAATGTCAATCGTTCCTTATCAGGAGACCAAGA
CACATTCCACCCCAGTGGGGGGTCCCATACCACTCATGGATCTGAATCAGATGGACACTCACATGGGAGTCAAGAAGGTGGAGCAAACAC
AACCTCTGGTCCTATAAGGACACCCCAAATTCCAGAATGGCTGATCATCTTGGCATCCCTCTTGGCCTTGGCTTTGATTCTTGCAGTTTG
CATTGCAGTCAACAGTCGAAGAAGGTGTGGGCAGAAGAAAAAGCTAGTGATCAACAGTGGCAATGGAGCTGTGGAGGACAGAAAGCCAAG
TGGACTCAACGGAGAGGCCAGCAAGTCTCAGGAAATGGTGCATTTGGTGAACAAGGAGTCGTCAGAAACTCCAGACCAGTTTATGACAGC
TGATGAGACAAGGAACCTGCAGAATGTGGACATGAAGATTGGGGTGTAACACCTACACCATTATCTTGGAAAGAAACAACCGTTGGAAAC
ATAACCATTACAGGGAGCTGGGACACTTAACAGATGCAATGTGCTACTGATTGTTTCATTGCGAATCTTTTTTAGCATAAAATTTTCTAC
TCTTTTTGTTTTTTGTGTTTTGTTCTTTAAAGTCAGGTCCAATTTGTAAAAACAGCATTGCTTTCTGAAATTAGGGCCCAATTAATAATC
AGCAAGAATTTGATCGTTCCAGTTCCCACTTGGAGGCCTTTCATCCCTCGGGTGTGCTATGGATGGCTTCTAACAAAAACTACACATATG
TATTCCTGATCGCCAACCTTTCCCCCACCAGCTAAGGACATTTCCCAGGGTTAATAGGGCCTGGTCCCTGGGAGGAAATTTGAATGGGTC
CATTTTGCCCTTCCATAGCCTAATCCCTGGGCATTGCTTTCCACTGAGGTTGGGGGTTGGGGTGTACTAGTTACACATCTTCAACAGACC
CCCTCTAGAAATTTTTCAGATGCTTCTGGGAGACACCCAAAGGGTGAAGCTATTTATCTGTAGTAAACTATTTATCTGTGTTTTTGAAAT
ATTAAACCCTGGATCAGTCCTTTGATCAGTATAATTTTTTAAAGTTACTTTGTCAGAGGCACAAAAGGGTTTAAACTGATTCATAATAAA

>In-frame_LDLRAD3_ENST00000524419_chr11_35965694_+_CD44_ENST00000278386_chr11_35198122_+_563nt
GAAGGCGGGAGGGAGGAGGGCCAGGCGGGAGGGCGGGGACGGCGCGGCGAGGGGCGGGGTCAGCGCCGAGGCCGCGGGGGCAGCAACGAC
GCCGGGCAGCGGGAGCGGCGGCCGCGCCATGTGGCTGCTGGGGCCGCTGTGCCTGCTGCTGAGCAGCGCCGCGGATTTGAATATAACCTG
CCGCTTTGCAGGTGTATTCCACGTGGAGAAAAATGGTCGCTACAGCATCTCTCGGACGGAGGCCGCTGACCTCTGCAAGGCTTTCAATAG
CACCTTGCCCACAATGGCCCAGATGGAGAAAGCTCTGAGCATCGGATTTGAGACCTGCAGTTTGCATTGCAGTCAACAGTCGAAGAAGGT
GTGGGCAGAAGAAAAAGCTAGTGATCAACAGTGGCAATGGAGCTGTGGAGGACAGAAAGCCAAGTGGACTCAACGGAGAGGCCAGCAAGT
CTCAGGAAATGGTGCATTTGGTGAACAAGGAGTCGTCAGAAACTCCAGACCAGTTTATGACAGCTGATGAGACAAGGAACCTGCAGAATG

>In-frame_LDLRAD3_ENST00000524419_chr11_35965694_+_CD44_ENST00000434472_chr11_35198122_+_1720nt
GAAGGCGGGAGGGAGGAGGGCCAGGCGGGAGGGCGGGGACGGCGCGGCGAGGGGCGGGGTCAGCGCCGAGGCCGCGGGGGCAGCAACGAC
GCCGGGCAGCGGGAGCGGCGGCCGCGCCATGTGGCTGCTGGGGCCGCTGTGCCTGCTGCTGAGCAGCGCCGCGGATTTGAATATAACCTG
CCGCTTTGCAGGTGTATTCCACGTGGAGAAAAATGGTCGCTACAGCATCTCTCGGACGGAGGCCGCTGACCTCTGCAAGGCTTTCAATAG
CACCTTGCCCACAATGGCCCAGATGGAGAAAGCTCTGAGCATCGGATTTGAGACCTGCAGGTATGGGTTCATAGAAGGGCACGTGGTGAT
TCCCCGGATCCACCCCAACTCCATCTGTGCAGCAAACAACACAGGGGTGTACATCCTCACATCCAACACCTCCCAGTATGACACATATTG
CTTCAATGCTTCAGCTCCACCTGAAGAAGATTGTACATCAGTCACAGACCTGCCCAATGCCTTTGATGGACCAATTACCATAACTATTGT
TAACCGTGATGGCACCCGCTATGTCCAGAAAGGAGAATACAGAACGAATCCTGAAGACATCTACCCCAGCAACCCTACTGATGATGACGT
GAGCAGCGGCTCCTCCAGTGAAAGGAGCAGCACTTCAGGAGGTTACATCTTTTACACCTTTTCTACTGTACACCCCATCCCAGACGAAGA
CAGTCCCTGGATCACCGACAGCACAGACAGAATCCCTGCTACCAATAGGAATGATGTCACAGGTGGAAGAAGAGACCCAAATCATTCTGA
AGGCTCAACTACTTTACTGGAAGGTTATACCTCTCATTACCCACACACGAAGGAAAGCAGGACCTTCATCCCAGTGACCTCAGCTAAGAC
TGGGTCCTTTGGAGTTACTGCAGTTACTGTTGGAGATTCCAACTCTAATGTCAATCGTTCCTTATCAGGAGACCAAGACACATTCCACCC
CAGTGGGGGGTCCCATACCACTCATGGATCTGAATCAGATGGACACTCACATGGGAGTCAAGAAGGTGGAGCAAACACAACCTCTGGTCC
TATAAGGACACCCCAAATTCCAGAATGGCTGATCATCTTGGCATCCCTCTTGGCCTTGGCTTTGATTCTTGCAGTTTGCATTGCAGTCAA
CAGTCGAAGAAGGTGTGGGCAGAAGAAAAAGCTAGTGATCAACAGTGGCAATGGAGCTGTGGAGGACAGAAAGCCAAGTGGACTCAACGG
AGAGGCCAGCAAGTCTCAGGAAATGGTGCATTTGGTGAACAAGGAGTCGTCAGAAACTCCAGACCAGTTTATGACAGCTGATGAGACAAG
GAACCTGCAGAATGTGGACATGAAGATTGGGGTGTAACACCTACACCATTATCTTGGAAAGAAACAACCGTTGGAAACATAACCATTACA
GGGAGCTGGGACACTTAACAGATGCAATGTGCTACTGATTGTTTCATTGCGAATCTTTTTTAGCATAAAATTTTCTACTCTTTTTGTTTT
TTGTGTTTTGTTCTTTAAAGTCAGGTCCAATTTGTAAAAACAGCATTGCTTTCTGAAATTAGGGCCCAATTAATAATCAGCAAGAATTTG
ATCGTTCCAGTTCCCACTTGGAGGCCTTTCATCCCTCGGGTGTGCTATGGATGGCTTCTAACAAAAACTACACATATGTATTCCTGATCG

>In-frame_LDLRAD3_ENST00000524419_chr11_35965694_+_CD44_ENST00000352818_chr11_35198122_+_1120nt
GAAGGCGGGAGGGAGGAGGGCCAGGCGGGAGGGCGGGGACGGCGCGGCGAGGGGCGGGGTCAGCGCCGAGGCCGCGGGGGCAGCAACGAC
GCCGGGCAGCGGGAGCGGCGGCCGCGCCATGTGGCTGCTGGGGCCGCTGTGCCTGCTGCTGAGCAGCGCCGCGGATTTGAATATAACCTG
CCGCTTTGCAGGTGTATTCCACGTGGAGAAAAATGGTCGCTACAGCATCTCTCGGACGGAGGCCGCTGACCTCTGCAAGGCTTTCAATAG
CACCTTGCCCACAATGGCCCAGATGGAGAAAGCTCTGAGCATCGGATTTGAGACCTGCAGGTATGGGTTCATAGAAGGGCACGTGGTGAT
TCCCCGGATCCACCCCAACTCCATCTGTGCAGCAAACAACACAGGGGTGTACATCCTCACATCCAACACCTCCCAGTATGACACATATTG
CTTCAATGCTTCAGCTCCACCTGAAGAAGATTGTACATCAGTCACAGACCTGCCCAATGCCTTTGATGGACCAATTACCATAACTATTGT
TAACCGTGATGGCACCCGCTATGTCCAGAAAGGAGAATACAGAACGAATCCTGAAGACATCTACCCCAGCAACCCTACTGATGATGACGT
GAGCAGCGGCTCCTCCAGTGAAAGGAGCAGCACTTCAGGAGGTTACATCTTTTACACCTTTTCTACTGTACACCCCATCCCAGACGAAGA
CAGTCCCTGGATCACCGACAGCACAGACAGAATCCCTGCTACCAGACACTCACATGGGAGTCAAGAAGGTGGAGCAAACACAACCTCTGG
TCCTATAAGGACACCCCAAATTCCAGAATGGCTGATCATCTTGGCATCCCTCTTGGCCTTGGCTTTGATTCTTGCAGTTTGCATTGCAGT
CAACAGTCGAAGAAGGTGTGGGCAGAAGAAAAAGCTAGTGATCAACAGTGGCAATGGAGCTGTGGAGGACAGAAAGCCAAGTGGACTCAA
CGGAGAGGCCAGCAAGTCTCAGGAAATGGTGCATTTGGTGAACAAGGAGTCGTCAGAAACTCCAGACCAGTTTATGACAGCTGATGAGAC

