FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 19476

FusionGeneSummary for LARP4_HPD

check button Fusion gene summary
Fusion gene informationFusion gene name: LARP4_HPD
Fusion gene ID: 19476
HgeneTgene
Gene symbol

LARP4

HPD

Gene ID

113251

3242

Gene nameLa ribonucleoprotein domain family member 44-hydroxyphenylpyruvate dioxygenase
SynonymsPP132964-HPPD|4HPPD|GLOD3|HPPDASE|PPD
Cytomap

12q13.12

12q24.31

Type of geneprotein-codingprotein-coding
Descriptionla-related protein 4c-Mpl binding protein4-hydroxyphenylpyruvate dioxygenase4-hydroxyphenylpyruvic acid oxidaseglyoxalase domain containing 3
Modification date2018052720180523
UniProtAcc

Q71RC2

P32754

Ensembl transtripts involved in fusion geneENST00000293618, ENST00000429001, 
ENST00000398473, ENST00000518444, 
ENST00000347328, ENST00000522085, 
ENST00000518561, 
ENST00000289004, 
ENST00000543163, ENST00000543869, 
Fusion gene scores* DoF score8 X 4 X 6=1924 X 4 X 3=48
# samples 84
** MAII scorelog2(8/192*10)=-1.26303440583379
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(4/48*10)=-0.263034405833794
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: LARP4 [Title/Abstract] AND HPD [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVPRADTCGA-YL-A8HO-01ALARP4chr12

50824353

+HPDchr12

122285120

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000293618ENST00000289004LARP4chr12

50824353

+HPDchr12

122285120

-
In-frameENST00000293618ENST00000543163LARP4chr12

50824353

+HPDchr12

122285120

-
5CDS-5UTRENST00000293618ENST00000543869LARP4chr12

50824353

+HPDchr12

122285120

-
In-frameENST00000429001ENST00000289004LARP4chr12

50824353

+HPDchr12

122285120

-
In-frameENST00000429001ENST00000543163LARP4chr12

50824353

+HPDchr12

122285120

-
5CDS-5UTRENST00000429001ENST00000543869LARP4chr12

50824353

+HPDchr12

122285120

-
In-frameENST00000398473ENST00000289004LARP4chr12

50824353

+HPDchr12

122285120

-
In-frameENST00000398473ENST00000543163LARP4chr12

50824353

+HPDchr12

122285120

-
5CDS-5UTRENST00000398473ENST00000543869LARP4chr12

50824353

+HPDchr12

122285120

-
In-frameENST00000518444ENST00000289004LARP4chr12

50824353

+HPDchr12

122285120

-
In-frameENST00000518444ENST00000543163LARP4chr12

50824353

+HPDchr12

122285120

-
5CDS-5UTRENST00000518444ENST00000543869LARP4chr12

50824353

+HPDchr12

122285120

-
In-frameENST00000347328ENST00000289004LARP4chr12

50824353

+HPDchr12

122285120

-
In-frameENST00000347328ENST00000543163LARP4chr12

50824353

+HPDchr12

122285120

-
5CDS-5UTRENST00000347328ENST00000543869LARP4chr12

50824353

+HPDchr12

122285120

-
In-frameENST00000522085ENST00000289004LARP4chr12

50824353

+HPDchr12

122285120

-
In-frameENST00000522085ENST00000543163LARP4chr12

50824353

+HPDchr12

122285120

-
5CDS-5UTRENST00000522085ENST00000543869LARP4chr12

50824353

+HPDchr12

122285120

-
In-frameENST00000518561ENST00000289004LARP4chr12

50824353

+HPDchr12

122285120

-
In-frameENST00000518561ENST00000543163LARP4chr12

50824353

+HPDchr12

122285120

-
5CDS-5UTRENST00000518561ENST00000543869LARP4chr12

50824353

+HPDchr12

122285120

-

Top

FusionProtFeatures for LARP4_HPD


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
LARP4

Q71RC2

HPD

P32754

RNA binding protein that binds to the poly-A tract ofmRNA molecules (PubMed:21098120). Associates with the 40Sribosomal subunit and with polysomes (PubMed:21098120). Plays arole in the regulation of mRNA translation (PubMed:21098120).Plays a role in the regulation of cell morphology and cytoskeletalorganization (PubMed:21834987, PubMed:27615744).{ECO:0000269|PubMed:21098120, ECO:0000269|PubMed:21834987,ECO:0000269|PubMed:27615744}. Key enzyme in the degradation of tyrosine.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneHPDchr12:50824353chr12:122285120ENST00000543163-915180_338159355DomainVOC 2

