FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 19557

FusionGeneSummary for LDHB_CTNNA2

check button Fusion gene summary
Fusion gene informationFusion gene name: LDHB_CTNNA2
Fusion gene ID: 19557
HgeneTgene
Gene symbol

LDHB

CTNNA2

Gene ID

3945

1496

Gene namelactate dehydrogenase Bcatenin alpha 2
SynonymsHEL-S-281|LDH-B|LDH-H|LDHBD|TRG-5CAP-R|CAPR|CT114|CTNR
Cytomap

12p12.1

2p12

Type of geneprotein-codingprotein-coding
DescriptionL-lactate dehydrogenase B chainLDH heart subunitepididymis secretory protein Li 281lactate dehydrogenase H chainrenal carcinoma antigen NY-REN-46testicular secretory protein Li 25catenin alpha-2alpha-N-cateninalpha-catenin-related proteincadherin-associated protein, relatedcancer/testis antigen 114catenin (cadherin-associated protein), alpha 2
Modification date2018052220180522
UniProtAcc

P07195

P26232

Ensembl transtripts involved in fusion geneENST00000535112, ENST00000396076, 
ENST00000350669, 
ENST00000466387, 
ENST00000496558, ENST00000361291, 
ENST00000402739, ENST00000540488, 
ENST00000541047, ENST00000343114, 
ENST00000496251, ENST00000409266, 
Fusion gene scores* DoF score6 X 4 X 5=12015 X 12 X 9=1620
# samples 615
** MAII scorelog2(6/120*10)=-1
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(15/1620*10)=-3.43295940727611
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: LDHB [Title/Abstract] AND CTNNA2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVUCECTCGA-AJ-A3QS-01ALDHBchr12

21790005

-CTNNA2chr2

80620336

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
intron-3CDSENST00000535112ENST00000466387LDHBchr12

21790005

-CTNNA2chr2

80620336

+
intron-3CDSENST00000535112ENST00000496558LDHBchr12

21790005

-CTNNA2chr2

80620336

+
intron-3CDSENST00000535112ENST00000361291LDHBchr12

21790005

-CTNNA2chr2

80620336

+
intron-3CDSENST00000535112ENST00000402739LDHBchr12

21790005

-CTNNA2chr2

80620336

+
intron-3CDSENST00000535112ENST00000540488LDHBchr12

21790005

-CTNNA2chr2

80620336

+
intron-3CDSENST00000535112ENST00000541047LDHBchr12

21790005

-CTNNA2chr2

80620336

+
intron-3CDSENST00000535112ENST00000343114LDHBchr12

21790005

-CTNNA2chr2

80620336

+
intron-intronENST00000535112ENST00000496251LDHBchr12

21790005

-CTNNA2chr2

80620336

+
intron-intronENST00000535112ENST00000409266LDHBchr12

21790005

-CTNNA2chr2

80620336

+
In-frameENST00000396076ENST00000466387LDHBchr12

21790005

-CTNNA2chr2

80620336

+
In-frameENST00000396076ENST00000496558LDHBchr12

21790005

-CTNNA2chr2

80620336

+
In-frameENST00000396076ENST00000361291LDHBchr12

21790005

-CTNNA2chr2

80620336

+
In-frameENST00000396076ENST00000402739LDHBchr12

21790005

-CTNNA2chr2

80620336

+
In-frameENST00000396076ENST00000540488LDHBchr12

21790005

-CTNNA2chr2

80620336

+
In-frameENST00000396076ENST00000541047LDHBchr12

21790005

-CTNNA2chr2

80620336

+
In-frameENST00000396076ENST00000343114LDHBchr12

21790005

-CTNNA2chr2

80620336

+
5CDS-intronENST00000396076ENST00000496251LDHBchr12

21790005

-CTNNA2chr2

80620336

+
5CDS-intronENST00000396076ENST00000409266LDHBchr12

21790005

-CTNNA2chr2

80620336

+
Frame-shitENST00000350669ENST00000466387LDHBchr12

21790005

-CTNNA2chr2

80620336

+
Frame-shitENST00000350669ENST00000496558LDHBchr12

21790005

-CTNNA2chr2

80620336

+
Frame-shitENST00000350669ENST00000361291LDHBchr12

21790005

-CTNNA2chr2

80620336

+
Frame-shitENST00000350669ENST00000402739LDHBchr12

21790005

-CTNNA2chr2

80620336

+
Frame-shitENST00000350669ENST00000540488LDHBchr12

21790005

-CTNNA2chr2

80620336

+
Frame-shitENST00000350669ENST00000541047LDHBchr12

21790005

-CTNNA2chr2

80620336

+
Frame-shitENST00000350669ENST00000343114LDHBchr12

21790005

-CTNNA2chr2

80620336

+
5CDS-intronENST00000350669ENST00000496251LDHBchr12

21790005

-CTNNA2chr2

80620336

+
5CDS-intronENST00000350669ENST00000409266LDHBchr12

21790005

-CTNNA2chr2

80620336

+

Top

FusionProtFeatures for LDHB_CTNNA2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
LDHB

P07195

CTNNA2

P26232


check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for LDHB_CTNNA2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_LDHB_ENST00000396076_chr12_21790005_-_CTNNA2_ENST00000466387_chr2_80620336_+_554aa
TGRKEKGDPLNIAIDKMTKKTRDLRRQLRKAVMDHISDSFLETNVPLLVLIEAAKSGNEKEVKETAQVFREHANKLVEVANLACSISNNE
EGVKLVRMAATQIDSLCPQVINAALTLAARPQSKVAQDNMDVFKDQWEKQVRVLTEAVDDITSVDDFLSVSENHILEDVNKCVIALQEGD
VDTLDRTAGAIRGRAARVIHIINAEMENTEAGVTTEKVLEATKLLSETVMPRFAEQVEVAIEALSANVPQPFEENEFIDASRLVTDGVRD
IRKAVLMIRTPEELEDDSDFEQEDTDVRSRTSVQTEDDQLIAGQSARAIMAQLPQEEKAKIAEQVEIFHQEKSKLDAEVAKWDDSGNDII
VLAKQMCMIMMEMTDFTRGKGPLKNTSDVINAAKKIAEAGSRMDKLARAVADQCPDSACKQDLLAYLQRIALTCHQLNICSKVKAEVQNL
GGELIVSGLDSATSLIQAAKNLMNAVVLTVKASTVASTKYQKVTGTAAVNSPVVSWKMKAPEKKPLVKREKPEEFQTRVRRGSQKKHISP

>In-frame_LDHB_ENST00000396076_chr12_21790005_-_CTNNA2_ENST00000496558_chr2_80620336_+_554aa
TGRKEKGDPLNIAIDKMTKKTRDLRRQLRKAVMDHISDSFLETNVPLLVLIEAAKSGNEKEVKETAQVFREHANKLVEVANLACSISNNE
EGVKLVRMAATQIDSLCPQVINAALTLAARPQSKVAQDNMDVFKDQWEKQVRVLTEAVDDITSVDDFLSVSENHILEDVNKCVIALQEGD
VDTLDRTAGAIRGRAARVIHIINAEMENTEAGVTTEKVLEATKLLSETVMPRFAEQVEVAIEALSANVPQPFEENEFIDASRLVTDGVRD
IRKAVLMIRTPEELEDDSDFEQEDTDVRSRTSVQTEDDQLIAGQSARAIMAQLPQEEKAKIAEQVEIFHQEKSKLDAEVAKWDDSGNDII
VLAKQMCMIMMEMTDFTRGKGPLKNTSDVINAAKKIAEAGSRMDKLARAVADQCPDSACKQDLLAYLQRIALTCHQLNICSKVKAEVQNL
GGELIVSGLDSATSLIQAAKNLMNAVVLTVKASTVASTKYQKVTGTAAVNSPVVSWKMKAPEKKPLVKREKPEEFQTRVRRGSQKKHISP

>In-frame_LDHB_ENST00000396076_chr12_21790005_-_CTNNA2_ENST00000361291_chr2_80620336_+_554aa
TGRKEKGDPLNIAIDKMTKKTRDLRRQLRKAVMDHISDSFLETNVPLLVLIEAAKSGNEKEVKETAQVFREHANKLVEVANLACSISNNE
EGVKLVRMAATQIDSLCPQVINAALTLAARPQSKVAQDNMDVFKDQWEKQVRVLTEAVDDITSVDDFLSVSENHILEDVNKCVIALQEGD
VDTLDRTAGAIRGRAARVIHIINAEMENTEAGVTTEKVLEATKLLSETVMPRFAEQVEVAIEALSANVPQPFEENEFIDASRLVTDGVRD
IRKAVLMIRTPEELEDDSDFEQEDTDVRSRTSVQTEDDQLIAGQSARAIMAQLPQEEKAKIAEQVEIFHQEKSKLDAEVAKWDDSGNDII
VLAKQMCMIMMEMTDFTRGKGPLKNTSDVINAAKKIAEAGSRMDKLARAVADQCPDSACKQDLLAYLQRIALTCHQLNICSKVKAEVQNL
GGELIVSGLDSATSLIQAAKNLMNAVVLTVKASTVASTKYQKVTGTAAVNSPVVSWKMKAPEKKPLVKREKPEEFQTRVRRGSQKKHISP

>In-frame_LDHB_ENST00000396076_chr12_21790005_-_CTNNA2_ENST00000402739_chr2_80620336_+_602aa
TGRKEKGDPLNIAIDKMTKKTRDLRRQLRKAVMDHISDSFLETNVPLLVLIEAAKSGNEKEVKETAQVFREHANKLVEVANLACSISNNE
EGVKLVRMAATQIDSLCPQVINAALTLAARPQSKVAQDNMDVFKDQWEKQVRVLTEAVDDITSVDDFLSVSENHILEDVNKCVIALQEGD
VDTLDRTAGAIRGRAARVIHIINAEMENTEAGVTTEKVLEATKLLSETVMPRFAEQVEVAIEALSANVPQPFEENEFIDASRLVTDGVRD
IRKAVLMIRTPEELEDDSDFEQEDTDVRSRTSVQTEDDQLIAGQSARAIMAQLPQEEKAKIAEQVEIFHQEKSKLDAEVAKWDDSGNDII
VLAKQMCMIMMEMTDFTRGKGPLKNTSDVINAAKKIAEAGSRMDKLARAVADQCPDSACKQDLLAYLQRIALTCHQLNICSKVKAEVQNL
GGELIVSGTGVQSTFTTFTEVDCDVIDGGRASQLSTHLPTCAEGAPIGSGSSDSSMLDSATSLIQAAKNLMNAVVLTVKASTVASTKYQK

>In-frame_LDHB_ENST00000396076_chr12_21790005_-_CTNNA2_ENST00000540488_chr2_80620336_+_509aa
TGRKEKGDPLNIAIDKMTKKTRDLRRQLRKAVMDHISDSFLETNVPLLVLIEAAKSGNEKEVKETAQVFREHANKLVEVANLACSISNNE
EGVKLVRMAATQIDSLCPQVINAALTLAARPQSKVAQDNMDVFKDQWEKQVRVLTEAVDDITSVDDFLSVSENHILEDVNKCVIALQEGD
VDTLDRTAGAIRGRAARVIHIINAEMENTEAGVTTEKVLEATKLLSETVMPRFAEQVEVAIEALSANVPQPFEENEFIDASRLVTDGVRD
IRKAVLMIRTPEELEDDSDFEQEDTDVRSRTSVQTEDDQLIAGQSARAIMAQLPQEEKAKIAEQVEIFHQEKSKLDAEVAKWDDSGNDII
VLAKQMCMIMMEMTDFTRGKGPLKNTSDVINAAKKIAEAGSRMDKLARAVADQLDSATSLIQAAKNLMNAVVLTVKASTVASTKYQKVTG