>In-frame_LDLRAD3_ENST00000528989_chr11_35965694_+_CD44_ENST00000263398_chr11_35198122_+_4252nt
GAAGGCGGGAGGGAGGAGGGCCAGGCGGGAGGGCGGGGACGGCGCGGCGAGGGGCGGGGTCAGCGCCGAGGCCGCGGGGGCAGCAACGAC
GCCGGGCAGCGGGAGCGGCGGCCGCGCCATGTGGCTGCTGGGGCCGCTGTGCCTGCTGCTGAGCAGCGCCGCGGATTTGAATATAACCTG
CCGCTTTGCAGGTGTATTCCACGTGGAGAAAAATGGTCGCTACAGCATCTCTCGGACGGAGGCCGCTGACCTCTGCAAGGCTTTCAATAG
CACCTTGCCCACAATGGCCCAGATGGAGAAAGCTCTGAGCATCGGATTTGAGACCTGCAGGTATGGGTTCATAGAAGGGCACGTGGTGAT
TCCCCGGATCCACCCCAACTCCATCTGTGCAGCAAACAACACAGGGGTGTACATCCTCACATCCAACACCTCCCAGTATGACACATATTG
CTTCAATGCTTCAGCTCCACCTGAAGAAGATTGTACATCAGTCACAGACCTGCCCAATGCCTTTGATGGACCAATTACCATAACTATTGT
TAACCGTGATGGCACCCGCTATGTCCAGAAAGGAGAATACAGAACGAATCCTGAAGACATCTACCCCAGCAACCCTACTGATGATGACGT
GAGCAGCGGCTCCTCCAGTGAAAGGAGCAGCACTTCAGGAGGTTACATCTTTTACACCTTTTCTACTGTACACCCCATCCCAGACGAAGA
CAGTCCCTGGATCACCGACAGCACAGACAGAATCCCTGCTACCAGAGACCAAGACACATTCCACCCCAGTGGGGGGTCCCATACCACTCA
TGGATCTGAATCAGATGGACACTCACATGGGAGTCAAGAAGGTGGAGCAAACACAACCTCTGGTCCTATAAGGACACCCCAAATTCCAGA
ATGGCTGATCATCTTGGCATCCCTCTTGGCCTTGGCTTTGATTCTTGCAGTTTGCATTGCAGTCAACAGTCGAAGAAGGTGTGGGCAGAA
GAAAAAGCTAGTGATCAACAGTGGCAATGGAGCTGTGGAGGACAGAAAGCCAAGTGGACTCAACGGAGAGGCCAGCAAGTCTCAGGAAAT
GGTGCATTTGGTGAACAAGGAGTCGTCAGAAACTCCAGACCAGTTTATGACAGCTGATGAGACAAGGAACCTGCAGAATGTGGACATGAA
GATTGGGGTGTAACACCTACACCATTATCTTGGAAAGAAACAACCGTTGGAAACATAACCATTACAGGGAGCTGGGACACTTAACAGATG
CAATGTGCTACTGATTGTTTCATTGCGAATCTTTTTTAGCATAAAATTTTCTACTCTTTTTGTTTTTTGTGTTTTGTTCTTTAAAGTCAG
GTCCAATTTGTAAAAACAGCATTGCTTTCTGAAATTAGGGCCCAATTAATAATCAGCAAGAATTTGATCGTTCCAGTTCCCACTTGGAGG
CCTTTCATCCCTCGGGTGTGCTATGGATGGCTTCTAACAAAAACTACACATATGTATTCCTGATCGCCAACCTTTCCCCCACCAGCTAAG
GACATTTCCCAGGGTTAATAGGGCCTGGTCCCTGGGAGGAAATTTGAATGGGTCCATTTTGCCCTTCCATAGCCTAATCCCTGGGCATTG
CTTTCCACTGAGGTTGGGGGTTGGGGTGTACTAGTTACACATCTTCAACAGACCCCCTCTAGAAATTTTTCAGATGCTTCTGGGAGACAC
CCAAAGGGTGAAGCTATTTATCTGTAGTAAACTATTTATCTGTGTTTTTGAAATATTAAACCCTGGATCAGTCCTTTGATCAGTATAATT
TTTTAAAGTTACTTTGTCAGAGGCACAAAAGGGTTTAAACTGATTCATAATAAATATCTGTACTTCTTCGATCTTCACCTTTTGTGCTGT
GATTCTTCAGTTTCTAAACCAGCACTGTCTGGGTCCCTACAATGTATCAGGAAGAGCTGAGAATGGTAAGGAGACTCTTCTAAGTCTTCA
TCTCAGAGACCCTGAGTTCCCACTCAGACCCACTCAGCCAAATCTCATGGAAGACCAAGGAGGGCAGCACTGTTTTTGTTTTTTGTTTTT
TGTTTTTTTTTTTTGACACTGTCCAAAGGTTTTCCATCCTGTCCTGGAATCAGAGTTGGAAGCTGAGGAGCTTCAGCCTCTTTTATGGTT
TAATGGCCACCTGTTCTCTCCTGTGAAAGGCTTTGCAAAGTCACATTAAGTTTGCATGACCTGTTATCCCTGGGGCCCTATTTCATAGAG
GCTGGCCCTATTAGTGATTTCCAAAAACAATATGGAAGTGCCTTTTGATGTCTTACAATAAGAGAAGAAGCCAATGGAAATGAAAGAGAT
TGGCAAAGGGGAAGGATGATGCCATGTAGATCCTGTTTGACATTTTTATGGCTGTATTTGTAAACTTAAACACACCAGTGTCTGTTCTTG
ATGCAGTTGCTATTTAGGATGAGTTAAGTGCCTGGGGAGTCCCTCAAAAGGTTAAAGGGATTCCCATCATTGGAATCTTATCACCAGATA
GGCAAGTTTATGACCAAACAAGAGAGTACTGGCTTTATCCTCTAACCTCATATTTTCTCCCACTTGGCAAGTCCTTTGTGGCATTTATTC
ATCAGTCAGGGTGTCCGATTGGTCCTAGAACTTCCAAAGGCTGCTTGTCATAGAAGCCATTGCATCTATAAAGCAACGGCTCCTGTTAAA
TGGTATCTCCTTTCTGAGGCTCCTACTAAAAGTCATTTGTTACCTAAACTTATGTGCTTAACAGGCAATGCTTCTCAGACCACAAAGCAG
AAAGAAGAAGAAAAGCTCCTGACTAAATCAGGGCTGGGCTTAGACAGAGTTGATCTGTAGAATATCTTTAAAGGAGAGATGTCAACTTTC
TGCACTATTCCCAGCCTCTGCTCCTCCCTGTCTACCCTCTCCCCTCCCTCTCTCCCTCCACTTCACCCCACAATCTTGAAAAACTTCCTT
TCTCTTCTGTGAACATCATTGGCCAGATCCATTTTCAGTGGTCTGGATTTCTTTTTATTTTCTTTTCAACTTGAAAGAAACTGGACATTA
GGCCACTATGTGTTGTTACTGCCACTAGTGTTCAAGTGCCTCTTGTTTTCCCAGAGATTTCCTGGGTCTGCCAGAGGCCCAGACAGGCTC
ACTCAAGCTCTTTAACTGAAAAGCAACAAGCCACTCCAGGACAAGGTTCAAAATGGTTACAACAGCCTCTACCTGTCGCCCCAGGGAGAA
AGGGGTAGTGATACAAGTCTCATAGCCAGAGATGGTTTTCCACTCCTTCTAGATATTCCCAAAAAGAGGCTGAGACAGGAGGTTATTTTC
AATTTTATTTTGGAATTAAATACTTTTTTCCCTTTATTACTGTTGTAGTCCCTCACTTGGATATACCTCTGTTTTCACGATAGAAATAAG
GGAGGTCTAGAGCTTCTATTCCTTGGCCATTGTCAACGGAGAGCTGGCCAAGTCTTCACAAACCCTTGCAACATTGCCTGAAGTTTATGG
AATAAGATGTATTCTCACTCCCTTGATCTCAAGGGCGTAACTCTGGAAGCACAGCTTGACTACACGTCATTTTTACCAATGATTTTCAGG
TGACCTGGGCTAAGTCATTTAAACTGGGTCTTTATAAAAGTAAAAGGCCAACATTTAATTATTTTGCAAAGCAACCTAAGAGCTAAAGAT
GTAATTTTTCTTGCAATTGTAAATCTTTTGTGTCTCCTGAAGACTTCCCTTAAAATTAGCTCTGAGTGAAAAATCAAAAGAGACAAAAGA
CATCTTCGAATCCATATTTCAAGCCTGGTAGAATTGGCTTTTCTAGCAGAACCTTTCCAAAAGTTTTATATTGAGATTCATAACAACACC
AAGAATTGATTTTGTAGCCAACATTCATTCAATACTGTTATATCAGAGGAGTAGGAGAGAGGAAACATTTGACTTATCTGGAAAAGCAAA
ATGTACTTAAGAATAAGAATAACATGGTCCATTCACCTTTATGTTATAGATATGTCTTTGTGTAAATCATTTGTTTTGAGTTTTCAAAGA
ATAGCCCATTGTTCATTCTTGTGCTGTACAATGACCACTGTTATTGTTACTTTGACTTTTCAGAGCACACCCTTCCTCTGGTTTTTGTAT
ATTTATTGATGGATCAATAATAATGAGGAAAGCATGATATGTATATTGCTGAGTTGAAAGCACTTATTGGAAAATATTAAAAGGCTAACA

>In-frame_LDLRAD3_ENST00000528989_chr11_35965694_+_CD44_ENST00000449691_chr11_35198122_+_2332nt
GAAGGCGGGAGGGAGGAGGGCCAGGCGGGAGGGCGGGGACGGCGCGGCGAGGGGCGGGGTCAGCGCCGAGGCCGCGGGGGCAGCAACGAC
GCCGGGCAGCGGGAGCGGCGGCCGCGCCATGTGGCTGCTGGGGCCGCTGTGCCTGCTGCTGAGCAGCGCCGCGGATTTGAATATAACCTG
CCGCTTTGCAGGTGTATTCCACGTGGAGAAAAATGGTCGCTACAGCATCTCTCGGACGGAGGCCGCTGACCTCTGCAAGGCTTTCAATAG
CACCTTGCCCACAATGGCCCAGATGGAGAAAGCTCTGAGCATCGGATTTGAGACCTGCAGGTATGGGTTCATAGAAGGGCACGTGGTGAT
TCCCCGGATCCACCCCAACTCCATCTGTGCAGCAAACAACACAGGGGTGTACATCCTCACATCCAACACCTCCCAGTATGACACATATTG
CTTCAATGCTTCAGCTCCACCTGAAGAAGATTGTACATCAGTCACAGACCTGCCCAATGCCTTTGATGGACCAATTACCATAACTATTGT
TAACCGTGATGGCACCCGCTATGTCCAGAAAGGAGAATACAGAACGAATCCTGAAGACATCTACCCCAGCAACCCTACTGATGATGACGT
GAGCAGCGGCTCCTCCAGTGAAAGGAGCAGCACTTCAGGAGGTTACATCTTTTACACCTTTTCTACTGTACACCCCATCCCAGACGAAGA
CAGTCCCTGGATCACCGACAGCACAGACAGAATCCCTGCTACCACTTTGATGAGCACTAGTGCTACAGCAACTGAGACAGCAACCAAGAG
GCAAGAAACCTGGGATTGGTTTTCATGGTTGTTTCTACCATCAGAGTCAAAGAATCATCTTCACACAACAACACAAATGGCTGGTACGTC
TTCAAATACCATCTCAGCAGGCTGGGAGCCAAATGAAGAAAATGAAGATGAAAGAGACAGACACCTCAGTTTTTCTGGATCAGGCATTGA
TGATGATGAAGATTTTATCTCCAGCACCATTTCAACCACACCACGGGCTTTTGACCACACAAAACAGAACCAGGACTGGACCCAGTGGAA
CCCAAGCCATTCAAATCCGGAAGTGCTACTTCAGACAACCACAAGGATGACTGATGTAGACAGAAATGGCACCACTGCTTATGAAGGAAA
CTGGAACCCAGAAGCACACCCTCCCCTCATTCACCATGAGCATCATGAGGAAGAAGAGACCCCACATTCTACAAGCACAACAGCCTCAGC
TCATACCAGCCATCCAATGCAAGGAAGGACAACACCAAGCCCAGAGGACAGTTCCTGGACTGATTTCTTCAACCCAATCTCACACCCCAT
GGGACGAGGTCATCAAGCAGGAAGAAGGATGGATATGGACTCCAGTCATAGTATAACGCTTCAGCCTACTGCAAATCCAAACACAGGTTT
GGTGGAAGATTTGGACAGGACAGGACCTCTTTCAATGACAACGCAGCAGAGTAATTCTCAGAGCTTCTCTACATCACATGAAGGCTTGGA
AGAAGATAAAGACCATCCAACAACTTCTACTCTGACATCAAGCAATAGGAATGATGTCACAGGTGGAAGAAGAGACCCAAATCATTCTGA
AGGCTCAACTACTTTACTGGAAGGTTATACCTCTCATTACCCACACACGAAGGAAAGCAGGACCTTCATCCCAGTGACCTCAGCTAAGAC
TGGGTCCTTTGGAGTTACTGCAGTTACTGTTGGAGATTCCAACTCTAATGTCAATCGTTCCTTATCAGGAGACCAAGACACATTCCACCC
CAGTGGGGGGTCCCATACCACTCATGGATCTGAATCAGATGGACACTCACATGGGAGTCAAGAAGGTGGAGCAAACACAACCTCTGGTCC
TATAAGGACACCCCAAATTCCAGAATGGCTGATCATCTTGGCATCCCTCTTGGCCTTGGCTTTGATTCTTGCAGTTTGCATTGCAGTCAA
CAGTCGAAGAAGGTGTGGGCAGAAGAAAAAGCTAGTGATCAACAGTGGCAATGGAGCTGTGGAGGACAGAAAGCCAAGTGGACTCAACGG
AGAGGCCAGCAAGTCTCAGGAAATGGTGCATTTGGTGAACAAGGAGTCGTCAGAAACTCCAGACCAGTTTATGACAGCTGATGAGACAAG
GAACCTGCAGAATGTGGACATGAAGATTGGGGTGTAACACCTACACCATTATCTTGGAAAGAAACAACCGTTGGAAACATAACCATTACA

>In-frame_LDLRAD3_ENST00000528989_chr11_35965694_+_CD44_ENST00000360158_chr11_35198122_+_1423nt
GAAGGCGGGAGGGAGGAGGGCCAGGCGGGAGGGCGGGGACGGCGCGGCGAGGGGCGGGGTCAGCGCCGAGGCCGCGGGGGCAGCAACGAC
GCCGGGCAGCGGGAGCGGCGGCCGCGCCATGTGGCTGCTGGGGCCGCTGTGCCTGCTGCTGAGCAGCGCCGCGGATTTGAATATAACCTG
CCGCTTTGCAGGTGTATTCCACGTGGAGAAAAATGGTCGCTACAGCATCTCTCGGACGGAGGCCGCTGACCTCTGCAAGGCTTTCAATAG
CACCTTGCCCACAATGGCCCAGATGGAGAAAGCTCTGAGCATCGGATTTGAGACCTGCAGGTATGGGTTCATAGAAGGGCACGTGGTGAT
TCCCCGGATCCACCCCAACTCCATCTGTGCAGCAAACAACACAGGGGTGTACATCCTCACATCCAACACCTCCCAGTATGACACATATTG
CTTCAATGCTTCAGCTCCACCTGAAGAAGATTGTACATCAGTCACAGACCTGCCCAATGCCTTTGATGGACCAATTACCATAACTATTGT
TAACCGTGATGGCACCCGCTATGTCCAGAAAGGAGAATACAGAACGAATCCTGAAGACATCTACCCCAGCAACCCTACTGATGATGACGT
GAGCAGCGGCTCCTCCAGTGAAAGGAGCAGCACTTCAGGAGGTTACATCTTTTACACCTTTTCTACTGTACACCCCATCCCAGACGAAGA
CAGTCCCTGGATCACCGACAGCACAGACAGAATCCCTGCTACCAATATGGACTCCAGTCATAGTATAACGCTTCAGCCTACTGCAAATCC
AAACACAGGTTTGGTGGAAGATTTGGACAGGACAGGACCTCTTTCAATGACAACGCGTAGAGACCAAGACACATTCCACCCCAGTGGGGG
GTCCCATACCACTCATGGATCTGAATCAGATGGACACTCACATGGGAGTCAAGAAGGTGGAGCAAACACAACCTCTGGTCCTATAAGGAC
ACCCCAAATTCCAGAATGGCTGATCATCTTGGCATCCCTCTTGGCCTTGGCTTTGATTCTTGCAGTTTGCATTGCAGTCAACAGTCGAAG
AAGGTGTGGGCAGAAGAAAAAGCTAGTGATCAACAGTGGCAATGGAGCTGTGGAGGACAGAAAGCCAAGTGGACTCAACGGAGAGGCCAG
CAAGTCTCAGGAAATGGTGCATTTGGTGAACAAGGAGTCGTCAGAAACTCCAGACCAGTTTATGACAGCTGATGAGACAAGGAACCTGCA
GAATGTGGACATGAAGATTGGGGTGTAACACCTACACCATTATCTTGGAAAGAAACAACCGTTGGAAACATAACCATTACAGGGAGCTGG