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneLARP4chr12:50824353chr12:122285120ENST00000293618+415113_202132654DomainHTH La-type RNA-binding
HgeneLARP4chr12:50824353chr12:122285120ENST00000293618+415203_281132654DomainNote=RRM
HgeneLARP4chr12:50824353chr12:122285120ENST00000347328+415113_202132654DomainHTH La-type RNA-binding
HgeneLARP4chr12:50824353chr12:122285120ENST00000347328+415203_281132654DomainNote=RRM
HgeneLARP4chr12:50824353chr12:122285120ENST00000398473+416113_202132725DomainHTH La-type RNA-binding
HgeneLARP4chr12:50824353chr12:122285120ENST00000398473+416203_281132725DomainNote=RRM
HgeneLARP4chr12:50824353chr12:122285120ENST00000429001+416113_202138731DomainHTH La-type RNA-binding
HgeneLARP4chr12:50824353chr12:122285120ENST00000429001+416203_281138731DomainNote=RRM
HgeneLARP4chr12:50824353chr12:122285120ENST00000518444+416113_202131724DomainHTH La-type RNA-binding
HgeneLARP4chr12:50824353chr12:122285120ENST00000518444+416203_281131724DomainNote=RRM
HgeneLARP4chr12:50824353chr12:122285120ENST00000522085+411113_202132446DomainHTH La-type RNA-binding
HgeneLARP4chr12:50824353chr12:122285120ENST00000522085+411203_281132446DomainNote=RRM
TgeneHPDchr12:50824353chr12:122285120ENST00000543163-91518_149159355DomainVOC 1


Top

FusionGeneSequence for LARP4_HPD


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_LARP4_ENST00000293618_chr12_50824353_+_HPD_ENST00000289004_chr12_122285120_-_328aa
MLLFVEQVASKGTGLNPNAKVWQEIAPGNTDATPVTHGTESSWHEIAATSGAHPEGNAELSEDICKEYEVMYSSSCETTRNTTGIEESTD
GMILGPEDLSYQIYDVSGESNSAVSTEDLKECLKKQLEFCFSRYLKNLQFHRFWSVDDTQVHTEYSSLRSIVVANYEESIKMPINEPAPG
KKKSQIQEYVDYNGGAGVQHIALKTEDIITAIRHLRERGLEFLSVPSTYYKQLREKLKTAKIKVKENIDALEELKILVDYDEKGYLLQIF

>In-frame_LARP4_ENST00000293618_chr12_50824353_+_HPD_ENST00000543163_chr12_122285120_-_328aa
MLLFVEQVASKGTGLNPNAKVWQEIAPGNTDATPVTHGTESSWHEIAATSGAHPEGNAELSEDICKEYEVMYSSSCETTRNTTGIEESTD
GMILGPEDLSYQIYDVSGESNSAVSTEDLKECLKKQLEFCFSRYLKNLQFHRFWSVDDTQVHTEYSSLRSIVVANYEESIKMPINEPAPG
KKKSQIQEYVDYNGGAGVQHIALKTEDIITAIRHLRERGLEFLSVPSTYYKQLREKLKTAKIKVKENIDALEELKILVDYDEKGYLLQIF

>In-frame_LARP4_ENST00000429001_chr12_50824353_+_HPD_ENST00000289004_chr12_122285120_-_334aa
MLLFVEQVASKGTGLNPNAKVWQEIAPGNTDATPVTHGTESSWHEIAATSGAHPEVSVFNTGNAELSEDICKEYEVMYSSSCETTRNTTG
IEESTDGMILGPEDLSYQIYDVSGESNSAVSTEDLKECLKKQLEFCFSRYLKNLQFHRFWSVDDTQVHTEYSSLRSIVVANYEESIKMPI
NEPAPGKKKSQIQEYVDYNGGAGVQHIALKTEDIITAIRHLRERGLEFLSVPSTYYKQLREKLKTAKIKVKENIDALEELKILVDYDEKG