>In-frame_LDHB_ENST00000396076_chr12_21790005_-_CTNNA2_ENST00000541047_chr2_80620336_+_554aa
TGRKEKGDPLNIAIDKMTKKTRDLRRQLRKAVMDHISDSFLETNVPLLVLIEAAKSGNEKEVKETAQVFREHANKLVEVANLACSISNNE
EGVKLVRMAATQIDSLCPQVINAALTLAARPQSKVAQDNMDVFKDQWEKQVRVLTEAVDDITSVDDFLSVSENHILEDVNKCVIALQEGD
VDTLDRTAGAIRGRAARVIHIINAEMENTEAGVTTEKVLEATKLLSETVMPRFAEQVEVAIEALSANVPQPFEENEFIDASRLVTDGVRD
IRKAVLMIRTPEELEDDSDFEQEDTDVRSRTSVQTEDDQLIAGQSARAIMAQLPQEEKAKIAEQVEIFHQEKSKLDAEVAKWDDSGNDII
VLAKQMCMIMMEMTDFTRGKGPLKNTSDVINAAKKIAEAGSRMDKLARAVADQCPDSACKQDLLAYLQRIALTCHQLNICSKVKAEVQNL
GGELIVSGLDSATSLIQAAKNLMNAVVLTVKASTVASTKYQKVTGTAAVNSPVVSWKMKAPEKKPLVKREKPEEFQTRVRRGSQKKHISP

>In-frame_LDHB_ENST00000396076_chr12_21790005_-_CTNNA2_ENST00000343114_chr2_80620336_+_554aa
TGRKEKGDPLNIAIDKMTKKTRDLRRQLRKAVMDHISDSFLETNVPLLVLIEAAKSGNEKEVKETAQVFREHANKLVEVANLACSISNNE
EGVKLVRMAATQIDSLCPQVINAALTLAARPQSKVAQDNMDVFKDQWEKQVRVLTEAVDDITSVDDFLSVSENHILEDVNKCVIALQEGD
VDTLDRTAGAIRGRAARVIHIINAEMENTEAGVTTEKVLEATKLLSETVMPRFAEQVEVAIEALSANVPQPFEENEFIDASRLVTDGVRD
IRKAVLMIRTPEELEDDSDFEQEDTDVRSRTSVQTEDDQLIAGQSARAIMAQLPQEEKAKIAEQVEIFHQEKSKLDAEVAKWDDSGNDII
VLAKQMCMIMMEMTDFTRGKGPLKNTSDVINAAKKIAEAGSRMDKLARAVADQCPDSACKQDLLAYLQRIALTCHQLNICSKVKAEVQNL
GGELIVSGLDSATSLIQAAKNLMNAVVLTVKASTVASTKYQKVTGTAAVNSPVVSWKMKAPEKKPLVKREKPEEFQTRVRRGSQKKHISP


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_LDHB_ENST00000396076_chr12_21790005_-_CTNNA2_ENST00000466387_chr2_80620336_+_1662nt
ACTGGAAGGAAAGAAAAAGGAGATCCTCTCAACATTGCGATTGATAAGATGACTAAGAAAACAAGAGATCTAAGGAGACAGCTTCGGAAA
GCAGTGATGGATCACATATCTGACTCTTTCCTGGAAACCAATGTTCCTTTGCTAGTTCTCATTGAGGCTGCAAAGAGCGGAAATGAAAAG
GAAGTGAAAGAATATGCCCAAGTTTTCCGTGAGCATGCCAACAAACTGGTAGAGGTTGCCAATTTGGCCTGTTCCATCTCCAACAATGAA
GAAGGGGTGAAATTAGTTCGGATGGCAGCCACCCAGATTGACAGCCTGTGTCCCCAGGTCATCAATGCCGCTCTGACACTGGCTGCCCGG
CCACAGAGCAAAGTTGCTCAGGATAACATGGACGTCTTCAAAGACCAGTGGGAGAAGCAGGTCCGAGTGTTGACAGAGGCCGTGGATGAC
ATCACCTCAGTGGATGACTTCCTCTCTGTCTCAGAAAATCACATCTTGGAGGATGTGAACAAGTGTGTGATAGCCCTCCAAGAGGGCGAT
GTGGACACTCTGGACCGGACTGCAGGGGCCATCAGGGGCCGGGCAGCTCGAGTCATACACATCATCAATGCTGAGATGGAGAACTATGAA
GCTGGGGTTTATACTGAGAAGGTGTTGGAAGCTACAAAATTGCTTTCTGAAACAGTGATGCCACGCTTCGCTGAACAAGTAGAGGTTGCC
ATTGAAGCCCTGAGTGCCAACGTTCCTCAACCGTTTGAGGAGAATGAGTTCATCGATGCCTCTCGCCTGGTGTATGATGGCGTTCGGGAC
ATCAGAAAGGCTGTGCTGATGATCAGGACCCCAGAAGAACTAGAGGATGATTCTGACTTTGAGCAGGAAGATTATGATGTGCGTAGCAGG
ACAAGTGTTCAGACTGAGGATGACCAGCTCATTGCAGGGCAGAGCGCACGGGCCATCATGGCGCAACTACCGCAGGAGGAGAAGGCAAAA
ATAGCTGAGCAGGTGGAGATATTCCATCAAGAGAAAAGCAAGCTGGATGCAGAAGTGGCCAAATGGGACGACAGCGGCAATGATATCATT
GTACTGGCCAAGCAGATGTGTATGATCATGATGGAAATGACAGACTTCACAAGAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATT
AATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGCTCGTGCTGTGGCTGATCAGTGTCCTGATTCAGCATGTAAG
CAGGATTTATTAGCCTACCTTCAACGAATTGCCTTGTATTGCCATCAGCTTAATATCTGCAGCAAGGTGAAGGCAGAAGTGCAGAATCTG
GGAGGAGAGCTCATTGTGTCAGGGCTGGACAGTGCCACATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTG
AAAGCATCCTATGTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCT
CCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAAACACATTTCGCCT

>In-frame_LDHB_ENST00000396076_chr12_21790005_-_CTNNA2_ENST00000496558_chr2_80620336_+_1662nt
ACTGGAAGGAAAGAAAAAGGAGATCCTCTCAACATTGCGATTGATAAGATGACTAAGAAAACAAGAGATCTAAGGAGACAGCTTCGGAAA
GCAGTGATGGATCACATATCTGACTCTTTCCTGGAAACCAATGTTCCTTTGCTAGTTCTCATTGAGGCTGCAAAGAGCGGAAATGAAAAG
GAAGTGAAAGAATATGCCCAAGTTTTCCGTGAGCATGCCAACAAACTGGTAGAGGTTGCCAATTTGGCCTGTTCCATCTCCAACAATGAA
GAAGGGGTGAAATTAGTTCGGATGGCAGCCACCCAGATTGACAGCCTGTGTCCCCAGGTCATCAATGCCGCTCTGACACTGGCTGCCCGG
CCACAGAGCAAAGTTGCTCAGGATAACATGGACGTCTTCAAAGACCAGTGGGAGAAGCAGGTCCGAGTGTTGACAGAGGCCGTGGATGAC
ATCACCTCAGTGGATGACTTCCTCTCTGTCTCAGAAAATCACATCTTGGAGGATGTGAACAAGTGTGTGATAGCCCTCCAAGAGGGCGAT
GTGGACACTCTGGACCGGACTGCAGGGGCCATCAGGGGCCGGGCAGCTCGAGTCATACACATCATCAATGCTGAGATGGAGAACTATGAA
GCTGGGGTTTATACTGAGAAGGTGTTGGAAGCTACAAAATTGCTTTCTGAAACAGTGATGCCACGCTTCGCTGAACAAGTAGAGGTTGCC
ATTGAAGCCCTGAGTGCCAACGTTCCTCAACCGTTTGAGGAGAATGAGTTCATCGATGCCTCTCGCCTGGTGTATGATGGCGTTCGGGAC
ATCAGAAAGGCTGTGCTGATGATCAGGACCCCAGAAGAACTAGAGGATGATTCTGACTTTGAGCAGGAAGATTATGATGTGCGTAGCAGG
ACAAGTGTTCAGACTGAGGATGACCAGCTCATTGCAGGGCAGAGCGCACGGGCCATCATGGCGCAACTACCGCAGGAGGAGAAGGCAAAA
ATAGCTGAGCAGGTGGAGATATTCCATCAAGAGAAAAGCAAGCTGGATGCAGAAGTGGCCAAATGGGACGACAGCGGCAATGATATCATT
GTACTGGCCAAGCAGATGTGTATGATCATGATGGAAATGACAGACTTCACAAGAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATT
AATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGCTCGTGCTGTGGCTGATCAGTGTCCTGATTCAGCATGTAAG
CAGGATTTATTAGCCTACCTTCAACGAATTGCCTTGTATTGCCATCAGCTTAATATCTGCAGCAAGGTGAAGGCAGAAGTGCAGAATCTG
GGAGGAGAGCTCATTGTGTCAGGGCTGGACAGTGCCACATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTG
AAAGCATCCTATGTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCT
CCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAAACACATTTCGCCT

>In-frame_LDHB_ENST00000396076_chr12_21790005_-_CTNNA2_ENST00000361291_chr2_80620336_+_1662nt
ACTGGAAGGAAAGAAAAAGGAGATCCTCTCAACATTGCGATTGATAAGATGACTAAGAAAACAAGAGATCTAAGGAGACAGCTTCGGAAA
GCAGTGATGGATCACATATCTGACTCTTTCCTGGAAACCAATGTTCCTTTGCTAGTTCTCATTGAGGCTGCAAAGAGCGGAAATGAAAAG
GAAGTGAAAGAATATGCCCAAGTTTTCCGTGAGCATGCCAACAAACTGGTAGAGGTTGCCAATTTGGCCTGTTCCATCTCCAACAATGAA
GAAGGGGTGAAATTAGTTCGGATGGCAGCCACCCAGATTGACAGCCTGTGTCCCCAGGTCATCAATGCCGCTCTGACACTGGCTGCCCGG
CCACAGAGCAAAGTTGCTCAGGATAACATGGACGTCTTCAAAGACCAGTGGGAGAAGCAGGTCCGAGTGTTGACAGAGGCCGTGGATGAC
ATCACCTCAGTGGATGACTTCCTCTCTGTCTCAGAAAATCACATCTTGGAGGATGTGAACAAGTGTGTGATAGCCCTCCAAGAGGGCGAT
GTGGACACTCTGGACCGGACTGCAGGGGCCATCAGGGGCCGGGCAGCTCGAGTCATACACATCATCAATGCTGAGATGGAGAACTATGAA
GCTGGGGTTTATACTGAGAAGGTGTTGGAAGCTACAAAATTGCTTTCTGAAACAGTGATGCCACGCTTCGCTGAACAAGTAGAGGTTGCC
ATTGAAGCCCTGAGTGCCAACGTTCCTCAACCGTTTGAGGAGAATGAGTTCATCGATGCCTCTCGCCTGGTGTATGATGGCGTTCGGGAC
ATCAGAAAGGCTGTGCTGATGATCAGGACCCCAGAAGAACTAGAGGATGATTCTGACTTTGAGCAGGAAGATTATGATGTGCGTAGCAGG
ACAAGTGTTCAGACTGAGGATGACCAGCTCATTGCAGGGCAGAGCGCACGGGCCATCATGGCGCAACTACCGCAGGAGGAGAAGGCAAAA
ATAGCTGAGCAGGTGGAGATATTCCATCAAGAGAAAAGCAAGCTGGATGCAGAAGTGGCCAAATGGGACGACAGCGGCAATGATATCATT
GTACTGGCCAAGCAGATGTGTATGATCATGATGGAAATGACAGACTTCACAAGAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATT
AATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGCTCGTGCTGTGGCTGATCAGTGTCCTGATTCAGCATGTAAG
CAGGATTTATTAGCCTACCTTCAACGAATTGCCTTGTATTGCCATCAGCTTAATATCTGCAGCAAGGTGAAGGCAGAAGTGCAGAATCTG
GGAGGAGAGCTCATTGTGTCAGGGCTGGACAGTGCCACATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTG
AAAGCATCCTATGTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCT
CCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAAACACATTTCGCCT

>In-frame_LDHB_ENST00000396076_chr12_21790005_-_CTNNA2_ENST00000402739_chr2_80620336_+_1806nt
ACTGGAAGGAAAGAAAAAGGAGATCCTCTCAACATTGCGATTGATAAGATGACTAAGAAAACAAGAGATCTAAGGAGACAGCTTCGGAAA
GCAGTGATGGATCACATATCTGACTCTTTCCTGGAAACCAATGTTCCTTTGCTAGTTCTCATTGAGGCTGCAAAGAGCGGAAATGAAAAG
GAAGTGAAAGAATATGCCCAAGTTTTCCGTGAGCATGCCAACAAACTGGTAGAGGTTGCCAATTTGGCCTGTTCCATCTCCAACAATGAA
GAAGGGGTGAAATTAGTTCGGATGGCAGCCACCCAGATTGACAGCCTGTGTCCCCAGGTCATCAATGCCGCTCTGACACTGGCTGCCCGG
CCACAGAGCAAAGTTGCTCAGGATAACATGGACGTCTTCAAAGACCAGTGGGAGAAGCAGGTCCGAGTGTTGACAGAGGCCGTGGATGAC
ATCACCTCAGTGGATGACTTCCTCTCTGTCTCAGAAAATCACATCTTGGAGGATGTGAACAAGTGTGTGATAGCCCTCCAAGAGGGCGAT
GTGGACACTCTGGACCGGACTGCAGGGGCCATCAGGGGCCGGGCAGCTCGAGTCATACACATCATCAATGCTGAGATGGAGAACTATGAA
GCTGGGGTTTATACTGAGAAGGTGTTGGAAGCTACAAAATTGCTTTCTGAAACAGTGATGCCACGCTTCGCTGAACAAGTAGAGGTTGCC
ATTGAAGCCCTGAGTGCCAACGTTCCTCAACCGTTTGAGGAGAATGAGTTCATCGATGCCTCTCGCCTGGTGTATGATGGCGTTCGGGAC
ATCAGAAAGGCTGTGCTGATGATCAGGACCCCAGAAGAACTAGAGGATGATTCTGACTTTGAGCAGGAAGATTATGATGTGCGTAGCAGG
ACAAGTGTTCAGACTGAGGATGACCAGCTCATTGCAGGGCAGAGCGCACGGGCCATCATGGCGCAACTACCGCAGGAGGAGAAGGCAAAA
ATAGCTGAGCAGGTGGAGATATTCCATCAAGAGAAAAGCAAGCTGGATGCAGAAGTGGCCAAATGGGACGACAGCGGCAATGATATCATT
GTACTGGCCAAGCAGATGTGTATGATCATGATGGAAATGACAGACTTCACAAGAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATT
AATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGCTCGTGCTGTGGCTGATCAGTGTCCTGATTCAGCATGTAAG
CAGGATTTATTAGCCTACCTTCAACGAATTGCCTTGTATTGCCATCAGCTTAATATCTGCAGCAAGGTGAAGGCAGAAGTGCAGAATCTG
GGAGGAGAGCTCATTGTGTCAGGGACAGGAGTTCAGAGCACTTTCACTACCTTTTATGAGGTAGATTGTGATGTCATAGATGGGGGCAGG
GCTAGTCAACTTTCTACCCACCTCCCAACCTGTGCTGAGGGAGCTCCGATCGGGAGTGGAAGCAGTGATTCCTCCATGCTGGACAGTGCC
ACATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTGAAAGCATCCTATGTGGCCTCAACCAAATACCAGAAG
GTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCT
GAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAAACACATTTCGCCTGTACAGGCTTTAAGTGAATTCAAAGCAATGGATTCC

>In-frame_LDHB_ENST00000396076_chr12_21790005_-_CTNNA2_ENST00000540488_chr2_80620336_+_1527nt
ACTGGAAGGAAAGAAAAAGGAGATCCTCTCAACATTGCGATTGATAAGATGACTAAGAAAACAAGAGATCTAAGGAGACAGCTTCGGAAA
GCAGTGATGGATCACATATCTGACTCTTTCCTGGAAACCAATGTTCCTTTGCTAGTTCTCATTGAGGCTGCAAAGAGCGGAAATGAAAAG
GAAGTGAAAGAATATGCCCAAGTTTTCCGTGAGCATGCCAACAAACTGGTAGAGGTTGCCAATTTGGCCTGTTCCATCTCCAACAATGAA
GAAGGGGTGAAATTAGTTCGGATGGCAGCCACCCAGATTGACAGCCTGTGTCCCCAGGTCATCAATGCCGCTCTGACACTGGCTGCCCGG
CCACAGAGCAAAGTTGCTCAGGATAACATGGACGTCTTCAAAGACCAGTGGGAGAAGCAGGTCCGAGTGTTGACAGAGGCCGTGGATGAC
ATCACCTCAGTGGATGACTTCCTCTCTGTCTCAGAAAATCACATCTTGGAGGATGTGAACAAGTGTGTGATAGCCCTCCAAGAGGGCGAT
GTGGACACTCTGGACCGGACTGCAGGGGCCATCAGGGGCCGGGCAGCTCGAGTCATACACATCATCAATGCTGAGATGGAGAACTATGAA
GCTGGGGTTTATACTGAGAAGGTGTTGGAAGCTACAAAATTGCTTTCTGAAACAGTGATGCCACGCTTCGCTGAACAAGTAGAGGTTGCC
ATTGAAGCCCTGAGTGCCAACGTTCCTCAACCGTTTGAGGAGAATGAGTTCATCGATGCCTCTCGCCTGGTGTATGATGGCGTTCGGGAC
ATCAGAAAGGCTGTGCTGATGATCAGGACCCCAGAAGAACTAGAGGATGATTCTGACTTTGAGCAGGAAGATTATGATGTGCGTAGCAGG
ACAAGTGTTCAGACTGAGGATGACCAGCTCATTGCAGGGCAGAGCGCACGGGCCATCATGGCGCAACTACCGCAGGAGGAGAAGGCAAAA
ATAGCTGAGCAGGTGGAGATATTCCATCAAGAGAAAAGCAAGCTGGATGCAGAAGTGGCCAAATGGGACGACAGCGGCAATGATATCATT
GTACTGGCCAAGCAGATGTGTATGATCATGATGGAAATGACAGACTTCACAAGAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATT
AATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGCTCGTGCTGTGGCTGATCAGCTGGACAGTGCCACATCGCTT
ATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTGAAAGCATCCTATGTGGCCTCAACCAAATACCAGAAGGTCTATGGG
ACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTC

>In-frame_LDHB_ENST00000396076_chr12_21790005_-_CTNNA2_ENST00000541047_chr2_80620336_+_1662nt
ACTGGAAGGAAAGAAAAAGGAGATCCTCTCAACATTGCGATTGATAAGATGACTAAGAAAACAAGAGATCTAAGGAGACAGCTTCGGAAA
GCAGTGATGGATCACATATCTGACTCTTTCCTGGAAACCAATGTTCCTTTGCTAGTTCTCATTGAGGCTGCAAAGAGCGGAAATGAAAAG
GAAGTGAAAGAATATGCCCAAGTTTTCCGTGAGCATGCCAACAAACTGGTAGAGGTTGCCAATTTGGCCTGTTCCATCTCCAACAATGAA
GAAGGGGTGAAATTAGTTCGGATGGCAGCCACCCAGATTGACAGCCTGTGTCCCCAGGTCATCAATGCCGCTCTGACACTGGCTGCCCGG
CCACAGAGCAAAGTTGCTCAGGATAACATGGACGTCTTCAAAGACCAGTGGGAGAAGCAGGTCCGAGTGTTGACAGAGGCCGTGGATGAC
ATCACCTCAGTGGATGACTTCCTCTCTGTCTCAGAAAATCACATCTTGGAGGATGTGAACAAGTGTGTGATAGCCCTCCAAGAGGGCGAT
GTGGACACTCTGGACCGGACTGCAGGGGCCATCAGGGGCCGGGCAGCTCGAGTCATACACATCATCAATGCTGAGATGGAGAACTATGAA
GCTGGGGTTTATACTGAGAAGGTGTTGGAAGCTACAAAATTGCTTTCTGAAACAGTGATGCCACGCTTCGCTGAACAAGTAGAGGTTGCC
ATTGAAGCCCTGAGTGCCAACGTTCCTCAACCGTTTGAGGAGAATGAGTTCATCGATGCCTCTCGCCTGGTGTATGATGGCGTTCGGGAC
ATCAGAAAGGCTGTGCTGATGATCAGGACCCCAGAAGAACTAGAGGATGATTCTGACTTTGAGCAGGAAGATTATGATGTGCGTAGCAGG
ACAAGTGTTCAGACTGAGGATGACCAGCTCATTGCAGGGCAGAGCGCACGGGCCATCATGGCGCAACTACCGCAGGAGGAGAAGGCAAAA
ATAGCTGAGCAGGTGGAGATATTCCATCAAGAGAAAAGCAAGCTGGATGCAGAAGTGGCCAAATGGGACGACAGCGGCAATGATATCATT
GTACTGGCCAAGCAGATGTGTATGATCATGATGGAAATGACAGACTTCACAAGAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATT
AATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGCTCGTGCTGTGGCTGATCAGTGTCCTGATTCAGCATGTAAG
CAGGATTTATTAGCCTACCTTCAACGAATTGCCTTGTATTGCCATCAGCTTAATATCTGCAGCAAGGTGAAGGCAGAAGTGCAGAATCTG
GGAGGAGAGCTCATTGTGTCAGGGCTGGACAGTGCCACATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTG
AAAGCATCCTATGTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCT
CCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAAACACATTTCGCCT

>In-frame_LDHB_ENST00000396076_chr12_21790005_-_CTNNA2_ENST00000343114_chr2_80620336_+_1662nt
ACTGGAAGGAAAGAAAAAGGAGATCCTCTCAACATTGCGATTGATAAGATGACTAAGAAAACAAGAGATCTAAGGAGACAGCTTCGGAAA
GCAGTGATGGATCACATATCTGACTCTTTCCTGGAAACCAATGTTCCTTTGCTAGTTCTCATTGAGGCTGCAAAGAGCGGAAATGAAAAG
GAAGTGAAAGAATATGCCCAAGTTTTCCGTGAGCATGCCAACAAACTGGTAGAGGTTGCCAATTTGGCCTGTTCCATCTCCAACAATGAA
GAAGGGGTGAAATTAGTTCGGATGGCAGCCACCCAGATTGACAGCCTGTGTCCCCAGGTCATCAATGCCGCTCTGACACTGGCTGCCCGG
CCACAGAGCAAAGTTGCTCAGGATAACATGGACGTCTTCAAAGACCAGTGGGAGAAGCAGGTCCGAGTGTTGACAGAGGCCGTGGATGAC
ATCACCTCAGTGGATGACTTCCTCTCTGTCTCAGAAAATCACATCTTGGAGGATGTGAACAAGTGTGTGATAGCCCTCCAAGAGGGCGAT
GTGGACACTCTGGACCGGACTGCAGGGGCCATCAGGGGCCGGGCAGCTCGAGTCATACACATCATCAATGCTGAGATGGAGAACTATGAA
GCTGGGGTTTATACTGAGAAGGTGTTGGAAGCTACAAAATTGCTTTCTGAAACAGTGATGCCACGCTTCGCTGAACAAGTAGAGGTTGCC
ATTGAAGCCCTGAGTGCCAACGTTCCTCAACCGTTTGAGGAGAATGAGTTCATCGATGCCTCTCGCCTGGTGTATGATGGCGTTCGGGAC
ATCAGAAAGGCTGTGCTGATGATCAGGACCCCAGAAGAACTAGAGGATGATTCTGACTTTGAGCAGGAAGATTATGATGTGCGTAGCAGG
ACAAGTGTTCAGACTGAGGATGACCAGCTCATTGCAGGGCAGAGCGCACGGGCCATCATGGCGCAACTACCGCAGGAGGAGAAGGCAAAA
ATAGCTGAGCAGGTGGAGATATTCCATCAAGAGAAAAGCAAGCTGGATGCAGAAGTGGCCAAATGGGACGACAGCGGCAATGATATCATT
GTACTGGCCAAGCAGATGTGTATGATCATGATGGAAATGACAGACTTCACAAGAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATT
AATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGCTCGTGCTGTGGCTGATCAGTGTCCTGATTCAGCATGTAAG
CAGGATTTATTAGCCTACCTTCAACGAATTGCCTTGTATTGCCATCAGCTTAATATCTGCAGCAAGGTGAAGGCAGAAGTGCAGAATCTG
GGAGGAGAGCTCATTGTGTCAGGGCTGGACAGTGCCACATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTG
AAAGCATCCTATGTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCT
CCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAAACACATTTCGCCT


* Fusion transcript sequences (Full-length transcript).
>In-frame_LDHB_ENST00000396076_chr12_21790005_-_CTNNA2_ENST00000466387_chr2_80620336_+_3739nt
TCCGCACGACTGTTACAGAGGTCTCCAGAGCCTTCTCTCTCCTGGTAGGTTTCGGCTCAGGACCCTGAATCCTGGCCCACAGGCAAGCCT
GATGGGACGTGCGGGGTAGTACTTGTATGGGGAGACGCGGGAAGGAGGAAGAAGCACATCTGTCCTCCGCGGCCTTTAGCTCTGAGCATC
CGGCCGCGGGCCCTGACTTTGCCGCTCAGTTTGGGGCGCAGGGGGGGCCGTGCCCTGGCGGAGGAGCAGAAGGCAGAGGGTAGCAGCTGC
GGCTCAGCGGAGAGACTTGTTGCATTTGCAGCTAAAACCAGGCCCTACTTGTCCTTGTGCAAAATGGCAACTCTTAAGGAAAAACTCATT
GCACCAGTTGCGGAAGAAGAGGCAACAGTTCCAAACAATAAGATCACTGTAGTGGGTGTTGGACAAGTTGGTATGGCGTGTGCTATCAGC
ATTCTGGGAAAGTCTCTGGCTGATGAACTTGCTCTTGTGGATGTTTTGGAAGATAAGCTTAAAGGAGAAATGATGGATCTGCAGCATGGG
AGCTTATTTCTTCAGACACCTAAAATTGTGGCAGATAAAGATTATTCTGTGACTGCCAATTCTAAGATTGTAGTGGTAACTGCAGGAGTC
CGTCAGCAAGAAGGGGAGAGTCGGCTCAATCTGGTGCAGAGAAATGTTAATGTCTTCAAATTCATTATTCCTCAGATCGTCAAGTACAGT
CCTGATTGCATCATAATTGTGGTTTCCAACCCAGTGGACATTCTTACGTATGTTACCTGGAAACTAAGTGGATTACCCAAACACCGCGTG
ATTGGAAGTGGATGTAATCTGGATTCTGCTAGATTTCGCTACCTTATGGCTGAAAAACTTGGCATTCATCCCAGCAGCTGCCATGGATGG
ATTTTGGGGGAACATGGCGACTCAAGTGTGGCTGTGTGGAGTGGTGTGAATGTGGCAGGTGTTTCTCTCCAGGAATTGAATCCAGAAATG
GGAACTGACAATGATAGTGAAAATTGGAAGGAAGTGCATAAGATGGTGGTTGAAAGTGCCTATGAAGTCATCAAGCTAAAAGGATATACC
AACTGGGCTATTGGATTAAGTGTGGCTGATCTTATTGAATCCATGTTGAAAAATCTATCCAGGATTCATCCCGTGTCAACAATGGTAAAG
ACTGGAAGGAAAGAAAAAGGAGATCCTCTCAACATTGCGATTGATAAGATGACTAAGAAAACAAGAGATCTAAGGAGACAGCTTCGGAAA
GCAGTGATGGATCACATATCTGACTCTTTCCTGGAAACCAATGTTCCTTTGCTAGTTCTCATTGAGGCTGCAAAGAGCGGAAATGAAAAG
GAAGTGAAAGAATATGCCCAAGTTTTCCGTGAGCATGCCAACAAACTGGTAGAGGTTGCCAATTTGGCCTGTTCCATCTCCAACAATGAA
GAAGGGGTGAAATTAGTTCGGATGGCAGCCACCCAGATTGACAGCCTGTGTCCCCAGGTCATCAATGCCGCTCTGACACTGGCTGCCCGG
CCACAGAGCAAAGTTGCTCAGGATAACATGGACGTCTTCAAAGACCAGTGGGAGAAGCAGGTCCGAGTGTTGACAGAGGCCGTGGATGAC
ATCACCTCAGTGGATGACTTCCTCTCTGTCTCAGAAAATCACATCTTGGAGGATGTGAACAAGTGTGTGATAGCCCTCCAAGAGGGCGAT
GTGGACACTCTGGACCGGACTGCAGGGGCCATCAGGGGCCGGGCAGCTCGAGTCATACACATCATCAATGCTGAGATGGAGAACTATGAA
GCTGGGGTTTATACTGAGAAGGTGTTGGAAGCTACAAAATTGCTTTCTGAAACAGTGATGCCACGCTTCGCTGAACAAGTAGAGGTTGCC
ATTGAAGCCCTGAGTGCCAACGTTCCTCAACCGTTTGAGGAGAATGAGTTCATCGATGCCTCTCGCCTGGTGTATGATGGCGTTCGGGAC
ATCAGAAAGGCTGTGCTGATGATCAGGACCCCAGAAGAACTAGAGGATGATTCTGACTTTGAGCAGGAAGATTATGATGTGCGTAGCAGG
ACAAGTGTTCAGACTGAGGATGACCAGCTCATTGCAGGGCAGAGCGCACGGGCCATCATGGCGCAACTACCGCAGGAGGAGAAGGCAAAA
ATAGCTGAGCAGGTGGAGATATTCCATCAAGAGAAAAGCAAGCTGGATGCAGAAGTGGCCAAATGGGACGACAGCGGCAATGATATCATT
GTACTGGCCAAGCAGATGTGTATGATCATGATGGAAATGACAGACTTCACAAGAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATT
AATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGCTCGTGCTGTGGCTGATCAGTGTCCTGATTCAGCATGTAAG
CAGGATTTATTAGCCTACCTTCAACGAATTGCCTTGTATTGCCATCAGCTTAATATCTGCAGCAAGGTGAAGGCAGAAGTGCAGAATCTG
GGAGGAGAGCTCATTGTGTCAGGGCTGGACAGTGCCACATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTG
AAAGCATCCTATGTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCT
CCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAAACACATTTCGCCT
GTACAGGCTTTAAGTGAATTCAAAGCAATGGATTCCTTCTAGGACGATAGGTTTTAACAAGAAAGCTTTTTCTTTCTTTTCTTTCTTTCT
TTTTCTTTTTAATTCCATTTTTGTATGCATACCTGCCAGCTCGTATGCCTCTGGCATGGGGAAATTAAGGGAACAGTGTCTGTTTGCATG
TAAGATGAGATGAGATCAATACTACTGATCCATCTGTAGCCTGGGAAGGAGACAGGACATTCCTGTACTAAGGTGGCACAGAGCTGTCCT
TTGCAACATTCTCATAAAATTGGGCACAGAGTTCGCATTGGCGCAATATTTATGGGAGTGGGAGGGATGGGGAAAATAAACTTAACTCTA
CAAAAGCAAACTCTAATGCATGCAAGAATCATTAGGTTGGCAGGTATATGCATAAGTGAAAAATCTGGAAGTGTAATGGTAGAACATAAA
ACTTGTATTGCTTCTGTTTCAGTGCAAAAATGTACTAGCCAATACGCTTAAGTGTGTGGCCCATGAATTGAACAATTTAACCTTGAAGTC
TATATCCGTGATATTATGTCGATTTTTAACTGAGGGGAAATTAACTAGTCCAGCCTAAAATGCTTCTTTTAATCTGCATTCTGTTTCCTC
TTCTAGTTGTGCCATTACTAGTGATCATGTTTTTTTCCCCCCTTTAATGAAAACAATAAACATCTATTTGAGACAATTAAAATCCTTCTG
GGGGCACTGGAAGCACAATACGGTGACCAATCTTGCTTTCATTTTTTTTTCTTTTTAATTTGAACCATGATTTTGCTAGAAATAGAAGGC
CCAGTGGTGGAATATTAGAGGGAAGGAAACTGACAACGTGTGAAAGTTAGAGGCAAATACATAGGTGTAGCTTGGAGTGCTGGTATCTAA