>In-frame_LDLRAD3_ENST00000528989_chr11_35965694_+_CD44_ENST00000415148_chr11_35198122_+_2332nt
GAAGGCGGGAGGGAGGAGGGCCAGGCGGGAGGGCGGGGACGGCGCGGCGAGGGGCGGGGTCAGCGCCGAGGCCGCGGGGGCAGCAACGAC
GCCGGGCAGCGGGAGCGGCGGCCGCGCCATGTGGCTGCTGGGGCCGCTGTGCCTGCTGCTGAGCAGCGCCGCGGATTTGAATATAACCTG
CCGCTTTGCAGGTGTATTCCACGTGGAGAAAAATGGTCGCTACAGCATCTCTCGGACGGAGGCCGCTGACCTCTGCAAGGCTTTCAATAG
CACCTTGCCCACAATGGCCCAGATGGAGAAAGCTCTGAGCATCGGATTTGAGACCTGCAGGTATGGGTTCATAGAAGGGCACGTGGTGAT
TCCCCGGATCCACCCCAACTCCATCTGTGCAGCAAACAACACAGGGGTGTACATCCTCACATCCAACACCTCCCAGTATGACACATATTG
CTTCAATGCTTCAGCTCCACCTGAAGAAGATTGTACATCAGTCACAGACCTGCCCAATGCCTTTGATGGACCAATTACCATAACTATTGT
TAACCGTGATGGCACCCGCTATGTCCAGAAAGGAGAATACAGAACGAATCCTGAAGACATCTACCCCAGCAACCCTACTGATGATGACGT
GAGCAGCGGCTCCTCCAGTGAAAGGAGCAGCACTTCAGGAGGTTACATCTTTTACACCTTTTCTACTGTACACCCCATCCCAGACGAAGA
CAGTCCCTGGATCACCGACAGCACAGACAGAATCCCTGCTACCAGTACGTCTTCAAATACCATCTCAGCAGGCTGGGAGCCAAATGAAGA
AAATGAAGATGAAAGAGACAGACACCTCAGTTTTTCTGGATCAGGCATTGATGATGATGAAGATTTTATCTCCAGCACCATTTCAACCAC
ACCACGGGCTTTTGACCACACAAAACAGAACCAGGACTGGACCCAGTGGAACCCAAGCCATTCAAATCCGGAAGTGCTACTTCAGACAAC
CACAAGGATGACTGATGTAGACAGAAATGGCACCACTGCTTATGAAGGAAACTGGAACCCAGAAGCACACCCTCCCCTCATTCACCATGA
GCATCATGAGGAAGAAGAGACCCCACATTCTACAAGCACAATCCAGGCAACTCCTAGTAGTACAACGGAAGAAACAGCTACCCAGAAGGA
ACAGTGGTTTGGCAACAGATGGCATGAGGGATATCGCCAAACACCCAAAGAAGACTCCCATTCGACAACAGGGACAGCTGCAGCCTCAGC
TCATACCAGCCATCCAATGCAAGGAAGGACAACACCAAGCCCAGAGGACAGTTCCTGGACTGATTTCTTCAACCCAATCTCACACCCCAT
GGGACGAGGTCATCAAGCAGGAAGAAGGATGGATATGGACTCCAGTCATAGTATAACGCTTCAGCCTACTGCAAATCCAAACACAGGTTT
GGTGGAAGATTTGGACAGGACAGGACCTCTTTCAATGACAACGCAGCAGAGTAATTCTCAGAGCTTCTCTACATCACATGAAGGCTTGGA
AGAAGATAAAGACCATCCAACAACTTCTACTCTGACATCAAGCAATAGGAATGATGTCACAGGTGGAAGAAGAGACCCAAATCATTCTGA
AGGCTCAACTACTTTACTGGAAGGTTATACCTCTCATTACCCACACACGAAGGAAAGCAGGACCTTCATCCCAGTGACCTCAGCTAAGAC
TGGGTCCTTTGGAGTTACTGCAGTTACTGTTGGAGATTCCAACTCTAATGTCAATCGTTCCTTATCAGGAGACCAAGACACATTCCACCC
CAGTGGGGGGTCCCATACCACTCATGGATCTGAATCAGATGGACACTCACATGGGAGTCAAGAAGGTGGAGCAAACACAACCTCTGGTCC
TATAAGGACACCCCAAATTCCAGAATGGCTGATCATCTTGGCATCCCTCTTGGCCTTGGCTTTGATTCTTGCAGTTTGCATTGCAGTCAA
CAGTCGAAGAAGGTGTGGGCAGAAGAAAAAGCTAGTGATCAACAGTGGCAATGGAGCTGTGGAGGACAGAAAGCCAAGTGGACTCAACGG
AGAGGCCAGCAAGTCTCAGGAAATGGTGCATTTGGTGAACAAGGAGTCGTCAGAAACTCCAGACCAGTTTATGACAGCTGATGAGACAAG
GAACCTGCAGAATGTGGACATGAAGATTGGGGTGTAACACCTACACCATTATCTTGGAAAGAAACAACCGTTGGAAACATAACCATTACA

>In-frame_LDLRAD3_ENST00000528989_chr11_35965694_+_CD44_ENST00000437706_chr11_35198122_+_2257nt
GAAGGCGGGAGGGAGGAGGGCCAGGCGGGAGGGCGGGGACGGCGCGGCGAGGGGCGGGGTCAGCGCCGAGGCCGCGGGGGCAGCAACGAC
GCCGGGCAGCGGGAGCGGCGGCCGCGCCATGTGGCTGCTGGGGCCGCTGTGCCTGCTGCTGAGCAGCGCCGCGGATTTGAATATAACCTG
CCGCTTTGCAGGTGTATTCCACGTGGAGAAAAATGGTCGCTACAGCATCTCTCGGACGGAGGCCGCTGACCTCTGCAAGGCTTTCAATAG
CACCTTGCCCACAATGGCCCAGATGGAGAAAGCTCTGAGCATCGGATTTGAGACCTGCAGGTATGGGTTCATAGAAGGGCACGTGGTGAT
TCCCCGGATCCACCCCAACTCCATCTGTGCAGCAAACAACACAGGGGTGTACATCCTCACATCCAACACCTCCCAGTATGACACATATTG
CTTCAATGCTTCAGCTCCACCTGAAGAAGATTGTACATCAGTCACAGACCTGCCCAATGCCTTTGATGGACCAATTACCATAACTATTGT
TAACCGTGATGGCACCCGCTATGTCCAGAAAGGAGAATACAGAACGAATCCTGAAGACATCTACCCCAGCAACCCTACTGATGATGACGT
GAGCAGCGGCTCCTCCAGTGAAAGGAGCAGCACTTCAGGAGGTTACATCTTTTACACCTTTTCTACTGTACACCCCATCCCAGACGAAGA
CAGTCCCTGGATCACCGACAGCACAGACAGAATCCCTGCTACCACTTTGATGAGCACTAGTGCTACAGCAACTGAGACAGCAACCAAGAG
GCAAGAAACCTGGGATTGGTTTTCATGGTTGTTTCTACCATCAGAGTCAAAGAATCATCTTCACACAACAACACAAATGGCTGGTACGTC
TTCAAATACCATCTCAGCAGGCTGGGAGCCAAATGAAGAAAATGAAGATGAAAGAGACAGACACCTCAGTTTTTCTGGATCAGGCATTGA
TGATGATGAAGATTTTATCTCCAGCACCATTTCAACCACACCACGGGCTTTTGACCACACAAAACAGAACCAGGACTGGACCCAGTGGAA
CCCAAGCCATTCAAATCCGGAAGTGCTACTTCAGACAACCACAAGGATGACTGATGTAGACAGAAATGGCACCACTGCTTATGAAGGAAA
CTGGAACCCAGAAGCACACCCTCCCCTCATTCACCATGAGCATCATGAGGAAGAAGAGACCCCACATTCTACAAGCACAATCCAGGCAAC
TCCTAGTAGTACAACGGAAGAAACAGCTACCCAGAAGGAACAGTGGTTTGGCAACAGATGGCATGAGGGATATCGCCAAACACCCAAAGA
AGACTCCCATTCGACAACAGGGACAGCTGCAGCCTCAGCTCATACCAGCCATCCAATGCAAGGAAGGACAACACCAAGCCCAGAGGACAG
TTCCTGGACTGATTTCTTCAACCCAATCTCACACCCCATGGGACGAGGTCATCAAGCAGGAAGAAGGATGGATATGGACTCCAGTCATAG
TATAACGCTTCAGCCTACTGCAAATCCAAACACAGGTTTGGTGGAAGATTTGGACAGGACAGGACCTCTTTCAATGACAACGCAGCAGAG
TAATTCTCAGAGCTTCTCTACATCACATGAAGGCTTGGAAGAAGATAAAGACCATCCAACAACTTCTACTCTGACATCAAGCAGAGACCA
AGACACATTCCACCCCAGTGGGGGGTCCCATACCACTCATGGATCTGAATCAGATGGACACTCACATGGGAGTCAAGAAGGTGGAGCAAA
CACAACCTCTGGTCCTATAAGGACACCCCAAATTCCAGAATGGCTGATCATCTTGGCATCCCTCTTGGCCTTGGCTTTGATTCTTGCAGT
TTGCATTGCAGTCAACAGTCGAAGAAGGTGTGGGCAGAAGAAAAAGCTAGTGATCAACAGTGGCAATGGAGCTGTGGAGGACAGAAAGCC
AAGTGGACTCAACGGAGAGGCCAGCAAGTCTCAGGAAATGGTGCATTTGGTGAACAAGGAGTCGTCAGAAACTCCAGACCAGTTTATGAC
AGCTGATGAGACAAGGAACCTGCAGAATGTGGACATGAAGATTGGGGTGTAACACCTACACCATTATCTTGGAAAGAAACAACCGTTGGA
AACATAACCATTACAGGGAGCTGGGACACTTAACAGATGCAATGTGCTACTGATTGTTTCATTGCGAATCTTTTTTAGCATAAAATTTTC

>In-frame_LDLRAD3_ENST00000528989_chr11_35965694_+_CD44_ENST00000433354_chr11_35198122_+_2377nt
GAAGGCGGGAGGGAGGAGGGCCAGGCGGGAGGGCGGGGACGGCGCGGCGAGGGGCGGGGTCAGCGCCGAGGCCGCGGGGGCAGCAACGAC
GCCGGGCAGCGGGAGCGGCGGCCGCGCCATGTGGCTGCTGGGGCCGCTGTGCCTGCTGCTGAGCAGCGCCGCGGATTTGAATATAACCTG
CCGCTTTGCAGGTGTATTCCACGTGGAGAAAAATGGTCGCTACAGCATCTCTCGGACGGAGGCCGCTGACCTCTGCAAGGCTTTCAATAG
CACCTTGCCCACAATGGCCCAGATGGAGAAAGCTCTGAGCATCGGATTTGAGACCTGCAGGTATGGGTTCATAGAAGGGCACGTGGTGAT
TCCCCGGATCCACCCCAACTCCATCTGTGCAGCAAACAACACAGGGGTGTACATCCTCACATCCAACACCTCCCAGTATGACACATATTG
CTTCAATGCTTCAGCTCCACCTGAAGAAGATTGTACATCAGTCACAGACCTGCCCAATGCCTTTGATGGACCAATTACCATAACTATTGT
TAACCGTGATGGCACCCGCTATGTCCAGAAAGGAGAATACAGAACGAATCCTGAAGACATCTACCCCAGCAACCCTACTGATGATGACGT
GAGCAGCGGCTCCTCCAGTGAAAGGAGCAGCACTTCAGGAGGTTACATCTTTTACACCTTTTCTACTGTACACCCCATCCCAGACGAAGA
CAGTCCCTGGATCACCGACAGCACAGACAGAATCCCTGCTACCACTTTGATGAGCACTAGTGCTACAGCAACTGAGACAGCAACCAAGAG
GCAAGAAACCTGGGATTGGTTTTCATGGTTGTTTCTACCATCAGAGTCAAAGAATCATCTTCACACAACAACACAAATGGCTGGTACGTC
TTCAAATACCATCTCAGCAGGCTGGGAGCCAAATGAAGAAAATGAAGATGAAAGAGACAGACACCTCAGTTTTTCTGGATCAGGCATTGA
TGATGATGAAGATTTTATCTCCAGCACCATTTCAACCACACCACGGGCTTTTGACCACACAAAACAGAACCAGGACTGGACCCAGTGGAA
CCCAAGCCATTCAAATCCGGAAGTGCTACTTCAGACAACCACAAGGATGACTGCAGATGTAGACAGAAATGGCACCACTGCTTATGAAGG
AAACTGGAACCCAGAAGCACACCCTCCCCTCATTCACCATGAGCATCATGAGGAAGAAGAGACCCCACATTCTACAAGCACAATCCAGGC
AACTCCTAGTAGTACAACGGAAGAAACAGCTACCCAGAAGGAACAGTGGTTTGGCAACAGATGGCATGAGGGATATCGCCAAACACCCAA
AGAAGACTCCCATTCGACAACAGGGACAGCTGCAGCCTCAGCTCATACCAGCCATCCAATGCAAGGAAGGACAACACCAAGCCCAGAGGA
CAGTTCCTGGACTGATTTCTTCAACCCAATCTCACACCCCATGGGACGAGGTCATCAAGCAGGAAGAAGGATGGATATGGACTCCAGTCA
TAGTATAACGCTTCAGCCTACTGCAAATCCAAACACAGGTTTGGTGGAAGATTTGGACAGGACAGGACCTCTTTCAATGACAACGCGTAA
TAGGAATGATGTCACAGGTGGAAGAAGAGACCCAAATCATTCTGAAGGCTCAACTACTTTACTGGAAGGTTATACCTCTCATTACCCACA
CACGAAGGAAAGCAGGACCTTCATCCCAGTGACCTCAGCTAAGACTGGGTCCTTTGGAGTTACTGCAGTTACTGTTGGAGATTCCAACTC
TAATGTCAATCGTTCCTTATCAGGAGACCAAGACACATTCCACCCCAGTGGGGGGTCCCATACCACTCATGGATCTGAATCAGATGGACA
CTCACATGGGAGTCAAGAAGGTGGAGCAAACACAACCTCTGGTCCTATAAGGACACCCCAAATTCCAGAATGGCTGATCATCTTGGCATC
CCTCTTGGCCTTGGCTTTGATTCTTGCAGTTTGCATTGCAGTCAACAGTCGAAGAAGGTGTGGGCAGAAGAAAAAGCTAGTGATCAACAG
TGGCAATGGAGCTGTGGAGGACAGAAAGCCAAGTGGACTCAACGGAGAGGCCAGCAAGTCTCAGGAAATGGTGCATTTGGTGAACAAGGA
GTCGTCAGAAACTCCAGACCAGTTTATGACAGCTGATGAGACAAGGAACCTGCAGAATGTGGACATGAAGATTGGGGTGTAACACCTACA
CCATTATCTTGGAAAGAAACAACCGTTGGAAACATAACCATTACAGGGAGCTGGGACACTTAACAGATGCAATGTGCTACTGATTGTTTC