>In-frame_LARP4_ENST00000429001_chr12_50824353_+_HPD_ENST00000543163_chr12_122285120_-_334aa
MLLFVEQVASKGTGLNPNAKVWQEIAPGNTDATPVTHGTESSWHEIAATSGAHPEVSVFNTGNAELSEDICKEYEVMYSSSCETTRNTTG
IEESTDGMILGPEDLSYQIYDVSGESNSAVSTEDLKECLKKQLEFCFSRYLKNLQFHRFWSVDDTQVHTEYSSLRSIVVANYEESIKMPI
NEPAPGKKKSQIQEYVDYNGGAGVQHIALKTEDIITAIRHLRERGLEFLSVPSTYYKQLREKLKTAKIKVKENIDALEELKILVDYDEKG

>In-frame_LARP4_ENST00000398473_chr12_50824353_+_HPD_ENST00000289004_chr12_122285120_-_328aa
MLLFVEQVASKGTGLNPNAKVWQEIAPGNTDATPVTHGTESSWHEIAATSGAHPEGNAELSEDICKEYEVMYSSSCETTRNTTGIEESTD
GMILGPEDLSYQIYDVSGESNSAVSTEDLKECLKKQLEFCFSRYLKNLQFHRFWSVDDTQVHTEYSSLRSIVVANYEESIKMPINEPAPG
KKKSQIQEYVDYNGGAGVQHIALKTEDIITAIRHLRERGLEFLSVPSTYYKQLREKLKTAKIKVKENIDALEELKILVDYDEKGYLLQIF

>In-frame_LARP4_ENST00000398473_chr12_50824353_+_HPD_ENST00000543163_chr12_122285120_-_328aa
MLLFVEQVASKGTGLNPNAKVWQEIAPGNTDATPVTHGTESSWHEIAATSGAHPEGNAELSEDICKEYEVMYSSSCETTRNTTGIEESTD
GMILGPEDLSYQIYDVSGESNSAVSTEDLKECLKKQLEFCFSRYLKNLQFHRFWSVDDTQVHTEYSSLRSIVVANYEESIKMPINEPAPG
KKKSQIQEYVDYNGGAGVQHIALKTEDIITAIRHLRERGLEFLSVPSTYYKQLREKLKTAKIKVKENIDALEELKILVDYDEKGYLLQIF

>In-frame_LARP4_ENST00000518444_chr12_50824353_+_HPD_ENST00000289004_chr12_122285120_-_327aa
MLLFVEVASKGTGLNPNAKVWQEIAPGNTDATPVTHGTESSWHEIAATSGAHPEGNAELSEDICKEYEVMYSSSCETTRNTTGIEESTDG
MILGPEDLSYQIYDVSGESNSAVSTEDLKECLKKQLEFCFSRYLKNLQFHRFWSVDDTQVHTEYSSLRSIVVANYEESIKMPINEPAPGK
KKSQIQEYVDYNGGAGVQHIALKTEDIITAIRHLRERGLEFLSVPSTYYKQLREKLKTAKIKVKENIDALEELKILVDYDEKGYLLQIFT

>In-frame_LARP4_ENST00000518444_chr12_50824353_+_HPD_ENST00000543163_chr12_122285120_-_327aa
MLLFVEVASKGTGLNPNAKVWQEIAPGNTDATPVTHGTESSWHEIAATSGAHPEGNAELSEDICKEYEVMYSSSCETTRNTTGIEESTDG
MILGPEDLSYQIYDVSGESNSAVSTEDLKECLKKQLEFCFSRYLKNLQFHRFWSVDDTQVHTEYSSLRSIVVANYEESIKMPINEPAPGK
KKSQIQEYVDYNGGAGVQHIALKTEDIITAIRHLRERGLEFLSVPSTYYKQLREKLKTAKIKVKENIDALEELKILVDYDEKGYLLQIFT