>In-frame_LDHB_ENST00000396076_chr12_21790005_-_CTNNA2_ENST00000496558_chr2_80620336_+_3740nt
TCCGCACGACTGTTACAGAGGTCTCCAGAGCCTTCTCTCTCCTGGTAGGTTTCGGCTCAGGACCCTGAATCCTGGCCCACAGGCAAGCCT
GATGGGACGTGCGGGGTAGTACTTGTATGGGGAGACGCGGGAAGGAGGAAGAAGCACATCTGTCCTCCGCGGCCTTTAGCTCTGAGCATC
CGGCCGCGGGCCCTGACTTTGCCGCTCAGTTTGGGGCGCAGGGGGGGCCGTGCCCTGGCGGAGGAGCAGAAGGCAGAGGGTAGCAGCTGC
GGCTCAGCGGAGAGACTTGTTGCATTTGCAGCTAAAACCAGGCCCTACTTGTCCTTGTGCAAAATGGCAACTCTTAAGGAAAAACTCATT
GCACCAGTTGCGGAAGAAGAGGCAACAGTTCCAAACAATAAGATCACTGTAGTGGGTGTTGGACAAGTTGGTATGGCGTGTGCTATCAGC
ATTCTGGGAAAGTCTCTGGCTGATGAACTTGCTCTTGTGGATGTTTTGGAAGATAAGCTTAAAGGAGAAATGATGGATCTGCAGCATGGG
AGCTTATTTCTTCAGACACCTAAAATTGTGGCAGATAAAGATTATTCTGTGACTGCCAATTCTAAGATTGTAGTGGTAACTGCAGGAGTC
CGTCAGCAAGAAGGGGAGAGTCGGCTCAATCTGGTGCAGAGAAATGTTAATGTCTTCAAATTCATTATTCCTCAGATCGTCAAGTACAGT
CCTGATTGCATCATAATTGTGGTTTCCAACCCAGTGGACATTCTTACGTATGTTACCTGGAAACTAAGTGGATTACCCAAACACCGCGTG
ATTGGAAGTGGATGTAATCTGGATTCTGCTAGATTTCGCTACCTTATGGCTGAAAAACTTGGCATTCATCCCAGCAGCTGCCATGGATGG
ATTTTGGGGGAACATGGCGACTCAAGTGTGGCTGTGTGGAGTGGTGTGAATGTGGCAGGTGTTTCTCTCCAGGAATTGAATCCAGAAATG
GGAACTGACAATGATAGTGAAAATTGGAAGGAAGTGCATAAGATGGTGGTTGAAAGTGCCTATGAAGTCATCAAGCTAAAAGGATATACC
AACTGGGCTATTGGATTAAGTGTGGCTGATCTTATTGAATCCATGTTGAAAAATCTATCCAGGATTCATCCCGTGTCAACAATGGTAAAG
ACTGGAAGGAAAGAAAAAGGAGATCCTCTCAACATTGCGATTGATAAGATGACTAAGAAAACAAGAGATCTAAGGAGACAGCTTCGGAAA
GCAGTGATGGATCACATATCTGACTCTTTCCTGGAAACCAATGTTCCTTTGCTAGTTCTCATTGAGGCTGCAAAGAGCGGAAATGAAAAG
GAAGTGAAAGAATATGCCCAAGTTTTCCGTGAGCATGCCAACAAACTGGTAGAGGTTGCCAATTTGGCCTGTTCCATCTCCAACAATGAA
GAAGGGGTGAAATTAGTTCGGATGGCAGCCACCCAGATTGACAGCCTGTGTCCCCAGGTCATCAATGCCGCTCTGACACTGGCTGCCCGG
CCACAGAGCAAAGTTGCTCAGGATAACATGGACGTCTTCAAAGACCAGTGGGAGAAGCAGGTCCGAGTGTTGACAGAGGCCGTGGATGAC
ATCACCTCAGTGGATGACTTCCTCTCTGTCTCAGAAAATCACATCTTGGAGGATGTGAACAAGTGTGTGATAGCCCTCCAAGAGGGCGAT
GTGGACACTCTGGACCGGACTGCAGGGGCCATCAGGGGCCGGGCAGCTCGAGTCATACACATCATCAATGCTGAGATGGAGAACTATGAA
GCTGGGGTTTATACTGAGAAGGTGTTGGAAGCTACAAAATTGCTTTCTGAAACAGTGATGCCACGCTTCGCTGAACAAGTAGAGGTTGCC
ATTGAAGCCCTGAGTGCCAACGTTCCTCAACCGTTTGAGGAGAATGAGTTCATCGATGCCTCTCGCCTGGTGTATGATGGCGTTCGGGAC
ATCAGAAAGGCTGTGCTGATGATCAGGACCCCAGAAGAACTAGAGGATGATTCTGACTTTGAGCAGGAAGATTATGATGTGCGTAGCAGG
ACAAGTGTTCAGACTGAGGATGACCAGCTCATTGCAGGGCAGAGCGCACGGGCCATCATGGCGCAACTACCGCAGGAGGAGAAGGCAAAA
ATAGCTGAGCAGGTGGAGATATTCCATCAAGAGAAAAGCAAGCTGGATGCAGAAGTGGCCAAATGGGACGACAGCGGCAATGATATCATT
GTACTGGCCAAGCAGATGTGTATGATCATGATGGAAATGACAGACTTCACAAGAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATT
AATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGCTCGTGCTGTGGCTGATCAGTGTCCTGATTCAGCATGTAAG
CAGGATTTATTAGCCTACCTTCAACGAATTGCCTTGTATTGCCATCAGCTTAATATCTGCAGCAAGGTGAAGGCAGAAGTGCAGAATCTG
GGAGGAGAGCTCATTGTGTCAGGGCTGGACAGTGCCACATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTG
AAAGCATCCTATGTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCT
CCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAAACACATTTCGCCT
GTACAGGCTTTAAGTGAATTCAAAGCAATGGATTCCTTCTAGGACGATAGGTTTTAACAAGAAAGCTTTTTCTTTCTTTTCTTTCTTTCT
TTTTCTTTTTAATTCCATTTTTGTATGCATACCTGCCAGCTCGTATGCCTCTGGCATGGGGAAATTAAGGGAACAGTGTCTGTTTGCATG
TAAGATGAGATGAGATCAATACTACTGATCCATCTGTAGCCTGGGAAGGAGACAGGACATTCCTGTACTAAGGTGGCACAGAGCTGTCCT
TTGCAACATTCTCATAAAATTGGGCACAGAGTTCGCATTGGCGCAATATTTATGGGAGTGGGAGGGATGGGGAAAATAAACTTAACTCTA
CAAAAGCAAACTCTAATGCATGCAAGAATCATTAGGTTGGCAGGTATATGCATAAGTGAAAAATCTGGAAGTGTAATGGTAGAACATAAA
ACTTGTATTGCTTCTGTTTCAGTGCAAAAATGTACTAGCCAATACGCTTAAGTGTGTGGCCCATGAATTGAACAATTTAACCTTGAAGTC
TATATCCGTGATATTATGTCGATTTTTAACTGAGGGGAAATTAACTAGTCCAGCCTAAAATGCTTCTTTTAATCTGCATTCTGTTTCCTC
TTCTAGTTGTGCCATTACTAGTGATCATGTTTTTTTCCCCCCTTTAATGAAAACAATAAACATCTATTTGAGACAATTAAAATCCTTCTG
GGGGCACTGGAAGCACAATACGGTGACCAATCTTGCTTTCATTTTTTTTTCTTTTTAATTTGAACCATGATTTTGCTAGAAATAGAAGGC
CCAGTGGTGGAATATTAGAGGGAAGGAAACTGACAACGTGTGAAAGTTAGAGGCAAATACATAGGTGTAGCTTGGAGTGCTGGTATCTAA

>In-frame_LDHB_ENST00000396076_chr12_21790005_-_CTNNA2_ENST00000361291_chr2_80620336_+_2832nt
TCCGCACGACTGTTACAGAGGTCTCCAGAGCCTTCTCTCTCCTGGTAGGTTTCGGCTCAGGACCCTGAATCCTGGCCCACAGGCAAGCCT
GATGGGACGTGCGGGGTAGTACTTGTATGGGGAGACGCGGGAAGGAGGAAGAAGCACATCTGTCCTCCGCGGCCTTTAGCTCTGAGCATC
CGGCCGCGGGCCCTGACTTTGCCGCTCAGTTTGGGGCGCAGGGGGGGCCGTGCCCTGGCGGAGGAGCAGAAGGCAGAGGGTAGCAGCTGC
GGCTCAGCGGAGAGACTTGTTGCATTTGCAGCTAAAACCAGGCCCTACTTGTCCTTGTGCAAAATGGCAACTCTTAAGGAAAAACTCATT
GCACCAGTTGCGGAAGAAGAGGCAACAGTTCCAAACAATAAGATCACTGTAGTGGGTGTTGGACAAGTTGGTATGGCGTGTGCTATCAGC
ATTCTGGGAAAGTCTCTGGCTGATGAACTTGCTCTTGTGGATGTTTTGGAAGATAAGCTTAAAGGAGAAATGATGGATCTGCAGCATGGG
AGCTTATTTCTTCAGACACCTAAAATTGTGGCAGATAAAGATTATTCTGTGACTGCCAATTCTAAGATTGTAGTGGTAACTGCAGGAGTC
CGTCAGCAAGAAGGGGAGAGTCGGCTCAATCTGGTGCAGAGAAATGTTAATGTCTTCAAATTCATTATTCCTCAGATCGTCAAGTACAGT
CCTGATTGCATCATAATTGTGGTTTCCAACCCAGTGGACATTCTTACGTATGTTACCTGGAAACTAAGTGGATTACCCAAACACCGCGTG
ATTGGAAGTGGATGTAATCTGGATTCTGCTAGATTTCGCTACCTTATGGCTGAAAAACTTGGCATTCATCCCAGCAGCTGCCATGGATGG
ATTTTGGGGGAACATGGCGACTCAAGTGTGGCTGTGTGGAGTGGTGTGAATGTGGCAGGTGTTTCTCTCCAGGAATTGAATCCAGAAATG
GGAACTGACAATGATAGTGAAAATTGGAAGGAAGTGCATAAGATGGTGGTTGAAAGTGCCTATGAAGTCATCAAGCTAAAAGGATATACC
AACTGGGCTATTGGATTAAGTGTGGCTGATCTTATTGAATCCATGTTGAAAAATCTATCCAGGATTCATCCCGTGTCAACAATGGTAAAG
ACTGGAAGGAAAGAAAAAGGAGATCCTCTCAACATTGCGATTGATAAGATGACTAAGAAAACAAGAGATCTAAGGAGACAGCTTCGGAAA
GCAGTGATGGATCACATATCTGACTCTTTCCTGGAAACCAATGTTCCTTTGCTAGTTCTCATTGAGGCTGCAAAGAGCGGAAATGAAAAG
GAAGTGAAAGAATATGCCCAAGTTTTCCGTGAGCATGCCAACAAACTGGTAGAGGTTGCCAATTTGGCCTGTTCCATCTCCAACAATGAA
GAAGGGGTGAAATTAGTTCGGATGGCAGCCACCCAGATTGACAGCCTGTGTCCCCAGGTCATCAATGCCGCTCTGACACTGGCTGCCCGG
CCACAGAGCAAAGTTGCTCAGGATAACATGGACGTCTTCAAAGACCAGTGGGAGAAGCAGGTCCGAGTGTTGACAGAGGCCGTGGATGAC
ATCACCTCAGTGGATGACTTCCTCTCTGTCTCAGAAAATCACATCTTGGAGGATGTGAACAAGTGTGTGATAGCCCTCCAAGAGGGCGAT
GTGGACACTCTGGACCGGACTGCAGGGGCCATCAGGGGCCGGGCAGCTCGAGTCATACACATCATCAATGCTGAGATGGAGAACTATGAA
GCTGGGGTTTATACTGAGAAGGTGTTGGAAGCTACAAAATTGCTTTCTGAAACAGTGATGCCACGCTTCGCTGAACAAGTAGAGGTTGCC
ATTGAAGCCCTGAGTGCCAACGTTCCTCAACCGTTTGAGGAGAATGAGTTCATCGATGCCTCTCGCCTGGTGTATGATGGCGTTCGGGAC
ATCAGAAAGGCTGTGCTGATGATCAGGACCCCAGAAGAACTAGAGGATGATTCTGACTTTGAGCAGGAAGATTATGATGTGCGTAGCAGG
ACAAGTGTTCAGACTGAGGATGACCAGCTCATTGCAGGGCAGAGCGCACGGGCCATCATGGCGCAACTACCGCAGGAGGAGAAGGCAAAA
ATAGCTGAGCAGGTGGAGATATTCCATCAAGAGAAAAGCAAGCTGGATGCAGAAGTGGCCAAATGGGACGACAGCGGCAATGATATCATT
GTACTGGCCAAGCAGATGTGTATGATCATGATGGAAATGACAGACTTCACAAGAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATT
AATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGCTCGTGCTGTGGCTGATCAGTGTCCTGATTCAGCATGTAAG
CAGGATTTATTAGCCTACCTTCAACGAATTGCCTTGTATTGCCATCAGCTTAATATCTGCAGCAAGGTGAAGGCAGAAGTGCAGAATCTG
GGAGGAGAGCTCATTGTGTCAGGGCTGGACAGTGCCACATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTG
AAAGCATCCTATGTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCT
CCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAAACACATTTCGCCT

>In-frame_LDHB_ENST00000396076_chr12_21790005_-_CTNNA2_ENST00000402739_chr2_80620336_+_3793nt
TCCGCACGACTGTTACAGAGGTCTCCAGAGCCTTCTCTCTCCTGGTAGGTTTCGGCTCAGGACCCTGAATCCTGGCCCACAGGCAAGCCT
GATGGGACGTGCGGGGTAGTACTTGTATGGGGAGACGCGGGAAGGAGGAAGAAGCACATCTGTCCTCCGCGGCCTTTAGCTCTGAGCATC
CGGCCGCGGGCCCTGACTTTGCCGCTCAGTTTGGGGCGCAGGGGGGGCCGTGCCCTGGCGGAGGAGCAGAAGGCAGAGGGTAGCAGCTGC
GGCTCAGCGGAGAGACTTGTTGCATTTGCAGCTAAAACCAGGCCCTACTTGTCCTTGTGCAAAATGGCAACTCTTAAGGAAAAACTCATT
GCACCAGTTGCGGAAGAAGAGGCAACAGTTCCAAACAATAAGATCACTGTAGTGGGTGTTGGACAAGTTGGTATGGCGTGTGCTATCAGC
ATTCTGGGAAAGTCTCTGGCTGATGAACTTGCTCTTGTGGATGTTTTGGAAGATAAGCTTAAAGGAGAAATGATGGATCTGCAGCATGGG
AGCTTATTTCTTCAGACACCTAAAATTGTGGCAGATAAAGATTATTCTGTGACTGCCAATTCTAAGATTGTAGTGGTAACTGCAGGAGTC
CGTCAGCAAGAAGGGGAGAGTCGGCTCAATCTGGTGCAGAGAAATGTTAATGTCTTCAAATTCATTATTCCTCAGATCGTCAAGTACAGT
CCTGATTGCATCATAATTGTGGTTTCCAACCCAGTGGACATTCTTACGTATGTTACCTGGAAACTAAGTGGATTACCCAAACACCGCGTG
ATTGGAAGTGGATGTAATCTGGATTCTGCTAGATTTCGCTACCTTATGGCTGAAAAACTTGGCATTCATCCCAGCAGCTGCCATGGATGG
ATTTTGGGGGAACATGGCGACTCAAGTGTGGCTGTGTGGAGTGGTGTGAATGTGGCAGGTGTTTCTCTCCAGGAATTGAATCCAGAAATG
GGAACTGACAATGATAGTGAAAATTGGAAGGAAGTGCATAAGATGGTGGTTGAAAGTGCCTATGAAGTCATCAAGCTAAAAGGATATACC
AACTGGGCTATTGGATTAAGTGTGGCTGATCTTATTGAATCCATGTTGAAAAATCTATCCAGGATTCATCCCGTGTCAACAATGGTAAAG
ACTGGAAGGAAAGAAAAAGGAGATCCTCTCAACATTGCGATTGATAAGATGACTAAGAAAACAAGAGATCTAAGGAGACAGCTTCGGAAA
GCAGTGATGGATCACATATCTGACTCTTTCCTGGAAACCAATGTTCCTTTGCTAGTTCTCATTGAGGCTGCAAAGAGCGGAAATGAAAAG
GAAGTGAAAGAATATGCCCAAGTTTTCCGTGAGCATGCCAACAAACTGGTAGAGGTTGCCAATTTGGCCTGTTCCATCTCCAACAATGAA
GAAGGGGTGAAATTAGTTCGGATGGCAGCCACCCAGATTGACAGCCTGTGTCCCCAGGTCATCAATGCCGCTCTGACACTGGCTGCCCGG
CCACAGAGCAAAGTTGCTCAGGATAACATGGACGTCTTCAAAGACCAGTGGGAGAAGCAGGTCCGAGTGTTGACAGAGGCCGTGGATGAC
ATCACCTCAGTGGATGACTTCCTCTCTGTCTCAGAAAATCACATCTTGGAGGATGTGAACAAGTGTGTGATAGCCCTCCAAGAGGGCGAT
GTGGACACTCTGGACCGGACTGCAGGGGCCATCAGGGGCCGGGCAGCTCGAGTCATACACATCATCAATGCTGAGATGGAGAACTATGAA
GCTGGGGTTTATACTGAGAAGGTGTTGGAAGCTACAAAATTGCTTTCTGAAACAGTGATGCCACGCTTCGCTGAACAAGTAGAGGTTGCC
ATTGAAGCCCTGAGTGCCAACGTTCCTCAACCGTTTGAGGAGAATGAGTTCATCGATGCCTCTCGCCTGGTGTATGATGGCGTTCGGGAC
ATCAGAAAGGCTGTGCTGATGATCAGGACCCCAGAAGAACTAGAGGATGATTCTGACTTTGAGCAGGAAGATTATGATGTGCGTAGCAGG
ACAAGTGTTCAGACTGAGGATGACCAGCTCATTGCAGGGCAGAGCGCACGGGCCATCATGGCGCAACTACCGCAGGAGGAGAAGGCAAAA
ATAGCTGAGCAGGTGGAGATATTCCATCAAGAGAAAAGCAAGCTGGATGCAGAAGTGGCCAAATGGGACGACAGCGGCAATGATATCATT
GTACTGGCCAAGCAGATGTGTATGATCATGATGGAAATGACAGACTTCACAAGAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATT
AATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGCTCGTGCTGTGGCTGATCAGTGTCCTGATTCAGCATGTAAG
CAGGATTTATTAGCCTACCTTCAACGAATTGCCTTGTATTGCCATCAGCTTAATATCTGCAGCAAGGTGAAGGCAGAAGTGCAGAATCTG
GGAGGAGAGCTCATTGTGTCAGGGACAGGAGTTCAGAGCACTTTCACTACCTTTTATGAGGTAGATTGTGATGTCATAGATGGGGGCAGG
GCTAGTCAACTTTCTACCCACCTCCCAACCTGTGCTGAGGGAGCTCCGATCGGGAGTGGAAGCAGTGATTCCTCCATGCTGGACAGTGCC
ACATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTGAAAGCATCCTATGTGGCCTCAACCAAATACCAGAAG
GTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCT
GAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAAACACATTTCGCCTGTACAGGCTTTAAGTGAATTCAAAGCAATGGATTCC
TTCTAGGACGATAGGTTTTAACAAGAAAGCTTTTTCTTTCTTTTCTTTCTTTCTTTTTCTTTTTAATTCCATTTTTGTATGCATACCTGC
CAGCTCGTATGCCTCTGGCATGGGGAAATTAAGGGAACAGTGTCTGTTTGCATGTAAGATGAGATGAGATCAATACTACTGATCCATCTG
TAGCCTGGGAAGGAGACAGGACATTCCTGTACTAAGGTGGCACAGAGCTGTCCTTTGCAACATTCTCATAAAATTGGGCACAGAGTTCGC
ATTGGCGCAATATTTATGGGAGTGGGAGGGATGGGGAAAATAAACTTAACTCTACAAAAGCAAACTCTAATGCATGCAAGAATCATTAGG
TTGGCAGGTATATGCATAAGTGAAAAATCTGGAAGTGTAATGGTAGAACATAAAACTTGTATTGCTTCTGTTTCAGTGCAAAAATGTACT
AGCCAATACGCTTAAGTGTGTGGCCCATGAATTGAACAATTTAACCTTGAAGTCTATATCCGTGATATTATGTCGATTTTTAACTGAGGG
GAAATTAACTAGTCCAGCCTAAAATGCTTCTTTTAATCTGCATTCTGTTTCCTCTTCTAGTTGTGCCATTACTAGTGATCATGTTTTTTT
CCCCCCTTTAATGAAAACAATAAACATCTATTTGAGACAATTAAAATCCTTCTGGGGGCACTGGAAGCACAATACGGTGACCAATCTTGC
TTTCATTTTTTTTTCTTTTTAATTTGAACCATGATTTTGCTAGAAATAGAAGGCCCAGTGGTGGAATATTAGAGGGAAGGAAACTGACAA