>In-frame_LDLRAD3_ENST00000528989_chr11_35965694_+_CD44_ENST00000428726_chr11_35198122_+_3020nt
GAAGGCGGGAGGGAGGAGGGCCAGGCGGGAGGGCGGGGACGGCGCGGCGAGGGGCGGGGTCAGCGCCGAGGCCGCGGGGGCAGCAACGAC
GCCGGGCAGCGGGAGCGGCGGCCGCGCCATGTGGCTGCTGGGGCCGCTGTGCCTGCTGCTGAGCAGCGCCGCGGATTTGAATATAACCTG
CCGCTTTGCAGGTGTATTCCACGTGGAGAAAAATGGTCGCTACAGCATCTCTCGGACGGAGGCCGCTGACCTCTGCAAGGCTTTCAATAG
CACCTTGCCCACAATGGCCCAGATGGAGAAAGCTCTGAGCATCGGATTTGAGACCTGCAGGTATGGGTTCATAGAAGGGCACGTGGTGAT
TCCCCGGATCCACCCCAACTCCATCTGTGCAGCAAACAACACAGGGGTGTACATCCTCACATCCAACACCTCCCAGTATGACACATATTG
CTTCAATGCTTCAGCTCCACCTGAAGAAGATTGTACATCAGTCACAGACCTGCCCAATGCCTTTGATGGACCAATTACCATAACTATTGT
TAACCGTGATGGCACCCGCTATGTCCAGAAAGGAGAATACAGAACGAATCCTGAAGACATCTACCCCAGCAACCCTACTGATGATGACGT
GAGCAGCGGCTCCTCCAGTGAAAGGAGCAGCACTTCAGGAGGTTACATCTTTTACACCTTTTCTACTGTACACCCCATCCCAGACGAAGA
CAGTCCCTGGATCACCGACAGCACAGACAGAATCCCTGCTACCACTTTGATGAGCACTAGTGCTACAGCAACTGAGACAGCAACCAAGAG
GCAAGAAACCTGGGATTGGTTTTCATGGTTGTTTCTACCATCAGAGTCAAAGAATCATCTTCACACAACAACACAAATGGCTGGTACGTC
TTCAAATACCATCTCAGCAGGCTGGGAGCCAAATGAAGAAAATGAAGATGAAAGAGACAGACACCTCAGTTTTTCTGGATCAGGCATTGA
TGATGATGAAGATTTTATCTCCAGCACCATTTCAACCACACCACGGGCTTTTGACCACACAAAACAGAACCAGGACTGGACCCAGTGGAA
CCCAAGCCATTCAAATCCGGAAGTGCTACTTCAGACAACCACAAGGATGACTGATGTAGACAGAAATGGCACCACTGCTTATGAAGGAAA
CTGGAACCCAGAAGCACACCCTCCCCTCATTCACCATGAGCATCATGAGGAAGAAGAGACCCCACATTCTACAAGCACAATCCAGGCAAC
TCCTAGTAGTACAACGGAAGAAACAGCTACCCAGAAGGAACAGTGGTTTGGCAACAGATGGCATGAGGGATATCGCCAAACACCCAAAGA
AGACTCCCATTCGACAACAGGGACAGCTGCAGCCTCAGCTCATACCAGCCATCCAATGCAAGGAAGGACAACACCAAGCCCAGAGGACAG
TTCCTGGACTGATTTCTTCAACCCAATCTCACACCCCATGGGACGAGGTCATCAAGCAGGAAGAAGGATGGATATGGACTCCAGTCATAG
TATAACGCTTCAGCCTACTGCAAATCCAAACACAGGTTTGGTGGAAGATTTGGACAGGACAGGACCTCTTTCAATGACAACGCAGCAGAG
TAATTCTCAGAGCTTCTCTACATCACATGAAGGCTTGGAAGAAGATAAAGACCATCCAACAACTTCTACTCTGACATCAAGCAATAGGAA
TGATGTCACAGGTGGAAGAAGAGACCCAAATCATTCTGAAGGCTCAACTACTTTACTGGAAGGTTATACCTCTCATTACCCACACACGAA
GGAAAGCAGGACCTTCATCCCAGTGACCTCAGCTAAGACTGGGTCCTTTGGAGTTACTGCAGTTACTGTTGGAGATTCCAACTCTAATGT
CAATCGTTCCTTATCAGGAGACCAAGACACATTCCACCCCAGTGGGGGGTCCCATACCACTCATGGATCTGAATCAGATGGACACTCACA
TGGGAGTCAAGAAGGTGGAGCAAACACAACCTCTGGTCCTATAAGGACACCCCAAATTCCAGAATGGCTGATCATCTTGGCATCCCTCTT
GGCCTTGGCTTTGATTCTTGCAGTTTGCATTGCAGTCAACAGTCGAAGAAGGTGTGGGCAGAAGAAAAAGCTAGTGATCAACAGTGGCAA
TGGAGCTGTGGAGGACAGAAAGCCAAGTGGACTCAACGGAGAGGCCAGCAAGTCTCAGGAAATGGTGCATTTGGTGAACAAGGAGTCGTC
AGAAACTCCAGACCAGTTTATGACAGCTGATGAGACAAGGAACCTGCAGAATGTGGACATGAAGATTGGGGTGTAACACCTACACCATTA
TCTTGGAAAGAAACAACCGTTGGAAACATAACCATTACAGGGAGCTGGGACACTTAACAGATGCAATGTGCTACTGATTGTTTCATTGCG
AATCTTTTTTAGCATAAAATTTTCTACTCTTTTTGTTTTTTGTGTTTTGTTCTTTAAAGTCAGGTCCAATTTGTAAAAACAGCATTGCTT
TCTGAAATTAGGGCCCAATTAATAATCAGCAAGAATTTGATCGTTCCAGTTCCCACTTGGAGGCCTTTCATCCCTCGGGTGTGCTATGGA
TGGCTTCTAACAAAAACTACACATATGTATTCCTGATCGCCAACCTTTCCCCCACCAGCTAAGGACATTTCCCAGGGTTAATAGGGCCTG
GTCCCTGGGAGGAAATTTGAATGGGTCCATTTTGCCCTTCCATAGCCTAATCCCTGGGCATTGCTTTCCACTGAGGTTGGGGGTTGGGGT
GTACTAGTTACACATCTTCAACAGACCCCCTCTAGAAATTTTTCAGATGCTTCTGGGAGACACCCAAAGGGTGAAGCTATTTATCTGTAG
TAAACTATTTATCTGTGTTTTTGAAATATTAAACCCTGGATCAGTCCTTTGATCAGTATAATTTTTTAAAGTTACTTTGTCAGAGGCACA

>In-frame_LDLRAD3_ENST00000528989_chr11_35965694_+_CD44_ENST00000526669_chr11_35198122_+_845nt
GAAGGCGGGAGGGAGGAGGGCCAGGCGGGAGGGCGGGGACGGCGCGGCGAGGGGCGGGGTCAGCGCCGAGGCCGCGGGGGCAGCAACGAC
GCCGGGCAGCGGGAGCGGCGGCCGCGCCATGTGGCTGCTGGGGCCGCTGTGCCTGCTGCTGAGCAGCGCCGCGGATTTGAATATAACCTG
CCGCTTTGCAGGTGTATTCCACGTGGAGAAAAATGGTCGCTACAGCATCTCTCGGACGGAGGCCGCTGACCTCTGCAAGGCTTTCAATAG
CACCTTGCCCACAATGGCCCAGATGGAGAAAGCTCTGAGCATCGGATTTGAGACCTGCAGGTATGGGTTCATAGAAGGGCACGTGGTGAT
TCCCCGGATCCACCCCAACTCCATCTGTGGAGCAAACACAACCTCTGGTCCTATAAGGACACCCCAAATTCCAGAATGGCTGATCATCTT
GGCATCCCTCTTGGCCTTGGCTTTGATTCTTGCAGTTTGCATTGCAGTCAACAGTCGAAGAAGGTGTGGGCAGAAGAAAAAGCTAGTGAT
CAACAGTGGCAATGGAGCTGTGGAGGACAGAAAGCCAAGTGGACTCAACGGAGAGGCCAGCAAGTCTCAGGAAATGGTGCATTTGGTGAA
CAAGGAGTCGTCAGAAACTCCAGACCAGTTTATGACAGCTGATGAGACAAGGAACCTGCAGAATGTGGACATGAAGATTGGGGTGTAACA
CCTACACCATTATCTTGGAAAGAAACAACCGTTGGAAACATAACCATTACAGGGAGCTGGGACACTTAACAGATGCAATGTGCTACTGAT

>In-frame_LDLRAD3_ENST00000528989_chr11_35965694_+_CD44_ENST00000433892_chr11_35198122_+_2273nt
GAAGGCGGGAGGGAGGAGGGCCAGGCGGGAGGGCGGGGACGGCGCGGCGAGGGGCGGGGTCAGCGCCGAGGCCGCGGGGGCAGCAACGAC
GCCGGGCAGCGGGAGCGGCGGCCGCGCCATGTGGCTGCTGGGGCCGCTGTGCCTGCTGCTGAGCAGCGCCGCGGATTTGAATATAACCTG
CCGCTTTGCAGGTGTATTCCACGTGGAGAAAAATGGTCGCTACAGCATCTCTCGGACGGAGGCCGCTGACCTCTGCAAGGCTTTCAATAG
CACCTTGCCCACAATGGCCCAGATGGAGAAAGCTCTGAGCATCGGATTTGAGACCTGCAGGTATGGGTTCATAGAAGGGCACGTGGTGAT
TCCCCGGATCCACCCCAACTCCATCTGTGCAGCAAACAACACAGGGGTGTACATCCTCACATCCAACACCTCCCAGTATGACACATATTG
CTTCAATGCTTCAGCTCCACCTGAAGAAGATTGTACATCAGTCACAGACCTGCCCAATGCCTTTGATGGACCAATTACCATAACTATTGT
TAACCGTGATGGCACCCGCTATGTCCAGAAAGGAGAATACAGAACGAATCCTGAAGACATCTACCCCAGCAACCCTACTGATGATGACGT
GAGCAGCGGCTCCTCCAGTGAAAGGAGCAGCACTTCAGGAGGTTACATCTTTTACACCTTTTCTACTGTACACCCCATCCCAGACGAAGA
CAGTCCCTGGATCACCGACAGCACAGACAGAATCCCTGCTACCAATATGGACTCCAGTCATAGTATAACGCTTCAGCCTACTGCAAATCC
AAACACAGGTTTGGTGGAAGATTTGGACAGGACAGGACCTCTTTCAATGACAACGCAGCAGAGTAATTCTCAGAGCTTCTCTACATCACA
TGAAGGCTTGGAAGAAGATAAAGACCATCCAACAACTTCTACTCTGACATCAAGCAATAGGAATGATGTCACAGGTGGAAGAAGAGACCC
AAATCATTCTGAAGGCTCAACTACTTTACTGGAAGGTTATACCTCTCATTACCCACACACGAAGGAAAGCAGGACCTTCATCCCAGTGAC
CTCAGCTAAGACTGGGTCCTTTGGAGTTACTGCAGTTACTGTTGGAGATTCCAACTCTAATGTCAATCGTTCCTTATCAGGAGACCAAGA
CACATTCCACCCCAGTGGGGGGTCCCATACCACTCATGGATCTGAATCAGATGGACACTCACATGGGAGTCAAGAAGGTGGAGCAAACAC
AACCTCTGGTCCTATAAGGACACCCCAAATTCCAGAATGGCTGATCATCTTGGCATCCCTCTTGGCCTTGGCTTTGATTCTTGCAGTTTG
CATTGCAGTCAACAGTCGAAGAAGGTGTGGGCAGAAGAAAAAGCTAGTGATCAACAGTGGCAATGGAGCTGTGGAGGACAGAAAGCCAAG
TGGACTCAACGGAGAGGCCAGCAAGTCTCAGGAAATGGTGCATTTGGTGAACAAGGAGTCGTCAGAAACTCCAGACCAGTTTATGACAGC
TGATGAGACAAGGAACCTGCAGAATGTGGACATGAAGATTGGGGTGTAACACCTACACCATTATCTTGGAAAGAAACAACCGTTGGAAAC
ATAACCATTACAGGGAGCTGGGACACTTAACAGATGCAATGTGCTACTGATTGTTTCATTGCGAATCTTTTTTAGCATAAAATTTTCTAC
TCTTTTTGTTTTTTGTGTTTTGTTCTTTAAAGTCAGGTCCAATTTGTAAAAACAGCATTGCTTTCTGAAATTAGGGCCCAATTAATAATC
AGCAAGAATTTGATCGTTCCAGTTCCCACTTGGAGGCCTTTCATCCCTCGGGTGTGCTATGGATGGCTTCTAACAAAAACTACACATATG
TATTCCTGATCGCCAACCTTTCCCCCACCAGCTAAGGACATTTCCCAGGGTTAATAGGGCCTGGTCCCTGGGAGGAAATTTGAATGGGTC
CATTTTGCCCTTCCATAGCCTAATCCCTGGGCATTGCTTTCCACTGAGGTTGGGGGTTGGGGTGTACTAGTTACACATCTTCAACAGACC
CCCTCTAGAAATTTTTCAGATGCTTCTGGGAGACACCCAAAGGGTGAAGCTATTTATCTGTAGTAAACTATTTATCTGTGTTTTTGAAAT
ATTAAACCCTGGATCAGTCCTTTGATCAGTATAATTTTTTAAAGTTACTTTGTCAGAGGCACAAAAGGGTTTAAACTGATTCATAATAAA

>In-frame_LDLRAD3_ENST00000528989_chr11_35965694_+_CD44_ENST00000278386_chr11_35198122_+_563nt
GAAGGCGGGAGGGAGGAGGGCCAGGCGGGAGGGCGGGGACGGCGCGGCGAGGGGCGGGGTCAGCGCCGAGGCCGCGGGGGCAGCAACGAC
GCCGGGCAGCGGGAGCGGCGGCCGCGCCATGTGGCTGCTGGGGCCGCTGTGCCTGCTGCTGAGCAGCGCCGCGGATTTGAATATAACCTG
CCGCTTTGCAGGTGTATTCCACGTGGAGAAAAATGGTCGCTACAGCATCTCTCGGACGGAGGCCGCTGACCTCTGCAAGGCTTTCAATAG
CACCTTGCCCACAATGGCCCAGATGGAGAAAGCTCTGAGCATCGGATTTGAGACCTGCAGTTTGCATTGCAGTCAACAGTCGAAGAAGGT
GTGGGCAGAAGAAAAAGCTAGTGATCAACAGTGGCAATGGAGCTGTGGAGGACAGAAAGCCAAGTGGACTCAACGGAGAGGCCAGCAAGT
CTCAGGAAATGGTGCATTTGGTGAACAAGGAGTCGTCAGAAACTCCAGACCAGTTTATGACAGCTGATGAGACAAGGAACCTGCAGAATG