>In-frame_LARP4_ENST00000347328_chr12_50824353_+_HPD_ENST00000289004_chr12_122285120_-_328aa
MLLFVEQVASKGTGLNPNAKVWQEIAPGNTDATPVTHGTESSWHEIAATSGAHPEGNAELSEDICKEYEVMYSSSCETTRNTTGIEESTD
GMILGPEDLSYQIYDVSGESNSAVSTEDLKECLKKQLEFCFSRYLKNLQFHRFWSVDDTQVHTEYSSLRSIVVANYEESIKMPINEPAPG
KKKSQIQEYVDYNGGAGVQHIALKTEDIITAIRHLRERGLEFLSVPSTYYKQLREKLKTAKIKVKENIDALEELKILVDYDEKGYLLQIF

>In-frame_LARP4_ENST00000347328_chr12_50824353_+_HPD_ENST00000543163_chr12_122285120_-_328aa
MLLFVEQVASKGTGLNPNAKVWQEIAPGNTDATPVTHGTESSWHEIAATSGAHPEGNAELSEDICKEYEVMYSSSCETTRNTTGIEESTD
GMILGPEDLSYQIYDVSGESNSAVSTEDLKECLKKQLEFCFSRYLKNLQFHRFWSVDDTQVHTEYSSLRSIVVANYEESIKMPINEPAPG
KKKSQIQEYVDYNGGAGVQHIALKTEDIITAIRHLRERGLEFLSVPSTYYKQLREKLKTAKIKVKENIDALEELKILVDYDEKGYLLQIF

>In-frame_LARP4_ENST00000522085_chr12_50824353_+_HPD_ENST00000289004_chr12_122285120_-_328aa
MLLFVEQVASKGTGLNPNAKVWQEIAPGNTDATPVTHGTESSWHEIAATSGAHPEGNAELSEDICKEYEVMYSSSCETTRNTTGIEESTD
GMILGPEDLSYQIYDVSGESNSAVSTEDLKECLKKQLEFCFSRYLKNLQFHRFWSVDDTQVHTEYSSLRSIVVANYEESIKMPINEPAPG
KKKSQIQEYVDYNGGAGVQHIALKTEDIITAIRHLRERGLEFLSVPSTYYKQLREKLKTAKIKVKENIDALEELKILVDYDEKGYLLQIF

>In-frame_LARP4_ENST00000522085_chr12_50824353_+_HPD_ENST00000543163_chr12_122285120_-_328aa
MLLFVEQVASKGTGLNPNAKVWQEIAPGNTDATPVTHGTESSWHEIAATSGAHPEGNAELSEDICKEYEVMYSSSCETTRNTTGIEESTD
GMILGPEDLSYQIYDVSGESNSAVSTEDLKECLKKQLEFCFSRYLKNLQFHRFWSVDDTQVHTEYSSLRSIVVANYEESIKMPINEPAPG
KKKSQIQEYVDYNGGAGVQHIALKTEDIITAIRHLRERGLEFLSVPSTYYKQLREKLKTAKIKVKENIDALEELKILVDYDEKGYLLQIF

>In-frame_LARP4_ENST00000518561_chr12_50824353_+_HPD_ENST00000289004_chr12_122285120_-_258aa
MYSSSCETTRNTTGIEESTDGMILGPEDLSYQIYDVSGESNSAVSTEDLKECLKKQLEFCFSRYLKNLQFHRFWSVDDTQVHTEYSSLRS
IVVANYEESIKMPINEPAPGKKKSQIQEYVDYNGGAGVQHIALKTEDIITAIRHLRERGLEFLSVPSTYYKQLREKLKTAKIKVKENIDA

>In-frame_LARP4_ENST00000518561_chr12_50824353_+_HPD_ENST00000543163_chr12_122285120_-_258aa
MYSSSCETTRNTTGIEESTDGMILGPEDLSYQIYDVSGESNSAVSTEDLKECLKKQLEFCFSRYLKNLQFHRFWSVDDTQVHTEYSSLRS
IVVANYEESIKMPINEPAPGKKKSQIQEYVDYNGGAGVQHIALKTEDIITAIRHLRERGLEFLSVPSTYYKQLREKLKTAKIKVKENIDA