>In-frame_LDHB_ENST00000396076_chr12_21790005_-_CTNNA2_ENST00000540488_chr2_80620336_+_2697nt
TCCGCACGACTGTTACAGAGGTCTCCAGAGCCTTCTCTCTCCTGGTAGGTTTCGGCTCAGGACCCTGAATCCTGGCCCACAGGCAAGCCT
GATGGGACGTGCGGGGTAGTACTTGTATGGGGAGACGCGGGAAGGAGGAAGAAGCACATCTGTCCTCCGCGGCCTTTAGCTCTGAGCATC
CGGCCGCGGGCCCTGACTTTGCCGCTCAGTTTGGGGCGCAGGGGGGGCCGTGCCCTGGCGGAGGAGCAGAAGGCAGAGGGTAGCAGCTGC
GGCTCAGCGGAGAGACTTGTTGCATTTGCAGCTAAAACCAGGCCCTACTTGTCCTTGTGCAAAATGGCAACTCTTAAGGAAAAACTCATT
GCACCAGTTGCGGAAGAAGAGGCAACAGTTCCAAACAATAAGATCACTGTAGTGGGTGTTGGACAAGTTGGTATGGCGTGTGCTATCAGC
ATTCTGGGAAAGTCTCTGGCTGATGAACTTGCTCTTGTGGATGTTTTGGAAGATAAGCTTAAAGGAGAAATGATGGATCTGCAGCATGGG
AGCTTATTTCTTCAGACACCTAAAATTGTGGCAGATAAAGATTATTCTGTGACTGCCAATTCTAAGATTGTAGTGGTAACTGCAGGAGTC
CGTCAGCAAGAAGGGGAGAGTCGGCTCAATCTGGTGCAGAGAAATGTTAATGTCTTCAAATTCATTATTCCTCAGATCGTCAAGTACAGT
CCTGATTGCATCATAATTGTGGTTTCCAACCCAGTGGACATTCTTACGTATGTTACCTGGAAACTAAGTGGATTACCCAAACACCGCGTG
ATTGGAAGTGGATGTAATCTGGATTCTGCTAGATTTCGCTACCTTATGGCTGAAAAACTTGGCATTCATCCCAGCAGCTGCCATGGATGG
ATTTTGGGGGAACATGGCGACTCAAGTGTGGCTGTGTGGAGTGGTGTGAATGTGGCAGGTGTTTCTCTCCAGGAATTGAATCCAGAAATG
GGAACTGACAATGATAGTGAAAATTGGAAGGAAGTGCATAAGATGGTGGTTGAAAGTGCCTATGAAGTCATCAAGCTAAAAGGATATACC
AACTGGGCTATTGGATTAAGTGTGGCTGATCTTATTGAATCCATGTTGAAAAATCTATCCAGGATTCATCCCGTGTCAACAATGGTAAAG
ACTGGAAGGAAAGAAAAAGGAGATCCTCTCAACATTGCGATTGATAAGATGACTAAGAAAACAAGAGATCTAAGGAGACAGCTTCGGAAA
GCAGTGATGGATCACATATCTGACTCTTTCCTGGAAACCAATGTTCCTTTGCTAGTTCTCATTGAGGCTGCAAAGAGCGGAAATGAAAAG
GAAGTGAAAGAATATGCCCAAGTTTTCCGTGAGCATGCCAACAAACTGGTAGAGGTTGCCAATTTGGCCTGTTCCATCTCCAACAATGAA
GAAGGGGTGAAATTAGTTCGGATGGCAGCCACCCAGATTGACAGCCTGTGTCCCCAGGTCATCAATGCCGCTCTGACACTGGCTGCCCGG
CCACAGAGCAAAGTTGCTCAGGATAACATGGACGTCTTCAAAGACCAGTGGGAGAAGCAGGTCCGAGTGTTGACAGAGGCCGTGGATGAC
ATCACCTCAGTGGATGACTTCCTCTCTGTCTCAGAAAATCACATCTTGGAGGATGTGAACAAGTGTGTGATAGCCCTCCAAGAGGGCGAT
GTGGACACTCTGGACCGGACTGCAGGGGCCATCAGGGGCCGGGCAGCTCGAGTCATACACATCATCAATGCTGAGATGGAGAACTATGAA
GCTGGGGTTTATACTGAGAAGGTGTTGGAAGCTACAAAATTGCTTTCTGAAACAGTGATGCCACGCTTCGCTGAACAAGTAGAGGTTGCC
ATTGAAGCCCTGAGTGCCAACGTTCCTCAACCGTTTGAGGAGAATGAGTTCATCGATGCCTCTCGCCTGGTGTATGATGGCGTTCGGGAC
ATCAGAAAGGCTGTGCTGATGATCAGGACCCCAGAAGAACTAGAGGATGATTCTGACTTTGAGCAGGAAGATTATGATGTGCGTAGCAGG
ACAAGTGTTCAGACTGAGGATGACCAGCTCATTGCAGGGCAGAGCGCACGGGCCATCATGGCGCAACTACCGCAGGAGGAGAAGGCAAAA
ATAGCTGAGCAGGTGGAGATATTCCATCAAGAGAAAAGCAAGCTGGATGCAGAAGTGGCCAAATGGGACGACAGCGGCAATGATATCATT
GTACTGGCCAAGCAGATGTGTATGATCATGATGGAAATGACAGACTTCACAAGAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATT
AATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGCTCGTGCTGTGGCTGATCAGCTGGACAGTGCCACATCGCTT
ATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTGAAAGCATCCTATGTGGCCTCAACCAAATACCAGAAGGTCTATGGG
ACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTC

>In-frame_LDHB_ENST00000396076_chr12_21790005_-_CTNNA2_ENST00000541047_chr2_80620336_+_3739nt
TCCGCACGACTGTTACAGAGGTCTCCAGAGCCTTCTCTCTCCTGGTAGGTTTCGGCTCAGGACCCTGAATCCTGGCCCACAGGCAAGCCT
GATGGGACGTGCGGGGTAGTACTTGTATGGGGAGACGCGGGAAGGAGGAAGAAGCACATCTGTCCTCCGCGGCCTTTAGCTCTGAGCATC
CGGCCGCGGGCCCTGACTTTGCCGCTCAGTTTGGGGCGCAGGGGGGGCCGTGCCCTGGCGGAGGAGCAGAAGGCAGAGGGTAGCAGCTGC
GGCTCAGCGGAGAGACTTGTTGCATTTGCAGCTAAAACCAGGCCCTACTTGTCCTTGTGCAAAATGGCAACTCTTAAGGAAAAACTCATT
GCACCAGTTGCGGAAGAAGAGGCAACAGTTCCAAACAATAAGATCACTGTAGTGGGTGTTGGACAAGTTGGTATGGCGTGTGCTATCAGC
ATTCTGGGAAAGTCTCTGGCTGATGAACTTGCTCTTGTGGATGTTTTGGAAGATAAGCTTAAAGGAGAAATGATGGATCTGCAGCATGGG
AGCTTATTTCTTCAGACACCTAAAATTGTGGCAGATAAAGATTATTCTGTGACTGCCAATTCTAAGATTGTAGTGGTAACTGCAGGAGTC
CGTCAGCAAGAAGGGGAGAGTCGGCTCAATCTGGTGCAGAGAAATGTTAATGTCTTCAAATTCATTATTCCTCAGATCGTCAAGTACAGT
CCTGATTGCATCATAATTGTGGTTTCCAACCCAGTGGACATTCTTACGTATGTTACCTGGAAACTAAGTGGATTACCCAAACACCGCGTG
ATTGGAAGTGGATGTAATCTGGATTCTGCTAGATTTCGCTACCTTATGGCTGAAAAACTTGGCATTCATCCCAGCAGCTGCCATGGATGG
ATTTTGGGGGAACATGGCGACTCAAGTGTGGCTGTGTGGAGTGGTGTGAATGTGGCAGGTGTTTCTCTCCAGGAATTGAATCCAGAAATG
GGAACTGACAATGATAGTGAAAATTGGAAGGAAGTGCATAAGATGGTGGTTGAAAGTGCCTATGAAGTCATCAAGCTAAAAGGATATACC
AACTGGGCTATTGGATTAAGTGTGGCTGATCTTATTGAATCCATGTTGAAAAATCTATCCAGGATTCATCCCGTGTCAACAATGGTAAAG
ACTGGAAGGAAAGAAAAAGGAGATCCTCTCAACATTGCGATTGATAAGATGACTAAGAAAACAAGAGATCTAAGGAGACAGCTTCGGAAA
GCAGTGATGGATCACATATCTGACTCTTTCCTGGAAACCAATGTTCCTTTGCTAGTTCTCATTGAGGCTGCAAAGAGCGGAAATGAAAAG
GAAGTGAAAGAATATGCCCAAGTTTTCCGTGAGCATGCCAACAAACTGGTAGAGGTTGCCAATTTGGCCTGTTCCATCTCCAACAATGAA
GAAGGGGTGAAATTAGTTCGGATGGCAGCCACCCAGATTGACAGCCTGTGTCCCCAGGTCATCAATGCCGCTCTGACACTGGCTGCCCGG
CCACAGAGCAAAGTTGCTCAGGATAACATGGACGTCTTCAAAGACCAGTGGGAGAAGCAGGTCCGAGTGTTGACAGAGGCCGTGGATGAC
ATCACCTCAGTGGATGACTTCCTCTCTGTCTCAGAAAATCACATCTTGGAGGATGTGAACAAGTGTGTGATAGCCCTCCAAGAGGGCGAT
GTGGACACTCTGGACCGGACTGCAGGGGCCATCAGGGGCCGGGCAGCTCGAGTCATACACATCATCAATGCTGAGATGGAGAACTATGAA
GCTGGGGTTTATACTGAGAAGGTGTTGGAAGCTACAAAATTGCTTTCTGAAACAGTGATGCCACGCTTCGCTGAACAAGTAGAGGTTGCC
ATTGAAGCCCTGAGTGCCAACGTTCCTCAACCGTTTGAGGAGAATGAGTTCATCGATGCCTCTCGCCTGGTGTATGATGGCGTTCGGGAC
ATCAGAAAGGCTGTGCTGATGATCAGGACCCCAGAAGAACTAGAGGATGATTCTGACTTTGAGCAGGAAGATTATGATGTGCGTAGCAGG
ACAAGTGTTCAGACTGAGGATGACCAGCTCATTGCAGGGCAGAGCGCACGGGCCATCATGGCGCAACTACCGCAGGAGGAGAAGGCAAAA
ATAGCTGAGCAGGTGGAGATATTCCATCAAGAGAAAAGCAAGCTGGATGCAGAAGTGGCCAAATGGGACGACAGCGGCAATGATATCATT
GTACTGGCCAAGCAGATGTGTATGATCATGATGGAAATGACAGACTTCACAAGAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATT
AATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGCTCGTGCTGTGGCTGATCAGTGTCCTGATTCAGCATGTAAG
CAGGATTTATTAGCCTACCTTCAACGAATTGCCTTGTATTGCCATCAGCTTAATATCTGCAGCAAGGTGAAGGCAGAAGTGCAGAATCTG
GGAGGAGAGCTCATTGTGTCAGGGCTGGACAGTGCCACATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTG
AAAGCATCCTATGTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCT
CCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAAACACATTTCGCCT
GTACAGGCTTTAAGTGAATTCAAAGCAATGGATTCCTTCTAGGACGATAGGTTTTAACAAGAAAGCTTTTTCTTTCTTTTCTTTCTTTCT
TTTTCTTTTTAATTCCATTTTTGTATGCATACCTGCCAGCTCGTATGCCTCTGGCATGGGGAAATTAAGGGAACAGTGTCTGTTTGCATG
TAAGATGAGATGAGATCAATACTACTGATCCATCTGTAGCCTGGGAAGGAGACAGGACATTCCTGTACTAAGGTGGCACAGAGCTGTCCT
TTGCAACATTCTCATAAAATTGGGCACAGAGTTCGCATTGGCGCAATATTTATGGGAGTGGGAGGGATGGGGAAAATAAACTTAACTCTA
CAAAAGCAAACTCTAATGCATGCAAGAATCATTAGGTTGGCAGGTATATGCATAAGTGAAAAATCTGGAAGTGTAATGGTAGAACATAAA
ACTTGTATTGCTTCTGTTTCAGTGCAAAAATGTACTAGCCAATACGCTTAAGTGTGTGGCCCATGAATTGAACAATTTAACCTTGAAGTC
TATATCCGTGATATTATGTCGATTTTTAACTGAGGGGAAATTAACTAGTCCAGCCTAAAATGCTTCTTTTAATCTGCATTCTGTTTCCTC
TTCTAGTTGTGCCATTACTAGTGATCATGTTTTTTTCCCCCCTTTAATGAAAACAATAAACATCTATTTGAGACAATTAAAATCCTTCTG
GGGGCACTGGAAGCACAATACGGTGACCAATCTTGCTTTCATTTTTTTTTCTTTTTAATTTGAACCATGATTTTGCTAGAAATAGAAGGC
CCAGTGGTGGAATATTAGAGGGAAGGAAACTGACAACGTGTGAAAGTTAGAGGCAAATACATAGGTGTAGCTTGGAGTGCTGGTATCTAA