>In-frame_LDLRAD3_ENST00000528989_chr11_35965694_+_CD44_ENST00000434472_chr11_35198122_+_1720nt
GAAGGCGGGAGGGAGGAGGGCCAGGCGGGAGGGCGGGGACGGCGCGGCGAGGGGCGGGGTCAGCGCCGAGGCCGCGGGGGCAGCAACGAC
GCCGGGCAGCGGGAGCGGCGGCCGCGCCATGTGGCTGCTGGGGCCGCTGTGCCTGCTGCTGAGCAGCGCCGCGGATTTGAATATAACCTG
CCGCTTTGCAGGTGTATTCCACGTGGAGAAAAATGGTCGCTACAGCATCTCTCGGACGGAGGCCGCTGACCTCTGCAAGGCTTTCAATAG
CACCTTGCCCACAATGGCCCAGATGGAGAAAGCTCTGAGCATCGGATTTGAGACCTGCAGGTATGGGTTCATAGAAGGGCACGTGGTGAT
TCCCCGGATCCACCCCAACTCCATCTGTGCAGCAAACAACACAGGGGTGTACATCCTCACATCCAACACCTCCCAGTATGACACATATTG
CTTCAATGCTTCAGCTCCACCTGAAGAAGATTGTACATCAGTCACAGACCTGCCCAATGCCTTTGATGGACCAATTACCATAACTATTGT
TAACCGTGATGGCACCCGCTATGTCCAGAAAGGAGAATACAGAACGAATCCTGAAGACATCTACCCCAGCAACCCTACTGATGATGACGT
GAGCAGCGGCTCCTCCAGTGAAAGGAGCAGCACTTCAGGAGGTTACATCTTTTACACCTTTTCTACTGTACACCCCATCCCAGACGAAGA
CAGTCCCTGGATCACCGACAGCACAGACAGAATCCCTGCTACCAATAGGAATGATGTCACAGGTGGAAGAAGAGACCCAAATCATTCTGA
AGGCTCAACTACTTTACTGGAAGGTTATACCTCTCATTACCCACACACGAAGGAAAGCAGGACCTTCATCCCAGTGACCTCAGCTAAGAC
TGGGTCCTTTGGAGTTACTGCAGTTACTGTTGGAGATTCCAACTCTAATGTCAATCGTTCCTTATCAGGAGACCAAGACACATTCCACCC
CAGTGGGGGGTCCCATACCACTCATGGATCTGAATCAGATGGACACTCACATGGGAGTCAAGAAGGTGGAGCAAACACAACCTCTGGTCC
TATAAGGACACCCCAAATTCCAGAATGGCTGATCATCTTGGCATCCCTCTTGGCCTTGGCTTTGATTCTTGCAGTTTGCATTGCAGTCAA
CAGTCGAAGAAGGTGTGGGCAGAAGAAAAAGCTAGTGATCAACAGTGGCAATGGAGCTGTGGAGGACAGAAAGCCAAGTGGACTCAACGG
AGAGGCCAGCAAGTCTCAGGAAATGGTGCATTTGGTGAACAAGGAGTCGTCAGAAACTCCAGACCAGTTTATGACAGCTGATGAGACAAG
GAACCTGCAGAATGTGGACATGAAGATTGGGGTGTAACACCTACACCATTATCTTGGAAAGAAACAACCGTTGGAAACATAACCATTACA
GGGAGCTGGGACACTTAACAGATGCAATGTGCTACTGATTGTTTCATTGCGAATCTTTTTTAGCATAAAATTTTCTACTCTTTTTGTTTT
TTGTGTTTTGTTCTTTAAAGTCAGGTCCAATTTGTAAAAACAGCATTGCTTTCTGAAATTAGGGCCCAATTAATAATCAGCAAGAATTTG
ATCGTTCCAGTTCCCACTTGGAGGCCTTTCATCCCTCGGGTGTGCTATGGATGGCTTCTAACAAAAACTACACATATGTATTCCTGATCG

>In-frame_LDLRAD3_ENST00000528989_chr11_35965694_+_CD44_ENST00000352818_chr11_35198122_+_1120nt
GAAGGCGGGAGGGAGGAGGGCCAGGCGGGAGGGCGGGGACGGCGCGGCGAGGGGCGGGGTCAGCGCCGAGGCCGCGGGGGCAGCAACGAC
GCCGGGCAGCGGGAGCGGCGGCCGCGCCATGTGGCTGCTGGGGCCGCTGTGCCTGCTGCTGAGCAGCGCCGCGGATTTGAATATAACCTG
CCGCTTTGCAGGTGTATTCCACGTGGAGAAAAATGGTCGCTACAGCATCTCTCGGACGGAGGCCGCTGACCTCTGCAAGGCTTTCAATAG
CACCTTGCCCACAATGGCCCAGATGGAGAAAGCTCTGAGCATCGGATTTGAGACCTGCAGGTATGGGTTCATAGAAGGGCACGTGGTGAT
TCCCCGGATCCACCCCAACTCCATCTGTGCAGCAAACAACACAGGGGTGTACATCCTCACATCCAACACCTCCCAGTATGACACATATTG
CTTCAATGCTTCAGCTCCACCTGAAGAAGATTGTACATCAGTCACAGACCTGCCCAATGCCTTTGATGGACCAATTACCATAACTATTGT
TAACCGTGATGGCACCCGCTATGTCCAGAAAGGAGAATACAGAACGAATCCTGAAGACATCTACCCCAGCAACCCTACTGATGATGACGT
GAGCAGCGGCTCCTCCAGTGAAAGGAGCAGCACTTCAGGAGGTTACATCTTTTACACCTTTTCTACTGTACACCCCATCCCAGACGAAGA
CAGTCCCTGGATCACCGACAGCACAGACAGAATCCCTGCTACCAGACACTCACATGGGAGTCAAGAAGGTGGAGCAAACACAACCTCTGG
TCCTATAAGGACACCCCAAATTCCAGAATGGCTGATCATCTTGGCATCCCTCTTGGCCTTGGCTTTGATTCTTGCAGTTTGCATTGCAGT
CAACAGTCGAAGAAGGTGTGGGCAGAAGAAAAAGCTAGTGATCAACAGTGGCAATGGAGCTGTGGAGGACAGAAAGCCAAGTGGACTCAA
CGGAGAGGCCAGCAAGTCTCAGGAAATGGTGCATTTGGTGAACAAGGAGTCGTCAGAAACTCCAGACCAGTTTATGACAGCTGATGAGAC

>In-frame_LDLRAD3_ENST00000315571_chr11_35965694_+_CD44_ENST00000263398_chr11_35198122_+_4155nt
AGCGGGAGCGGCGGCCGCGCCATGTGGCTGCTGGGGCCGCTGTGCCTGCTGCTGAGCAGCGCCGCGGATTTGAATATAACCTGCCGCTTT
GCAGGTGTATTCCACGTGGAGAAAAATGGTCGCTACAGCATCTCTCGGACGGAGGCCGCTGACCTCTGCAAGGCTTTCAATAGCACCTTG
CCCACAATGGCCCAGATGGAGAAAGCTCTGAGCATCGGATTTGAGACCTGCAGGTATGGGTTCATAGAAGGGCACGTGGTGATTCCCCGG
ATCCACCCCAACTCCATCTGTGCAGCAAACAACACAGGGGTGTACATCCTCACATCCAACACCTCCCAGTATGACACATATTGCTTCAAT
GCTTCAGCTCCACCTGAAGAAGATTGTACATCAGTCACAGACCTGCCCAATGCCTTTGATGGACCAATTACCATAACTATTGTTAACCGT
GATGGCACCCGCTATGTCCAGAAAGGAGAATACAGAACGAATCCTGAAGACATCTACCCCAGCAACCCTACTGATGATGACGTGAGCAGC
GGCTCCTCCAGTGAAAGGAGCAGCACTTCAGGAGGTTACATCTTTTACACCTTTTCTACTGTACACCCCATCCCAGACGAAGACAGTCCC
TGGATCACCGACAGCACAGACAGAATCCCTGCTACCAGAGACCAAGACACATTCCACCCCAGTGGGGGGTCCCATACCACTCATGGATCT
GAATCAGATGGACACTCACATGGGAGTCAAGAAGGTGGAGCAAACACAACCTCTGGTCCTATAAGGACACCCCAAATTCCAGAATGGCTG
ATCATCTTGGCATCCCTCTTGGCCTTGGCTTTGATTCTTGCAGTTTGCATTGCAGTCAACAGTCGAAGAAGGTGTGGGCAGAAGAAAAAG
CTAGTGATCAACAGTGGCAATGGAGCTGTGGAGGACAGAAAGCCAAGTGGACTCAACGGAGAGGCCAGCAAGTCTCAGGAAATGGTGCAT
TTGGTGAACAAGGAGTCGTCAGAAACTCCAGACCAGTTTATGACAGCTGATGAGACAAGGAACCTGCAGAATGTGGACATGAAGATTGGG
GTGTAACACCTACACCATTATCTTGGAAAGAAACAACCGTTGGAAACATAACCATTACAGGGAGCTGGGACACTTAACAGATGCAATGTG
CTACTGATTGTTTCATTGCGAATCTTTTTTAGCATAAAATTTTCTACTCTTTTTGTTTTTTGTGTTTTGTTCTTTAAAGTCAGGTCCAAT
TTGTAAAAACAGCATTGCTTTCTGAAATTAGGGCCCAATTAATAATCAGCAAGAATTTGATCGTTCCAGTTCCCACTTGGAGGCCTTTCA
TCCCTCGGGTGTGCTATGGATGGCTTCTAACAAAAACTACACATATGTATTCCTGATCGCCAACCTTTCCCCCACCAGCTAAGGACATTT
CCCAGGGTTAATAGGGCCTGGTCCCTGGGAGGAAATTTGAATGGGTCCATTTTGCCCTTCCATAGCCTAATCCCTGGGCATTGCTTTCCA
CTGAGGTTGGGGGTTGGGGTGTACTAGTTACACATCTTCAACAGACCCCCTCTAGAAATTTTTCAGATGCTTCTGGGAGACACCCAAAGG
GTGAAGCTATTTATCTGTAGTAAACTATTTATCTGTGTTTTTGAAATATTAAACCCTGGATCAGTCCTTTGATCAGTATAATTTTTTAAA
GTTACTTTGTCAGAGGCACAAAAGGGTTTAAACTGATTCATAATAAATATCTGTACTTCTTCGATCTTCACCTTTTGTGCTGTGATTCTT
CAGTTTCTAAACCAGCACTGTCTGGGTCCCTACAATGTATCAGGAAGAGCTGAGAATGGTAAGGAGACTCTTCTAAGTCTTCATCTCAGA
GACCCTGAGTTCCCACTCAGACCCACTCAGCCAAATCTCATGGAAGACCAAGGAGGGCAGCACTGTTTTTGTTTTTTGTTTTTTGTTTTT
TTTTTTTGACACTGTCCAAAGGTTTTCCATCCTGTCCTGGAATCAGAGTTGGAAGCTGAGGAGCTTCAGCCTCTTTTATGGTTTAATGGC
CACCTGTTCTCTCCTGTGAAAGGCTTTGCAAAGTCACATTAAGTTTGCATGACCTGTTATCCCTGGGGCCCTATTTCATAGAGGCTGGCC
CTATTAGTGATTTCCAAAAACAATATGGAAGTGCCTTTTGATGTCTTACAATAAGAGAAGAAGCCAATGGAAATGAAAGAGATTGGCAAA
GGGGAAGGATGATGCCATGTAGATCCTGTTTGACATTTTTATGGCTGTATTTGTAAACTTAAACACACCAGTGTCTGTTCTTGATGCAGT
TGCTATTTAGGATGAGTTAAGTGCCTGGGGAGTCCCTCAAAAGGTTAAAGGGATTCCCATCATTGGAATCTTATCACCAGATAGGCAAGT
TTATGACCAAACAAGAGAGTACTGGCTTTATCCTCTAACCTCATATTTTCTCCCACTTGGCAAGTCCTTTGTGGCATTTATTCATCAGTC
AGGGTGTCCGATTGGTCCTAGAACTTCCAAAGGCTGCTTGTCATAGAAGCCATTGCATCTATAAAGCAACGGCTCCTGTTAAATGGTATC
TCCTTTCTGAGGCTCCTACTAAAAGTCATTTGTTACCTAAACTTATGTGCTTAACAGGCAATGCTTCTCAGACCACAAAGCAGAAAGAAG
AAGAAAAGCTCCTGACTAAATCAGGGCTGGGCTTAGACAGAGTTGATCTGTAGAATATCTTTAAAGGAGAGATGTCAACTTTCTGCACTA
TTCCCAGCCTCTGCTCCTCCCTGTCTACCCTCTCCCCTCCCTCTCTCCCTCCACTTCACCCCACAATCTTGAAAAACTTCCTTTCTCTTC
TGTGAACATCATTGGCCAGATCCATTTTCAGTGGTCTGGATTTCTTTTTATTTTCTTTTCAACTTGAAAGAAACTGGACATTAGGCCACT
ATGTGTTGTTACTGCCACTAGTGTTCAAGTGCCTCTTGTTTTCCCAGAGATTTCCTGGGTCTGCCAGAGGCCCAGACAGGCTCACTCAAG
CTCTTTAACTGAAAAGCAACAAGCCACTCCAGGACAAGGTTCAAAATGGTTACAACAGCCTCTACCTGTCGCCCCAGGGAGAAAGGGGTA
GTGATACAAGTCTCATAGCCAGAGATGGTTTTCCACTCCTTCTAGATATTCCCAAAAAGAGGCTGAGACAGGAGGTTATTTTCAATTTTA
TTTTGGAATTAAATACTTTTTTCCCTTTATTACTGTTGTAGTCCCTCACTTGGATATACCTCTGTTTTCACGATAGAAATAAGGGAGGTC
TAGAGCTTCTATTCCTTGGCCATTGTCAACGGAGAGCTGGCCAAGTCTTCACAAACCCTTGCAACATTGCCTGAAGTTTATGGAATAAGA
TGTATTCTCACTCCCTTGATCTCAAGGGCGTAACTCTGGAAGCACAGCTTGACTACACGTCATTTTTACCAATGATTTTCAGGTGACCTG
GGCTAAGTCATTTAAACTGGGTCTTTATAAAAGTAAAAGGCCAACATTTAATTATTTTGCAAAGCAACCTAAGAGCTAAAGATGTAATTT
TTCTTGCAATTGTAAATCTTTTGTGTCTCCTGAAGACTTCCCTTAAAATTAGCTCTGAGTGAAAAATCAAAAGAGACAAAAGACATCTTC
GAATCCATATTTCAAGCCTGGTAGAATTGGCTTTTCTAGCAGAACCTTTCCAAAAGTTTTATATTGAGATTCATAACAACACCAAGAATT
GATTTTGTAGCCAACATTCATTCAATACTGTTATATCAGAGGAGTAGGAGAGAGGAAACATTTGACTTATCTGGAAAAGCAAAATGTACT
TAAGAATAAGAATAACATGGTCCATTCACCTTTATGTTATAGATATGTCTTTGTGTAAATCATTTGTTTTGAGTTTTCAAAGAATAGCCC
ATTGTTCATTCTTGTGCTGTACAATGACCACTGTTATTGTTACTTTGACTTTTCAGAGCACACCCTTCCTCTGGTTTTTGTATATTTATT
GATGGATCAATAATAATGAGGAAAGCATGATATGTATATTGCTGAGTTGAAAGCACTTATTGGAAAATATTAAAAGGCTAACATTAAAAG