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_LARP4_ENST00000293618_chr12_50824353_+_HPD_ENST00000289004_chr12_122285120_-_984nt
ATGTTGCTTTTCGTGGAGCAGGTAGCATCTAAAGGAACTGGTTTAAATCCTAATGCCAAAGTATGGCAAGAAATTGCTCCTGGAAATACT
GATGCCACCCCAGTAACTCATGGAACTGAAAGCTCTTGGCATGAAATAGCAGCTACATCAGGTGCTCATCCTGAGGGTAATGCAGAGCTC
TCAGAAGATATATGTAAAGAATATGAAGTAATGTATTCTTCATCTTGTGAAACCACAAGAAATACTACAGGCATTGAAGAATCAACTGAT
GGGATGATTTTAGGACCAGAAGATCTGAGTTACCAAATATATGATGTTTCCGGAGAAAGCAATTCAGCAGTTTCTACAGAAGACCTAAAA
GAATGTCTGAAGAAACAATTAGAATTCTGTTTTTCACGGTACCTGAAAAACCTGCAGTTCCACCGCTTCTGGTCCGTGGATGACACGCAG
GTGCACACGGAATATAGCTCTCTGCGATCCATTGTGGTGGCCAACTATGAAGAGTCCATCAAGATGCCCATCAATGAGCCAGCGCCTGGC
AAGAAGAAGTCCCAGATCCAGGAATATGTGGACTATAACGGGGGCGCTGGGGTCCAGCACATCGCTCTCAAGACCGAAGACATCATCACA
GCGATTCGCCACTTGAGAGAGAGAGGCCTGGAGTTCTTATCTGTTCCCTCCACGTACTACAAACAACTGCGGGAGAAGCTGAAGACGGCC
AAGATCAAGGTGAAGGAGAACATTGATGCCCTGGAGGAGCTGAAAATCCTGGTGGACTACGACGAGAAAGGCTACCTCCTGCAGATCTTC
ACCAAACCGGTGCAGGACCGGCCCACGCTCTTCCTGGAAGTCATCCAGCGCCACAACCACCAGGGTTTTGGAGCCGGCAACTTCAACTCA

>In-frame_LARP4_ENST00000293618_chr12_50824353_+_HPD_ENST00000543163_chr12_122285120_-_984nt
ATGTTGCTTTTCGTGGAGCAGGTAGCATCTAAAGGAACTGGTTTAAATCCTAATGCCAAAGTATGGCAAGAAATTGCTCCTGGAAATACT
GATGCCACCCCAGTAACTCATGGAACTGAAAGCTCTTGGCATGAAATAGCAGCTACATCAGGTGCTCATCCTGAGGGTAATGCAGAGCTC
TCAGAAGATATATGTAAAGAATATGAAGTAATGTATTCTTCATCTTGTGAAACCACAAGAAATACTACAGGCATTGAAGAATCAACTGAT
GGGATGATTTTAGGACCAGAAGATCTGAGTTACCAAATATATGATGTTTCCGGAGAAAGCAATTCAGCAGTTTCTACAGAAGACCTAAAA
GAATGTCTGAAGAAACAATTAGAATTCTGTTTTTCACGGTACCTGAAAAACCTGCAGTTCCACCGCTTCTGGTCCGTGGATGACACGCAG
GTGCACACGGAATATAGCTCTCTGCGATCCATTGTGGTGGCCAACTATGAAGAGTCCATCAAGATGCCCATCAATGAGCCAGCGCCTGGC
AAGAAGAAGTCCCAGATCCAGGAATATGTGGACTATAACGGGGGCGCTGGGGTCCAGCACATCGCTCTCAAGACCGAAGACATCATCACA
GCGATTCGCCACTTGAGAGAGAGAGGCCTGGAGTTCTTATCTGTTCCCTCCACGTACTACAAACAACTGCGGGAGAAGCTGAAGACGGCC
AAGATCAAGGTGAAGGAGAACATTGATGCCCTGGAGGAGCTGAAAATCCTGGTGGACTACGACGAGAAAGGCTACCTCCTGCAGATCTTC
ACCAAACCGGTGCAGGACCGGCCCACGCTCTTCCTGGAAGTCATCCAGCGCCACAACCACCAGGGTTTTGGAGCCGGCAACTTCAACTCA