>In-frame_LDHB_ENST00000396076_chr12_21790005_-_CTNNA2_ENST00000343114_chr2_80620336_+_3740nt
TCCGCACGACTGTTACAGAGGTCTCCAGAGCCTTCTCTCTCCTGGTAGGTTTCGGCTCAGGACCCTGAATCCTGGCCCACAGGCAAGCCT
GATGGGACGTGCGGGGTAGTACTTGTATGGGGAGACGCGGGAAGGAGGAAGAAGCACATCTGTCCTCCGCGGCCTTTAGCTCTGAGCATC
CGGCCGCGGGCCCTGACTTTGCCGCTCAGTTTGGGGCGCAGGGGGGGCCGTGCCCTGGCGGAGGAGCAGAAGGCAGAGGGTAGCAGCTGC
GGCTCAGCGGAGAGACTTGTTGCATTTGCAGCTAAAACCAGGCCCTACTTGTCCTTGTGCAAAATGGCAACTCTTAAGGAAAAACTCATT
GCACCAGTTGCGGAAGAAGAGGCAACAGTTCCAAACAATAAGATCACTGTAGTGGGTGTTGGACAAGTTGGTATGGCGTGTGCTATCAGC
ATTCTGGGAAAGTCTCTGGCTGATGAACTTGCTCTTGTGGATGTTTTGGAAGATAAGCTTAAAGGAGAAATGATGGATCTGCAGCATGGG
AGCTTATTTCTTCAGACACCTAAAATTGTGGCAGATAAAGATTATTCTGTGACTGCCAATTCTAAGATTGTAGTGGTAACTGCAGGAGTC
CGTCAGCAAGAAGGGGAGAGTCGGCTCAATCTGGTGCAGAGAAATGTTAATGTCTTCAAATTCATTATTCCTCAGATCGTCAAGTACAGT
CCTGATTGCATCATAATTGTGGTTTCCAACCCAGTGGACATTCTTACGTATGTTACCTGGAAACTAAGTGGATTACCCAAACACCGCGTG
ATTGGAAGTGGATGTAATCTGGATTCTGCTAGATTTCGCTACCTTATGGCTGAAAAACTTGGCATTCATCCCAGCAGCTGCCATGGATGG
ATTTTGGGGGAACATGGCGACTCAAGTGTGGCTGTGTGGAGTGGTGTGAATGTGGCAGGTGTTTCTCTCCAGGAATTGAATCCAGAAATG
GGAACTGACAATGATAGTGAAAATTGGAAGGAAGTGCATAAGATGGTGGTTGAAAGTGCCTATGAAGTCATCAAGCTAAAAGGATATACC
AACTGGGCTATTGGATTAAGTGTGGCTGATCTTATTGAATCCATGTTGAAAAATCTATCCAGGATTCATCCCGTGTCAACAATGGTAAAG
ACTGGAAGGAAAGAAAAAGGAGATCCTCTCAACATTGCGATTGATAAGATGACTAAGAAAACAAGAGATCTAAGGAGACAGCTTCGGAAA
GCAGTGATGGATCACATATCTGACTCTTTCCTGGAAACCAATGTTCCTTTGCTAGTTCTCATTGAGGCTGCAAAGAGCGGAAATGAAAAG
GAAGTGAAAGAATATGCCCAAGTTTTCCGTGAGCATGCCAACAAACTGGTAGAGGTTGCCAATTTGGCCTGTTCCATCTCCAACAATGAA
GAAGGGGTGAAATTAGTTCGGATGGCAGCCACCCAGATTGACAGCCTGTGTCCCCAGGTCATCAATGCCGCTCTGACACTGGCTGCCCGG
CCACAGAGCAAAGTTGCTCAGGATAACATGGACGTCTTCAAAGACCAGTGGGAGAAGCAGGTCCGAGTGTTGACAGAGGCCGTGGATGAC
ATCACCTCAGTGGATGACTTCCTCTCTGTCTCAGAAAATCACATCTTGGAGGATGTGAACAAGTGTGTGATAGCCCTCCAAGAGGGCGAT
GTGGACACTCTGGACCGGACTGCAGGGGCCATCAGGGGCCGGGCAGCTCGAGTCATACACATCATCAATGCTGAGATGGAGAACTATGAA
GCTGGGGTTTATACTGAGAAGGTGTTGGAAGCTACAAAATTGCTTTCTGAAACAGTGATGCCACGCTTCGCTGAACAAGTAGAGGTTGCC
ATTGAAGCCCTGAGTGCCAACGTTCCTCAACCGTTTGAGGAGAATGAGTTCATCGATGCCTCTCGCCTGGTGTATGATGGCGTTCGGGAC
ATCAGAAAGGCTGTGCTGATGATCAGGACCCCAGAAGAACTAGAGGATGATTCTGACTTTGAGCAGGAAGATTATGATGTGCGTAGCAGG
ACAAGTGTTCAGACTGAGGATGACCAGCTCATTGCAGGGCAGAGCGCACGGGCCATCATGGCGCAACTACCGCAGGAGGAGAAGGCAAAA
ATAGCTGAGCAGGTGGAGATATTCCATCAAGAGAAAAGCAAGCTGGATGCAGAAGTGGCCAAATGGGACGACAGCGGCAATGATATCATT
GTACTGGCCAAGCAGATGTGTATGATCATGATGGAAATGACAGACTTCACAAGAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATT
AATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGCTCGTGCTGTGGCTGATCAGTGTCCTGATTCAGCATGTAAG
CAGGATTTATTAGCCTACCTTCAACGAATTGCCTTGTATTGCCATCAGCTTAATATCTGCAGCAAGGTGAAGGCAGAAGTGCAGAATCTG
GGAGGAGAGCTCATTGTGTCAGGGCTGGACAGTGCCACATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTG
AAAGCATCCTATGTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCT
CCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAAACACATTTCGCCT
GTACAGGCTTTAAGTGAATTCAAAGCAATGGATTCCTTCTAGGACGATAGGTTTTAACAAGAAAGCTTTTTCTTTCTTTTCTTTCTTTCT
TTTTCTTTTTAATTCCATTTTTGTATGCATACCTGCCAGCTCGTATGCCTCTGGCATGGGGAAATTAAGGGAACAGTGTCTGTTTGCATG
TAAGATGAGATGAGATCAATACTACTGATCCATCTGTAGCCTGGGAAGGAGACAGGACATTCCTGTACTAAGGTGGCACAGAGCTGTCCT
TTGCAACATTCTCATAAAATTGGGCACAGAGTTCGCATTGGCGCAATATTTATGGGAGTGGGAGGGATGGGGAAAATAAACTTAACTCTA
CAAAAGCAAACTCTAATGCATGCAAGAATCATTAGGTTGGCAGGTATATGCATAAGTGAAAAATCTGGAAGTGTAATGGTAGAACATAAA
ACTTGTATTGCTTCTGTTTCAGTGCAAAAATGTACTAGCCAATACGCTTAAGTGTGTGGCCCATGAATTGAACAATTTAACCTTGAAGTC
TATATCCGTGATATTATGTCGATTTTTAACTGAGGGGAAATTAACTAGTCCAGCCTAAAATGCTTCTTTTAATCTGCATTCTGTTTCCTC
TTCTAGTTGTGCCATTACTAGTGATCATGTTTTTTTCCCCCCTTTAATGAAAACAATAAACATCTATTTGAGACAATTAAAATCCTTCTG
GGGGCACTGGAAGCACAATACGGTGACCAATCTTGCTTTCATTTTTTTTTCTTTTTAATTTGAACCATGATTTTGCTAGAAATAGAAGGC
CCAGTGGTGGAATATTAGAGGGAAGGAAACTGACAACGTGTGAAAGTTAGAGGCAAATACATAGGTGTAGCTTGGAGTGCTGGTATCTAA


Top

FusionGenePPI for LDHB_CTNNA2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
LDHBLDHB, H2AFX, TERF1, POT1, CUL3, CUL4B, CDK2, COPS5, LDHA, ECT2, LIG4, PAXIP1, SMURF1, CTNNB1, FN1, VCAM1, ATF2, METTL21B, UBL4A, ITGA4, RAD52, CKS2, CKS1B, ALDH7A1, BZW1, CKB, CNDP2, G6PD, GNAI3, HMGB2, HNRNPA2B1, HNRNPAB, FTO, GINS4, PAFAH1B2, PAFAH1B3, SLC9A3R1, TGM2, UBE2V1, NPEPPS, PAK2, PFAS, PGD, RPS6KA1, TXNDC5, UBFD1, YWHAB, YWHAG, YWHAQ, YWHAZ, STAU1, HUWE1, FUS, PEX5, SUZ12, RNF2, ACADM, ADSL, AHCY, ALDH1B1, ALDH2, ALDH4A1, APRT, ARF4, ARF5, ASS1, CAT, CCT3, CCT6A, CCT6B, CTSD, EIF4H, ENO1, ETFA, FAHD1, FH, G3BP1, GAA, GFPT1, IDE, KIAA0368, AHSA1, ARF1, CFL1, CFL2, DNAJA1, DSTN, HSPA9, NANP, PCMT1, PHGDH, RAB1A, RAB1B, RAB5C, SOD1, TKT, UFC1, WDR1, MDH1, MIF, NIT2, NME1-NME2, NME2, NUP50, PARK7, PDHA1, PEPD, PGK1, PGM1, PHB2, PKM, PPIA, PPT1, PRCP, PRDX5, PSMC2, RAB5A, RHEB, SORD, TALDO1, TPI1, UBE2N, NTRK1, PTEN, EWSR1, PPME1, CKAP5, PPP4R1, MCM2, C3orf17, FAM210A, ZNF746, LDHC, COQ2, DLD, DLST, DNM1L, SDHA, SOAT1, TRIM25, BRCA1CTNNA2PAN2, PPP2R1A, FBXW11, CD27, UTP3, SAPCD1, CTNNB1, JUP, NTRK1, SDHAF2, GAN, MCM2, EGFR, CDH1, CDH8, CDH5, CTNNBIP1, DUSP22, FBXL5, CIR1, G3BP1, UBE2A, TES


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for LDHB_CTNNA2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
HgeneLDHBP07195DB09118StiripentolL-lactate dehydrogenase B chainsmall moleculeapproved
HgeneLDHBP07195DB11638ArtenimolL-lactate dehydrogenase B chainsmall moleculeapproved|investigational

Top

RelatedDiseases for LDHB_CTNNA2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneLDHBC3279904Lactate Dehydrogenase B Deficiency7ORPHANET;UNIPROT
HgeneLDHBC0007124Noninfiltrating Intraductal Carcinoma1CTD_human
HgeneLDHBC0007134Renal Cell Carcinoma1CTD_human
HgeneLDHBC0023893Liver Cirrhosis, Experimental1CTD_human
HgeneLDHBC0025521Inborn Errors of Metabolism1CTD_human
HgeneLDHBC0027626Neoplasm Invasiveness1CTD_human
HgeneLDHBC0033578Prostatic Neoplasms1CTD_human
HgeneLDHBC0948089Acute Coronary Syndrome1CTD_human
HgeneLDHBC1458155Mammary Neoplasms1CTD_human
TgeneCTNNA2C0001973Alcoholic Intoxication, Chronic1PSYGENET
TgeneCTNNA2C0036341Schizophrenia1PSYGENET
TgeneCTNNA2C0038356Stomach Neoplasms1CTD_human