>In-frame_LDLRAD3_ENST00000315571_chr11_35965694_+_CD44_ENST00000449691_chr11_35198122_+_2235nt
AGCGGGAGCGGCGGCCGCGCCATGTGGCTGCTGGGGCCGCTGTGCCTGCTGCTGAGCAGCGCCGCGGATTTGAATATAACCTGCCGCTTT
GCAGGTGTATTCCACGTGGAGAAAAATGGTCGCTACAGCATCTCTCGGACGGAGGCCGCTGACCTCTGCAAGGCTTTCAATAGCACCTTG
CCCACAATGGCCCAGATGGAGAAAGCTCTGAGCATCGGATTTGAGACCTGCAGGTATGGGTTCATAGAAGGGCACGTGGTGATTCCCCGG
ATCCACCCCAACTCCATCTGTGCAGCAAACAACACAGGGGTGTACATCCTCACATCCAACACCTCCCAGTATGACACATATTGCTTCAAT
GCTTCAGCTCCACCTGAAGAAGATTGTACATCAGTCACAGACCTGCCCAATGCCTTTGATGGACCAATTACCATAACTATTGTTAACCGT
GATGGCACCCGCTATGTCCAGAAAGGAGAATACAGAACGAATCCTGAAGACATCTACCCCAGCAACCCTACTGATGATGACGTGAGCAGC
GGCTCCTCCAGTGAAAGGAGCAGCACTTCAGGAGGTTACATCTTTTACACCTTTTCTACTGTACACCCCATCCCAGACGAAGACAGTCCC
TGGATCACCGACAGCACAGACAGAATCCCTGCTACCACTTTGATGAGCACTAGTGCTACAGCAACTGAGACAGCAACCAAGAGGCAAGAA
ACCTGGGATTGGTTTTCATGGTTGTTTCTACCATCAGAGTCAAAGAATCATCTTCACACAACAACACAAATGGCTGGTACGTCTTCAAAT
ACCATCTCAGCAGGCTGGGAGCCAAATGAAGAAAATGAAGATGAAAGAGACAGACACCTCAGTTTTTCTGGATCAGGCATTGATGATGAT
GAAGATTTTATCTCCAGCACCATTTCAACCACACCACGGGCTTTTGACCACACAAAACAGAACCAGGACTGGACCCAGTGGAACCCAAGC
CATTCAAATCCGGAAGTGCTACTTCAGACAACCACAAGGATGACTGATGTAGACAGAAATGGCACCACTGCTTATGAAGGAAACTGGAAC
CCAGAAGCACACCCTCCCCTCATTCACCATGAGCATCATGAGGAAGAAGAGACCCCACATTCTACAAGCACAACAGCCTCAGCTCATACC
AGCCATCCAATGCAAGGAAGGACAACACCAAGCCCAGAGGACAGTTCCTGGACTGATTTCTTCAACCCAATCTCACACCCCATGGGACGA
GGTCATCAAGCAGGAAGAAGGATGGATATGGACTCCAGTCATAGTATAACGCTTCAGCCTACTGCAAATCCAAACACAGGTTTGGTGGAA
GATTTGGACAGGACAGGACCTCTTTCAATGACAACGCAGCAGAGTAATTCTCAGAGCTTCTCTACATCACATGAAGGCTTGGAAGAAGAT
AAAGACCATCCAACAACTTCTACTCTGACATCAAGCAATAGGAATGATGTCACAGGTGGAAGAAGAGACCCAAATCATTCTGAAGGCTCA
ACTACTTTACTGGAAGGTTATACCTCTCATTACCCACACACGAAGGAAAGCAGGACCTTCATCCCAGTGACCTCAGCTAAGACTGGGTCC
TTTGGAGTTACTGCAGTTACTGTTGGAGATTCCAACTCTAATGTCAATCGTTCCTTATCAGGAGACCAAGACACATTCCACCCCAGTGGG
GGGTCCCATACCACTCATGGATCTGAATCAGATGGACACTCACATGGGAGTCAAGAAGGTGGAGCAAACACAACCTCTGGTCCTATAAGG
ACACCCCAAATTCCAGAATGGCTGATCATCTTGGCATCCCTCTTGGCCTTGGCTTTGATTCTTGCAGTTTGCATTGCAGTCAACAGTCGA
AGAAGGTGTGGGCAGAAGAAAAAGCTAGTGATCAACAGTGGCAATGGAGCTGTGGAGGACAGAAAGCCAAGTGGACTCAACGGAGAGGCC
AGCAAGTCTCAGGAAATGGTGCATTTGGTGAACAAGGAGTCGTCAGAAACTCCAGACCAGTTTATGACAGCTGATGAGACAAGGAACCTG
CAGAATGTGGACATGAAGATTGGGGTGTAACACCTACACCATTATCTTGGAAAGAAACAACCGTTGGAAACATAACCATTACAGGGAGCT

>In-frame_LDLRAD3_ENST00000315571_chr11_35965694_+_CD44_ENST00000360158_chr11_35198122_+_1326nt
AGCGGGAGCGGCGGCCGCGCCATGTGGCTGCTGGGGCCGCTGTGCCTGCTGCTGAGCAGCGCCGCGGATTTGAATATAACCTGCCGCTTT
GCAGGTGTATTCCACGTGGAGAAAAATGGTCGCTACAGCATCTCTCGGACGGAGGCCGCTGACCTCTGCAAGGCTTTCAATAGCACCTTG
CCCACAATGGCCCAGATGGAGAAAGCTCTGAGCATCGGATTTGAGACCTGCAGGTATGGGTTCATAGAAGGGCACGTGGTGATTCCCCGG
ATCCACCCCAACTCCATCTGTGCAGCAAACAACACAGGGGTGTACATCCTCACATCCAACACCTCCCAGTATGACACATATTGCTTCAAT
GCTTCAGCTCCACCTGAAGAAGATTGTACATCAGTCACAGACCTGCCCAATGCCTTTGATGGACCAATTACCATAACTATTGTTAACCGT
GATGGCACCCGCTATGTCCAGAAAGGAGAATACAGAACGAATCCTGAAGACATCTACCCCAGCAACCCTACTGATGATGACGTGAGCAGC
GGCTCCTCCAGTGAAAGGAGCAGCACTTCAGGAGGTTACATCTTTTACACCTTTTCTACTGTACACCCCATCCCAGACGAAGACAGTCCC
TGGATCACCGACAGCACAGACAGAATCCCTGCTACCAATATGGACTCCAGTCATAGTATAACGCTTCAGCCTACTGCAAATCCAAACACA
GGTTTGGTGGAAGATTTGGACAGGACAGGACCTCTTTCAATGACAACGCGTAGAGACCAAGACACATTCCACCCCAGTGGGGGGTCCCAT
ACCACTCATGGATCTGAATCAGATGGACACTCACATGGGAGTCAAGAAGGTGGAGCAAACACAACCTCTGGTCCTATAAGGACACCCCAA
ATTCCAGAATGGCTGATCATCTTGGCATCCCTCTTGGCCTTGGCTTTGATTCTTGCAGTTTGCATTGCAGTCAACAGTCGAAGAAGGTGT
GGGCAGAAGAAAAAGCTAGTGATCAACAGTGGCAATGGAGCTGTGGAGGACAGAAAGCCAAGTGGACTCAACGGAGAGGCCAGCAAGTCT
CAGGAAATGGTGCATTTGGTGAACAAGGAGTCGTCAGAAACTCCAGACCAGTTTATGACAGCTGATGAGACAAGGAACCTGCAGAATGTG
GACATGAAGATTGGGGTGTAACACCTACACCATTATCTTGGAAAGAAACAACCGTTGGAAACATAACCATTACAGGGAGCTGGGACACTT

>In-frame_LDLRAD3_ENST00000315571_chr11_35965694_+_CD44_ENST00000415148_chr11_35198122_+_2235nt
AGCGGGAGCGGCGGCCGCGCCATGTGGCTGCTGGGGCCGCTGTGCCTGCTGCTGAGCAGCGCCGCGGATTTGAATATAACCTGCCGCTTT
GCAGGTGTATTCCACGTGGAGAAAAATGGTCGCTACAGCATCTCTCGGACGGAGGCCGCTGACCTCTGCAAGGCTTTCAATAGCACCTTG
CCCACAATGGCCCAGATGGAGAAAGCTCTGAGCATCGGATTTGAGACCTGCAGGTATGGGTTCATAGAAGGGCACGTGGTGATTCCCCGG
ATCCACCCCAACTCCATCTGTGCAGCAAACAACACAGGGGTGTACATCCTCACATCCAACACCTCCCAGTATGACACATATTGCTTCAAT
GCTTCAGCTCCACCTGAAGAAGATTGTACATCAGTCACAGACCTGCCCAATGCCTTTGATGGACCAATTACCATAACTATTGTTAACCGT
GATGGCACCCGCTATGTCCAGAAAGGAGAATACAGAACGAATCCTGAAGACATCTACCCCAGCAACCCTACTGATGATGACGTGAGCAGC
GGCTCCTCCAGTGAAAGGAGCAGCACTTCAGGAGGTTACATCTTTTACACCTTTTCTACTGTACACCCCATCCCAGACGAAGACAGTCCC
TGGATCACCGACAGCACAGACAGAATCCCTGCTACCAGTACGTCTTCAAATACCATCTCAGCAGGCTGGGAGCCAAATGAAGAAAATGAA
GATGAAAGAGACAGACACCTCAGTTTTTCTGGATCAGGCATTGATGATGATGAAGATTTTATCTCCAGCACCATTTCAACCACACCACGG
GCTTTTGACCACACAAAACAGAACCAGGACTGGACCCAGTGGAACCCAAGCCATTCAAATCCGGAAGTGCTACTTCAGACAACCACAAGG
ATGACTGATGTAGACAGAAATGGCACCACTGCTTATGAAGGAAACTGGAACCCAGAAGCACACCCTCCCCTCATTCACCATGAGCATCAT
GAGGAAGAAGAGACCCCACATTCTACAAGCACAATCCAGGCAACTCCTAGTAGTACAACGGAAGAAACAGCTACCCAGAAGGAACAGTGG
TTTGGCAACAGATGGCATGAGGGATATCGCCAAACACCCAAAGAAGACTCCCATTCGACAACAGGGACAGCTGCAGCCTCAGCTCATACC
AGCCATCCAATGCAAGGAAGGACAACACCAAGCCCAGAGGACAGTTCCTGGACTGATTTCTTCAACCCAATCTCACACCCCATGGGACGA
GGTCATCAAGCAGGAAGAAGGATGGATATGGACTCCAGTCATAGTATAACGCTTCAGCCTACTGCAAATCCAAACACAGGTTTGGTGGAA
GATTTGGACAGGACAGGACCTCTTTCAATGACAACGCAGCAGAGTAATTCTCAGAGCTTCTCTACATCACATGAAGGCTTGGAAGAAGAT
AAAGACCATCCAACAACTTCTACTCTGACATCAAGCAATAGGAATGATGTCACAGGTGGAAGAAGAGACCCAAATCATTCTGAAGGCTCA
ACTACTTTACTGGAAGGTTATACCTCTCATTACCCACACACGAAGGAAAGCAGGACCTTCATCCCAGTGACCTCAGCTAAGACTGGGTCC
TTTGGAGTTACTGCAGTTACTGTTGGAGATTCCAACTCTAATGTCAATCGTTCCTTATCAGGAGACCAAGACACATTCCACCCCAGTGGG
GGGTCCCATACCACTCATGGATCTGAATCAGATGGACACTCACATGGGAGTCAAGAAGGTGGAGCAAACACAACCTCTGGTCCTATAAGG
ACACCCCAAATTCCAGAATGGCTGATCATCTTGGCATCCCTCTTGGCCTTGGCTTTGATTCTTGCAGTTTGCATTGCAGTCAACAGTCGA
AGAAGGTGTGGGCAGAAGAAAAAGCTAGTGATCAACAGTGGCAATGGAGCTGTGGAGGACAGAAAGCCAAGTGGACTCAACGGAGAGGCC
AGCAAGTCTCAGGAAATGGTGCATTTGGTGAACAAGGAGTCGTCAGAAACTCCAGACCAGTTTATGACAGCTGATGAGACAAGGAACCTG
CAGAATGTGGACATGAAGATTGGGGTGTAACACCTACACCATTATCTTGGAAAGAAACAACCGTTGGAAACATAACCATTACAGGGAGCT

>In-frame_LDLRAD3_ENST00000315571_chr11_35965694_+_CD44_ENST00000437706_chr11_35198122_+_2160nt
AGCGGGAGCGGCGGCCGCGCCATGTGGCTGCTGGGGCCGCTGTGCCTGCTGCTGAGCAGCGCCGCGGATTTGAATATAACCTGCCGCTTT
GCAGGTGTATTCCACGTGGAGAAAAATGGTCGCTACAGCATCTCTCGGACGGAGGCCGCTGACCTCTGCAAGGCTTTCAATAGCACCTTG
CCCACAATGGCCCAGATGGAGAAAGCTCTGAGCATCGGATTTGAGACCTGCAGGTATGGGTTCATAGAAGGGCACGTGGTGATTCCCCGG
ATCCACCCCAACTCCATCTGTGCAGCAAACAACACAGGGGTGTACATCCTCACATCCAACACCTCCCAGTATGACACATATTGCTTCAAT
GCTTCAGCTCCACCTGAAGAAGATTGTACATCAGTCACAGACCTGCCCAATGCCTTTGATGGACCAATTACCATAACTATTGTTAACCGT
GATGGCACCCGCTATGTCCAGAAAGGAGAATACAGAACGAATCCTGAAGACATCTACCCCAGCAACCCTACTGATGATGACGTGAGCAGC
GGCTCCTCCAGTGAAAGGAGCAGCACTTCAGGAGGTTACATCTTTTACACCTTTTCTACTGTACACCCCATCCCAGACGAAGACAGTCCC
TGGATCACCGACAGCACAGACAGAATCCCTGCTACCACTTTGATGAGCACTAGTGCTACAGCAACTGAGACAGCAACCAAGAGGCAAGAA
ACCTGGGATTGGTTTTCATGGTTGTTTCTACCATCAGAGTCAAAGAATCATCTTCACACAACAACACAAATGGCTGGTACGTCTTCAAAT
ACCATCTCAGCAGGCTGGGAGCCAAATGAAGAAAATGAAGATGAAAGAGACAGACACCTCAGTTTTTCTGGATCAGGCATTGATGATGAT
GAAGATTTTATCTCCAGCACCATTTCAACCACACCACGGGCTTTTGACCACACAAAACAGAACCAGGACTGGACCCAGTGGAACCCAAGC
CATTCAAATCCGGAAGTGCTACTTCAGACAACCACAAGGATGACTGATGTAGACAGAAATGGCACCACTGCTTATGAAGGAAACTGGAAC
CCAGAAGCACACCCTCCCCTCATTCACCATGAGCATCATGAGGAAGAAGAGACCCCACATTCTACAAGCACAATCCAGGCAACTCCTAGT
AGTACAACGGAAGAAACAGCTACCCAGAAGGAACAGTGGTTTGGCAACAGATGGCATGAGGGATATCGCCAAACACCCAAAGAAGACTCC
CATTCGACAACAGGGACAGCTGCAGCCTCAGCTCATACCAGCCATCCAATGCAAGGAAGGACAACACCAAGCCCAGAGGACAGTTCCTGG
ACTGATTTCTTCAACCCAATCTCACACCCCATGGGACGAGGTCATCAAGCAGGAAGAAGGATGGATATGGACTCCAGTCATAGTATAACG
CTTCAGCCTACTGCAAATCCAAACACAGGTTTGGTGGAAGATTTGGACAGGACAGGACCTCTTTCAATGACAACGCAGCAGAGTAATTCT
CAGAGCTTCTCTACATCACATGAAGGCTTGGAAGAAGATAAAGACCATCCAACAACTTCTACTCTGACATCAAGCAGAGACCAAGACACA
TTCCACCCCAGTGGGGGGTCCCATACCACTCATGGATCTGAATCAGATGGACACTCACATGGGAGTCAAGAAGGTGGAGCAAACACAACC
TCTGGTCCTATAAGGACACCCCAAATTCCAGAATGGCTGATCATCTTGGCATCCCTCTTGGCCTTGGCTTTGATTCTTGCAGTTTGCATT
GCAGTCAACAGTCGAAGAAGGTGTGGGCAGAAGAAAAAGCTAGTGATCAACAGTGGCAATGGAGCTGTGGAGGACAGAAAGCCAAGTGGA
CTCAACGGAGAGGCCAGCAAGTCTCAGGAAATGGTGCATTTGGTGAACAAGGAGTCGTCAGAAACTCCAGACCAGTTTATGACAGCTGAT
GAGACAAGGAACCTGCAGAATGTGGACATGAAGATTGGGGTGTAACACCTACACCATTATCTTGGAAAGAAACAACCGTTGGAAACATAA
CCATTACAGGGAGCTGGGACACTTAACAGATGCAATGTGCTACTGATTGTTTCATTGCGAATCTTTTTTAGCATAAAATTTTCTACTCTT