>In-frame_LARP4_ENST00000429001_chr12_50824353_+_HPD_ENST00000289004_chr12_122285120_-_1002nt
ATGTTGCTTTTCGTGGAGCAGGTAGCATCTAAAGGAACTGGTTTAAATCCTAATGCCAAAGTATGGCAAGAAATTGCTCCTGGAAATACT
GATGCCACCCCAGTAACTCATGGAACTGAAAGCTCTTGGCATGAAATAGCAGCTACATCAGGTGCTCATCCTGAGGTGTCTGTCTTTAAT
ACAGGTAATGCAGAGCTCTCAGAAGATATATGTAAAGAATATGAAGTAATGTATTCTTCATCTTGTGAAACCACAAGAAATACTACAGGC
ATTGAAGAATCAACTGATGGGATGATTTTAGGACCAGAAGATCTGAGTTACCAAATATATGATGTTTCCGGAGAAAGCAATTCAGCAGTT
TCTACAGAAGACCTAAAAGAATGTCTGAAGAAACAATTAGAATTCTGTTTTTCACGGTACCTGAAAAACCTGCAGTTCCACCGCTTCTGG
TCCGTGGATGACACGCAGGTGCACACGGAATATAGCTCTCTGCGATCCATTGTGGTGGCCAACTATGAAGAGTCCATCAAGATGCCCATC
AATGAGCCAGCGCCTGGCAAGAAGAAGTCCCAGATCCAGGAATATGTGGACTATAACGGGGGCGCTGGGGTCCAGCACATCGCTCTCAAG
ACCGAAGACATCATCACAGCGATTCGCCACTTGAGAGAGAGAGGCCTGGAGTTCTTATCTGTTCCCTCCACGTACTACAAACAACTGCGG
GAGAAGCTGAAGACGGCCAAGATCAAGGTGAAGGAGAACATTGATGCCCTGGAGGAGCTGAAAATCCTGGTGGACTACGACGAGAAAGGC
TACCTCCTGCAGATCTTCACCAAACCGGTGCAGGACCGGCCCACGCTCTTCCTGGAAGTCATCCAGCGCCACAACCACCAGGGTTTTGGA
GCCGGCAACTTCAACTCACTGTTCAAGGCTTTCGAGGAGGAGCAGAACCTGCGGGGTAACCTCACCAACATGGAGACCAATGGGGTGGTG

>In-frame_LARP4_ENST00000429001_chr12_50824353_+_HPD_ENST00000543163_chr12_122285120_-_1002nt
ATGTTGCTTTTCGTGGAGCAGGTAGCATCTAAAGGAACTGGTTTAAATCCTAATGCCAAAGTATGGCAAGAAATTGCTCCTGGAAATACT
GATGCCACCCCAGTAACTCATGGAACTGAAAGCTCTTGGCATGAAATAGCAGCTACATCAGGTGCTCATCCTGAGGTGTCTGTCTTTAAT
ACAGGTAATGCAGAGCTCTCAGAAGATATATGTAAAGAATATGAAGTAATGTATTCTTCATCTTGTGAAACCACAAGAAATACTACAGGC
ATTGAAGAATCAACTGATGGGATGATTTTAGGACCAGAAGATCTGAGTTACCAAATATATGATGTTTCCGGAGAAAGCAATTCAGCAGTT
TCTACAGAAGACCTAAAAGAATGTCTGAAGAAACAATTAGAATTCTGTTTTTCACGGTACCTGAAAAACCTGCAGTTCCACCGCTTCTGG
TCCGTGGATGACACGCAGGTGCACACGGAATATAGCTCTCTGCGATCCATTGTGGTGGCCAACTATGAAGAGTCCATCAAGATGCCCATC
AATGAGCCAGCGCCTGGCAAGAAGAAGTCCCAGATCCAGGAATATGTGGACTATAACGGGGGCGCTGGGGTCCAGCACATCGCTCTCAAG
ACCGAAGACATCATCACAGCGATTCGCCACTTGAGAGAGAGAGGCCTGGAGTTCTTATCTGTTCCCTCCACGTACTACAAACAACTGCGG
GAGAAGCTGAAGACGGCCAAGATCAAGGTGAAGGAGAACATTGATGCCCTGGAGGAGCTGAAAATCCTGGTGGACTACGACGAGAAAGGC
TACCTCCTGCAGATCTTCACCAAACCGGTGCAGGACCGGCCCACGCTCTTCCTGGAAGTCATCCAGCGCCACAACCACCAGGGTTTTGGA
GCCGGCAACTTCAACTCACTGTTCAAGGCTTTCGAGGAGGAGCAGAACCTGCGGGGTAACCTCACCAACATGGAGACCAATGGGGTGGTG