>In-frame_LDLRAD3_ENST00000315571_chr11_35965694_+_CD44_ENST00000433354_chr11_35198122_+_2280nt
AGCGGGAGCGGCGGCCGCGCCATGTGGCTGCTGGGGCCGCTGTGCCTGCTGCTGAGCAGCGCCGCGGATTTGAATATAACCTGCCGCTTT
GCAGGTGTATTCCACGTGGAGAAAAATGGTCGCTACAGCATCTCTCGGACGGAGGCCGCTGACCTCTGCAAGGCTTTCAATAGCACCTTG
CCCACAATGGCCCAGATGGAGAAAGCTCTGAGCATCGGATTTGAGACCTGCAGGTATGGGTTCATAGAAGGGCACGTGGTGATTCCCCGG
ATCCACCCCAACTCCATCTGTGCAGCAAACAACACAGGGGTGTACATCCTCACATCCAACACCTCCCAGTATGACACATATTGCTTCAAT
GCTTCAGCTCCACCTGAAGAAGATTGTACATCAGTCACAGACCTGCCCAATGCCTTTGATGGACCAATTACCATAACTATTGTTAACCGT
GATGGCACCCGCTATGTCCAGAAAGGAGAATACAGAACGAATCCTGAAGACATCTACCCCAGCAACCCTACTGATGATGACGTGAGCAGC
GGCTCCTCCAGTGAAAGGAGCAGCACTTCAGGAGGTTACATCTTTTACACCTTTTCTACTGTACACCCCATCCCAGACGAAGACAGTCCC
TGGATCACCGACAGCACAGACAGAATCCCTGCTACCACTTTGATGAGCACTAGTGCTACAGCAACTGAGACAGCAACCAAGAGGCAAGAA
ACCTGGGATTGGTTTTCATGGTTGTTTCTACCATCAGAGTCAAAGAATCATCTTCACACAACAACACAAATGGCTGGTACGTCTTCAAAT
ACCATCTCAGCAGGCTGGGAGCCAAATGAAGAAAATGAAGATGAAAGAGACAGACACCTCAGTTTTTCTGGATCAGGCATTGATGATGAT
GAAGATTTTATCTCCAGCACCATTTCAACCACACCACGGGCTTTTGACCACACAAAACAGAACCAGGACTGGACCCAGTGGAACCCAAGC
CATTCAAATCCGGAAGTGCTACTTCAGACAACCACAAGGATGACTGCAGATGTAGACAGAAATGGCACCACTGCTTATGAAGGAAACTGG
AACCCAGAAGCACACCCTCCCCTCATTCACCATGAGCATCATGAGGAAGAAGAGACCCCACATTCTACAAGCACAATCCAGGCAACTCCT
AGTAGTACAACGGAAGAAACAGCTACCCAGAAGGAACAGTGGTTTGGCAACAGATGGCATGAGGGATATCGCCAAACACCCAAAGAAGAC
TCCCATTCGACAACAGGGACAGCTGCAGCCTCAGCTCATACCAGCCATCCAATGCAAGGAAGGACAACACCAAGCCCAGAGGACAGTTCC
TGGACTGATTTCTTCAACCCAATCTCACACCCCATGGGACGAGGTCATCAAGCAGGAAGAAGGATGGATATGGACTCCAGTCATAGTATA
ACGCTTCAGCCTACTGCAAATCCAAACACAGGTTTGGTGGAAGATTTGGACAGGACAGGACCTCTTTCAATGACAACGCGTAATAGGAAT
GATGTCACAGGTGGAAGAAGAGACCCAAATCATTCTGAAGGCTCAACTACTTTACTGGAAGGTTATACCTCTCATTACCCACACACGAAG
GAAAGCAGGACCTTCATCCCAGTGACCTCAGCTAAGACTGGGTCCTTTGGAGTTACTGCAGTTACTGTTGGAGATTCCAACTCTAATGTC
AATCGTTCCTTATCAGGAGACCAAGACACATTCCACCCCAGTGGGGGGTCCCATACCACTCATGGATCTGAATCAGATGGACACTCACAT
GGGAGTCAAGAAGGTGGAGCAAACACAACCTCTGGTCCTATAAGGACACCCCAAATTCCAGAATGGCTGATCATCTTGGCATCCCTCTTG
GCCTTGGCTTTGATTCTTGCAGTTTGCATTGCAGTCAACAGTCGAAGAAGGTGTGGGCAGAAGAAAAAGCTAGTGATCAACAGTGGCAAT
GGAGCTGTGGAGGACAGAAAGCCAAGTGGACTCAACGGAGAGGCCAGCAAGTCTCAGGAAATGGTGCATTTGGTGAACAAGGAGTCGTCA
GAAACTCCAGACCAGTTTATGACAGCTGATGAGACAAGGAACCTGCAGAATGTGGACATGAAGATTGGGGTGTAACACCTACACCATTAT
CTTGGAAAGAAACAACCGTTGGAAACATAACCATTACAGGGAGCTGGGACACTTAACAGATGCAATGTGCTACTGATTGTTTCATTGCGA

>In-frame_LDLRAD3_ENST00000315571_chr11_35965694_+_CD44_ENST00000428726_chr11_35198122_+_2923nt
AGCGGGAGCGGCGGCCGCGCCATGTGGCTGCTGGGGCCGCTGTGCCTGCTGCTGAGCAGCGCCGCGGATTTGAATATAACCTGCCGCTTT
GCAGGTGTATTCCACGTGGAGAAAAATGGTCGCTACAGCATCTCTCGGACGGAGGCCGCTGACCTCTGCAAGGCTTTCAATAGCACCTTG
CCCACAATGGCCCAGATGGAGAAAGCTCTGAGCATCGGATTTGAGACCTGCAGGTATGGGTTCATAGAAGGGCACGTGGTGATTCCCCGG
ATCCACCCCAACTCCATCTGTGCAGCAAACAACACAGGGGTGTACATCCTCACATCCAACACCTCCCAGTATGACACATATTGCTTCAAT
GCTTCAGCTCCACCTGAAGAAGATTGTACATCAGTCACAGACCTGCCCAATGCCTTTGATGGACCAATTACCATAACTATTGTTAACCGT
GATGGCACCCGCTATGTCCAGAAAGGAGAATACAGAACGAATCCTGAAGACATCTACCCCAGCAACCCTACTGATGATGACGTGAGCAGC
GGCTCCTCCAGTGAAAGGAGCAGCACTTCAGGAGGTTACATCTTTTACACCTTTTCTACTGTACACCCCATCCCAGACGAAGACAGTCCC
TGGATCACCGACAGCACAGACAGAATCCCTGCTACCACTTTGATGAGCACTAGTGCTACAGCAACTGAGACAGCAACCAAGAGGCAAGAA
ACCTGGGATTGGTTTTCATGGTTGTTTCTACCATCAGAGTCAAAGAATCATCTTCACACAACAACACAAATGGCTGGTACGTCTTCAAAT
ACCATCTCAGCAGGCTGGGAGCCAAATGAAGAAAATGAAGATGAAAGAGACAGACACCTCAGTTTTTCTGGATCAGGCATTGATGATGAT
GAAGATTTTATCTCCAGCACCATTTCAACCACACCACGGGCTTTTGACCACACAAAACAGAACCAGGACTGGACCCAGTGGAACCCAAGC
CATTCAAATCCGGAAGTGCTACTTCAGACAACCACAAGGATGACTGATGTAGACAGAAATGGCACCACTGCTTATGAAGGAAACTGGAAC
CCAGAAGCACACCCTCCCCTCATTCACCATGAGCATCATGAGGAAGAAGAGACCCCACATTCTACAAGCACAATCCAGGCAACTCCTAGT
AGTACAACGGAAGAAACAGCTACCCAGAAGGAACAGTGGTTTGGCAACAGATGGCATGAGGGATATCGCCAAACACCCAAAGAAGACTCC
CATTCGACAACAGGGACAGCTGCAGCCTCAGCTCATACCAGCCATCCAATGCAAGGAAGGACAACACCAAGCCCAGAGGACAGTTCCTGG
ACTGATTTCTTCAACCCAATCTCACACCCCATGGGACGAGGTCATCAAGCAGGAAGAAGGATGGATATGGACTCCAGTCATAGTATAACG
CTTCAGCCTACTGCAAATCCAAACACAGGTTTGGTGGAAGATTTGGACAGGACAGGACCTCTTTCAATGACAACGCAGCAGAGTAATTCT
CAGAGCTTCTCTACATCACATGAAGGCTTGGAAGAAGATAAAGACCATCCAACAACTTCTACTCTGACATCAAGCAATAGGAATGATGTC
ACAGGTGGAAGAAGAGACCCAAATCATTCTGAAGGCTCAACTACTTTACTGGAAGGTTATACCTCTCATTACCCACACACGAAGGAAAGC
AGGACCTTCATCCCAGTGACCTCAGCTAAGACTGGGTCCTTTGGAGTTACTGCAGTTACTGTTGGAGATTCCAACTCTAATGTCAATCGT
TCCTTATCAGGAGACCAAGACACATTCCACCCCAGTGGGGGGTCCCATACCACTCATGGATCTGAATCAGATGGACACTCACATGGGAGT
CAAGAAGGTGGAGCAAACACAACCTCTGGTCCTATAAGGACACCCCAAATTCCAGAATGGCTGATCATCTTGGCATCCCTCTTGGCCTTG
GCTTTGATTCTTGCAGTTTGCATTGCAGTCAACAGTCGAAGAAGGTGTGGGCAGAAGAAAAAGCTAGTGATCAACAGTGGCAATGGAGCT
GTGGAGGACAGAAAGCCAAGTGGACTCAACGGAGAGGCCAGCAAGTCTCAGGAAATGGTGCATTTGGTGAACAAGGAGTCGTCAGAAACT
CCAGACCAGTTTATGACAGCTGATGAGACAAGGAACCTGCAGAATGTGGACATGAAGATTGGGGTGTAACACCTACACCATTATCTTGGA
AAGAAACAACCGTTGGAAACATAACCATTACAGGGAGCTGGGACACTTAACAGATGCAATGTGCTACTGATTGTTTCATTGCGAATCTTT
TTTAGCATAAAATTTTCTACTCTTTTTGTTTTTTGTGTTTTGTTCTTTAAAGTCAGGTCCAATTTGTAAAAACAGCATTGCTTTCTGAAA
TTAGGGCCCAATTAATAATCAGCAAGAATTTGATCGTTCCAGTTCCCACTTGGAGGCCTTTCATCCCTCGGGTGTGCTATGGATGGCTTC
TAACAAAAACTACACATATGTATTCCTGATCGCCAACCTTTCCCCCACCAGCTAAGGACATTTCCCAGGGTTAATAGGGCCTGGTCCCTG
GGAGGAAATTTGAATGGGTCCATTTTGCCCTTCCATAGCCTAATCCCTGGGCATTGCTTTCCACTGAGGTTGGGGGTTGGGGTGTACTAG
TTACACATCTTCAACAGACCCCCTCTAGAAATTTTTCAGATGCTTCTGGGAGACACCCAAAGGGTGAAGCTATTTATCTGTAGTAAACTA
TTTATCTGTGTTTTTGAAATATTAAACCCTGGATCAGTCCTTTGATCAGTATAATTTTTTAAAGTTACTTTGTCAGAGGCACAAAAGGGT

>In-frame_LDLRAD3_ENST00000315571_chr11_35965694_+_CD44_ENST00000526669_chr11_35198122_+_748nt
AGCGGGAGCGGCGGCCGCGCCATGTGGCTGCTGGGGCCGCTGTGCCTGCTGCTGAGCAGCGCCGCGGATTTGAATATAACCTGCCGCTTT
GCAGGTGTATTCCACGTGGAGAAAAATGGTCGCTACAGCATCTCTCGGACGGAGGCCGCTGACCTCTGCAAGGCTTTCAATAGCACCTTG
CCCACAATGGCCCAGATGGAGAAAGCTCTGAGCATCGGATTTGAGACCTGCAGGTATGGGTTCATAGAAGGGCACGTGGTGATTCCCCGG
ATCCACCCCAACTCCATCTGTGGAGCAAACACAACCTCTGGTCCTATAAGGACACCCCAAATTCCAGAATGGCTGATCATCTTGGCATCC
CTCTTGGCCTTGGCTTTGATTCTTGCAGTTTGCATTGCAGTCAACAGTCGAAGAAGGTGTGGGCAGAAGAAAAAGCTAGTGATCAACAGT
GGCAATGGAGCTGTGGAGGACAGAAAGCCAAGTGGACTCAACGGAGAGGCCAGCAAGTCTCAGGAAATGGTGCATTTGGTGAACAAGGAG
TCGTCAGAAACTCCAGACCAGTTTATGACAGCTGATGAGACAAGGAACCTGCAGAATGTGGACATGAAGATTGGGGTGTAACACCTACAC
CATTATCTTGGAAAGAAACAACCGTTGGAAACATAACCATTACAGGGAGCTGGGACACTTAACAGATGCAATGTGCTACTGATTGTTTCA

>In-frame_LDLRAD3_ENST00000315571_chr11_35965694_+_CD44_ENST00000433892_chr11_35198122_+_2176nt
AGCGGGAGCGGCGGCCGCGCCATGTGGCTGCTGGGGCCGCTGTGCCTGCTGCTGAGCAGCGCCGCGGATTTGAATATAACCTGCCGCTTT
GCAGGTGTATTCCACGTGGAGAAAAATGGTCGCTACAGCATCTCTCGGACGGAGGCCGCTGACCTCTGCAAGGCTTTCAATAGCACCTTG
CCCACAATGGCCCAGATGGAGAAAGCTCTGAGCATCGGATTTGAGACCTGCAGGTATGGGTTCATAGAAGGGCACGTGGTGATTCCCCGG
ATCCACCCCAACTCCATCTGTGCAGCAAACAACACAGGGGTGTACATCCTCACATCCAACACCTCCCAGTATGACACATATTGCTTCAAT
GCTTCAGCTCCACCTGAAGAAGATTGTACATCAGTCACAGACCTGCCCAATGCCTTTGATGGACCAATTACCATAACTATTGTTAACCGT
GATGGCACCCGCTATGTCCAGAAAGGAGAATACAGAACGAATCCTGAAGACATCTACCCCAGCAACCCTACTGATGATGACGTGAGCAGC
GGCTCCTCCAGTGAAAGGAGCAGCACTTCAGGAGGTTACATCTTTTACACCTTTTCTACTGTACACCCCATCCCAGACGAAGACAGTCCC
TGGATCACCGACAGCACAGACAGAATCCCTGCTACCAATATGGACTCCAGTCATAGTATAACGCTTCAGCCTACTGCAAATCCAAACACA
GGTTTGGTGGAAGATTTGGACAGGACAGGACCTCTTTCAATGACAACGCAGCAGAGTAATTCTCAGAGCTTCTCTACATCACATGAAGGC
TTGGAAGAAGATAAAGACCATCCAACAACTTCTACTCTGACATCAAGCAATAGGAATGATGTCACAGGTGGAAGAAGAGACCCAAATCAT
TCTGAAGGCTCAACTACTTTACTGGAAGGTTATACCTCTCATTACCCACACACGAAGGAAAGCAGGACCTTCATCCCAGTGACCTCAGCT
AAGACTGGGTCCTTTGGAGTTACTGCAGTTACTGTTGGAGATTCCAACTCTAATGTCAATCGTTCCTTATCAGGAGACCAAGACACATTC
CACCCCAGTGGGGGGTCCCATACCACTCATGGATCTGAATCAGATGGACACTCACATGGGAGTCAAGAAGGTGGAGCAAACACAACCTCT
GGTCCTATAAGGACACCCCAAATTCCAGAATGGCTGATCATCTTGGCATCCCTCTTGGCCTTGGCTTTGATTCTTGCAGTTTGCATTGCA
GTCAACAGTCGAAGAAGGTGTGGGCAGAAGAAAAAGCTAGTGATCAACAGTGGCAATGGAGCTGTGGAGGACAGAAAGCCAAGTGGACTC
AACGGAGAGGCCAGCAAGTCTCAGGAAATGGTGCATTTGGTGAACAAGGAGTCGTCAGAAACTCCAGACCAGTTTATGACAGCTGATGAG
ACAAGGAACCTGCAGAATGTGGACATGAAGATTGGGGTGTAACACCTACACCATTATCTTGGAAAGAAACAACCGTTGGAAACATAACCA
TTACAGGGAGCTGGGACACTTAACAGATGCAATGTGCTACTGATTGTTTCATTGCGAATCTTTTTTAGCATAAAATTTTCTACTCTTTTT
GTTTTTTGTGTTTTGTTCTTTAAAGTCAGGTCCAATTTGTAAAAACAGCATTGCTTTCTGAAATTAGGGCCCAATTAATAATCAGCAAGA
ATTTGATCGTTCCAGTTCCCACTTGGAGGCCTTTCATCCCTCGGGTGTGCTATGGATGGCTTCTAACAAAAACTACACATATGTATTCCT
GATCGCCAACCTTTCCCCCACCAGCTAAGGACATTTCCCAGGGTTAATAGGGCCTGGTCCCTGGGAGGAAATTTGAATGGGTCCATTTTG
CCCTTCCATAGCCTAATCCCTGGGCATTGCTTTCCACTGAGGTTGGGGGTTGGGGTGTACTAGTTACACATCTTCAACAGACCCCCTCTA
GAAATTTTTCAGATGCTTCTGGGAGACACCCAAAGGGTGAAGCTATTTATCTGTAGTAAACTATTTATCTGTGTTTTTGAAATATTAAAC
CCTGGATCAGTCCTTTGATCAGTATAATTTTTTAAAGTTACTTTGTCAGAGGCACAAAAGGGTTTAAACTGATTCATAATAAATATCTGT

>In-frame_LDLRAD3_ENST00000315571_chr11_35965694_+_CD44_ENST00000278386_chr11_35198122_+_466nt
AGCGGGAGCGGCGGCCGCGCCATGTGGCTGCTGGGGCCGCTGTGCCTGCTGCTGAGCAGCGCCGCGGATTTGAATATAACCTGCCGCTTT
GCAGGTGTATTCCACGTGGAGAAAAATGGTCGCTACAGCATCTCTCGGACGGAGGCCGCTGACCTCTGCAAGGCTTTCAATAGCACCTTG
CCCACAATGGCCCAGATGGAGAAAGCTCTGAGCATCGGATTTGAGACCTGCAGTTTGCATTGCAGTCAACAGTCGAAGAAGGTGTGGGCA
GAAGAAAAAGCTAGTGATCAACAGTGGCAATGGAGCTGTGGAGGACAGAAAGCCAAGTGGACTCAACGGAGAGGCCAGCAAGTCTCAGGA
AATGGTGCATTTGGTGAACAAGGAGTCGTCAGAAACTCCAGACCAGTTTATGACAGCTGATGAGACAAGGAACCTGCAGAATGTGGACAT

>In-frame_LDLRAD3_ENST00000315571_chr11_35965694_+_CD44_ENST00000434472_chr11_35198122_+_1623nt
AGCGGGAGCGGCGGCCGCGCCATGTGGCTGCTGGGGCCGCTGTGCCTGCTGCTGAGCAGCGCCGCGGATTTGAATATAACCTGCCGCTTT
GCAGGTGTATTCCACGTGGAGAAAAATGGTCGCTACAGCATCTCTCGGACGGAGGCCGCTGACCTCTGCAAGGCTTTCAATAGCACCTTG
CCCACAATGGCCCAGATGGAGAAAGCTCTGAGCATCGGATTTGAGACCTGCAGGTATGGGTTCATAGAAGGGCACGTGGTGATTCCCCGG
ATCCACCCCAACTCCATCTGTGCAGCAAACAACACAGGGGTGTACATCCTCACATCCAACACCTCCCAGTATGACACATATTGCTTCAAT
GCTTCAGCTCCACCTGAAGAAGATTGTACATCAGTCACAGACCTGCCCAATGCCTTTGATGGACCAATTACCATAACTATTGTTAACCGT
GATGGCACCCGCTATGTCCAGAAAGGAGAATACAGAACGAATCCTGAAGACATCTACCCCAGCAACCCTACTGATGATGACGTGAGCAGC
GGCTCCTCCAGTGAAAGGAGCAGCACTTCAGGAGGTTACATCTTTTACACCTTTTCTACTGTACACCCCATCCCAGACGAAGACAGTCCC
TGGATCACCGACAGCACAGACAGAATCCCTGCTACCAATAGGAATGATGTCACAGGTGGAAGAAGAGACCCAAATCATTCTGAAGGCTCA
ACTACTTTACTGGAAGGTTATACCTCTCATTACCCACACACGAAGGAAAGCAGGACCTTCATCCCAGTGACCTCAGCTAAGACTGGGTCC
TTTGGAGTTACTGCAGTTACTGTTGGAGATTCCAACTCTAATGTCAATCGTTCCTTATCAGGAGACCAAGACACATTCCACCCCAGTGGG
GGGTCCCATACCACTCATGGATCTGAATCAGATGGACACTCACATGGGAGTCAAGAAGGTGGAGCAAACACAACCTCTGGTCCTATAAGG
ACACCCCAAATTCCAGAATGGCTGATCATCTTGGCATCCCTCTTGGCCTTGGCTTTGATTCTTGCAGTTTGCATTGCAGTCAACAGTCGA
AGAAGGTGTGGGCAGAAGAAAAAGCTAGTGATCAACAGTGGCAATGGAGCTGTGGAGGACAGAAAGCCAAGTGGACTCAACGGAGAGGCC
AGCAAGTCTCAGGAAATGGTGCATTTGGTGAACAAGGAGTCGTCAGAAACTCCAGACCAGTTTATGACAGCTGATGAGACAAGGAACCTG
CAGAATGTGGACATGAAGATTGGGGTGTAACACCTACACCATTATCTTGGAAAGAAACAACCGTTGGAAACATAACCATTACAGGGAGCT
GGGACACTTAACAGATGCAATGTGCTACTGATTGTTTCATTGCGAATCTTTTTTAGCATAAAATTTTCTACTCTTTTTGTTTTTTGTGTT
TTGTTCTTTAAAGTCAGGTCCAATTTGTAAAAACAGCATTGCTTTCTGAAATTAGGGCCCAATTAATAATCAGCAAGAATTTGATCGTTC
CAGTTCCCACTTGGAGGCCTTTCATCCCTCGGGTGTGCTATGGATGGCTTCTAACAAAAACTACACATATGTATTCCTGATCGCCAACCT

>In-frame_LDLRAD3_ENST00000315571_chr11_35965694_+_CD44_ENST00000352818_chr11_35198122_+_1023nt
AGCGGGAGCGGCGGCCGCGCCATGTGGCTGCTGGGGCCGCTGTGCCTGCTGCTGAGCAGCGCCGCGGATTTGAATATAACCTGCCGCTTT
GCAGGTGTATTCCACGTGGAGAAAAATGGTCGCTACAGCATCTCTCGGACGGAGGCCGCTGACCTCTGCAAGGCTTTCAATAGCACCTTG
CCCACAATGGCCCAGATGGAGAAAGCTCTGAGCATCGGATTTGAGACCTGCAGGTATGGGTTCATAGAAGGGCACGTGGTGATTCCCCGG
ATCCACCCCAACTCCATCTGTGCAGCAAACAACACAGGGGTGTACATCCTCACATCCAACACCTCCCAGTATGACACATATTGCTTCAAT
GCTTCAGCTCCACCTGAAGAAGATTGTACATCAGTCACAGACCTGCCCAATGCCTTTGATGGACCAATTACCATAACTATTGTTAACCGT
GATGGCACCCGCTATGTCCAGAAAGGAGAATACAGAACGAATCCTGAAGACATCTACCCCAGCAACCCTACTGATGATGACGTGAGCAGC
GGCTCCTCCAGTGAAAGGAGCAGCACTTCAGGAGGTTACATCTTTTACACCTTTTCTACTGTACACCCCATCCCAGACGAAGACAGTCCC
TGGATCACCGACAGCACAGACAGAATCCCTGCTACCAGACACTCACATGGGAGTCAAGAAGGTGGAGCAAACACAACCTCTGGTCCTATA
AGGACACCCCAAATTCCAGAATGGCTGATCATCTTGGCATCCCTCTTGGCCTTGGCTTTGATTCTTGCAGTTTGCATTGCAGTCAACAGT
CGAAGAAGGTGTGGGCAGAAGAAAAAGCTAGTGATCAACAGTGGCAATGGAGCTGTGGAGGACAGAAAGCCAAGTGGACTCAACGGAGAG
GCCAGCAAGTCTCAGGAAATGGTGCATTTGGTGAACAAGGAGTCGTCAGAAACTCCAGACCAGTTTATGACAGCTGATGAGACAAGGAAC


Top

FusionGenePPI for LDLRAD3_CD44


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
LDLRAD3ELAVL1, NXF1, ITCHCD44ARHGEF1, COL14A1, LCK, IGFBP3, MMP7, ERBB4, TIAM1, TGFBR1, VAV2, FN1, EGFR, ERBB2, HBEGF, EZR, VCAN, SRC, PTPRC, FYN, MSN, NF2, ELAVL1, PRKCZ, ITGB1, FLOT2, CAV1, EP300, STAT3, SLC3A2, IQGAP1, FMNL1, ATF2, ANK1, VHL, BAG1, DPP8, ABCE1, AIM1, DBN1, FLNA, MYH9, DYNLL1, SYNPO, LIMA1, MYO19, SQSTM1, CHERP, PHRF1, CDC73, CD44, FGFR1, CTDSPL, GMEB2, FGF2, GMEB1, DHRS2, METTL8, FAM115C, SLC39A9, AMPD2, SNX33, CAMKV, ATG9A, PRDM10, C17orf80, SNX18, FGFR2, FGFRL1, VANGL1, PARP2, TEFM, LAMA3, MTCH2, HADHB, CLCN7, XAB2, GTF3C2, CDC40, GTF3C3, AQR, GTF3C1, GTF3C6, HADHA, TMEM160, OSBPL8, CDC5L, TNPO2, PRKCI, LEMD3, LGALS1, RBM22, VANGL2, MBOAT7, ISY1, GBAS, TRIM25, CD74


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for LDLRAD3_CD44


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
TgeneCD44P16070DB08818Hyaluronic acidCD44 antigensmall moleculeapproved|vet_approved

Top

RelatedDiseases for LDLRAD3_CD44


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneLDLRAD3C0236969Substance-Related Disorders1CTD_human
TgeneCD44C0023487Acute Promyelocytic Leukemia2CTD_human
TgeneCD44C0011616Contact Dermatitis1CTD_human
TgeneCD44C0017661IGA Glomerulonephritis1CTD_human
TgeneCD44C0023467Leukemia, Myelocytic, Acute1CTD_human
TgeneCD44C0024668Mammary Neoplasms, Experimental1CTD_human
TgeneCD44C0027627Neoplasm Metastasis1CTD_human
TgeneCD44C0027746Nerve Degeneration1CTD_human
TgeneCD44C0030297Pancreatic Neoplasm1CTD_human
TgeneCD44C0037274Dermatologic disorders1CTD_human
TgeneCD44C0038356Stomach Neoplasms1CTD_human
TgeneCD44C0042900Vitiligo1CTD_human
TgeneCD44C0311375Arsenic Poisoning1CTD_human
TgeneCD44C2609414Acute kidney injury1CTD_human