>In-frame_LARP4_ENST00000398473_chr12_50824353_+_HPD_ENST00000289004_chr12_122285120_-_984nt
ATGTTGCTTTTCGTGGAGCAGGTAGCATCTAAAGGAACTGGTTTAAATCCTAATGCCAAAGTATGGCAAGAAATTGCTCCTGGAAATACT
GATGCCACCCCAGTAACTCATGGAACTGAAAGCTCTTGGCATGAAATAGCAGCTACATCAGGTGCTCATCCTGAGGGTAATGCAGAGCTC
TCAGAAGATATATGTAAAGAATATGAAGTAATGTATTCTTCATCTTGTGAAACCACAAGAAATACTACAGGCATTGAAGAATCAACTGAT
GGGATGATTTTAGGACCAGAAGATCTGAGTTACCAAATATATGATGTTTCCGGAGAAAGCAATTCAGCAGTTTCTACAGAAGACCTAAAA
GAATGTCTGAAGAAACAATTAGAATTCTGTTTTTCACGGTACCTGAAAAACCTGCAGTTCCACCGCTTCTGGTCCGTGGATGACACGCAG
GTGCACACGGAATATAGCTCTCTGCGATCCATTGTGGTGGCCAACTATGAAGAGTCCATCAAGATGCCCATCAATGAGCCAGCGCCTGGC
AAGAAGAAGTCCCAGATCCAGGAATATGTGGACTATAACGGGGGCGCTGGGGTCCAGCACATCGCTCTCAAGACCGAAGACATCATCACA
GCGATTCGCCACTTGAGAGAGAGAGGCCTGGAGTTCTTATCTGTTCCCTCCACGTACTACAAACAACTGCGGGAGAAGCTGAAGACGGCC
AAGATCAAGGTGAAGGAGAACATTGATGCCCTGGAGGAGCTGAAAATCCTGGTGGACTACGACGAGAAAGGCTACCTCCTGCAGATCTTC
ACCAAACCGGTGCAGGACCGGCCCACGCTCTTCCTGGAAGTCATCCAGCGCCACAACCACCAGGGTTTTGGAGCCGGCAACTTCAACTCA

>In-frame_LARP4_ENST00000398473_chr12_50824353_+_HPD_ENST00000543163_chr12_122285120_-_984nt
ATGTTGCTTTTCGTGGAGCAGGTAGCATCTAAAGGAACTGGTTTAAATCCTAATGCCAAAGTATGGCAAGAAATTGCTCCTGGAAATACT
GATGCCACCCCAGTAACTCATGGAACTGAAAGCTCTTGGCATGAAATAGCAGCTACATCAGGTGCTCATCCTGAGGGTAATGCAGAGCTC
TCAGAAGATATATGTAAAGAATATGAAGTAATGTATTCTTCATCTTGTGAAACCACAAGAAATACTACAGGCATTGAAGAATCAACTGAT
GGGATGATTTTAGGACCAGAAGATCTGAGTTACCAAATATATGATGTTTCCGGAGAAAGCAATTCAGCAGTTTCTACAGAAGACCTAAAA
GAATGTCTGAAGAAACAATTAGAATTCTGTTTTTCACGGTACCTGAAAAACCTGCAGTTCCACCGCTTCTGGTCCGTGGATGACACGCAG
GTGCACACGGAATATAGCTCTCTGCGATCCATTGTGGTGGCCAACTATGAAGAGTCCATCAAGATGCCCATCAATGAGCCAGCGCCTGGC
AAGAAGAAGTCCCAGATCCAGGAATATGTGGACTATAACGGGGGCGCTGGGGTCCAGCACATCGCTCTCAAGACCGAAGACATCATCACA
GCGATTCGCCACTTGAGAGAGAGAGGCCTGGAGTTCTTATCTGTTCCCTCCACGTACTACAAACAACTGCGGGAGAAGCTGAAGACGGCC
AAGATCAAGGTGAAGGAGAACATTGATGCCCTGGAGGAGCTGAAAATCCTGGTGGACTACGACGAGAAAGGCTACCTCCTGCAGATCTTC
ACCAAACCGGTGCAGGACCGGCCCACGCTCTTCCTGGAAGTCATCCAGCGCCACAACCACCAGGGTTTTGGAGCCGGCAACTTCAACTCA

>In-frame_LARP4_ENST00000518444_chr12_50824353_+_HPD_ENST00000289004_chr12_122285120_-_981nt
ATGTTGCTTTTCGTGGAGGTAGCATCTAAAGGAACTGGTTTAAATCCTAATGCCAAAGTATGGCAAGAAATTGCTCCTGGAAATACTGAT
GCCACCCCAGTAACTCATGGAACTGAAAGCTCTTGGCATGAAATAGCAGCTACATCAGGTGCTCATCCTGAGGGTAATGCAGAGCTCTCA
GAAGATATATGTAAAGAATATGAAGTAATGTATTCTTCATCTTGTGAAACCACAAGAAATACTACAGGCATTGAAGAATCAACTGATGGG
ATGATTTTAGGACCAGAAGATCTGAGTTACCAAATATATGATGTTTCCGGAGAAAGCAATTCAGCAGTTTCTACAGAAGACCTAAAAGAA
TGTCTGAAGAAACAATTAGAATTCTGTTTTTCACGGTACCTGAAAAACCTGCAGTTCCACCGCTTCTGGTCCGTGGATGACACGCAGGTG
CACACGGAATATAGCTCTCTGCGATCCATTGTGGTGGCCAACTATGAAGAGTCCATCAAGATGCCCATCAATGAGCCAGCGCCTGGCAAG
AAGAAGTCCCAGATCCAGGAATATGTGGACTATAACGGGGGCGCTGGGGTCCAGCACATCGCTCTCAAGACCGAAGACATCATCACAGCG
ATTCGCCACTTGAGAGAGAGAGGCCTGGAGTTCTTATCTGTTCCCTCCACGTACTACAAACAACTGCGGGAGAAGCTGAAGACGGCCAAG
ATCAAGGTGAAGGAGAACATTGATGCCCTGGAGGAGCTGAAAATCCTGGTGGACTACGACGAGAAAGGCTACCTCCTGCAGATCTTCACC
AAACCGGTGCAGGACCGGCCCACGCTCTTCCTGGAAGTCATCCAGCGCCACAACCACCAGGGTTTTGGAGCCGGCAACTTCAACTCACTG

>In-frame_LARP4_ENST00000518444_chr12_50824353_+_HPD_ENST00000543163_chr12_122285120_-_981nt
ATGTTGCTTTTCGTGGAGGTAGCATCTAAAGGAACTGGTTTAAATCCTAATGCCAAAGTATGGCAAGAAATTGCTCCTGGAAATACTGAT
GCCACCCCAGTAACTCATGGAACTGAAAGCTCTTGGCATGAAATAGCAGCTACATCAGGTGCTCATCCTGAGGGTAATGCAGAGCTCTCA
GAAGATATATGTAAAGAATATGAAGTAATGTATTCTTCATCTTGTGAAACCACAAGAAATACTACAGGCATTGAAGAATCAACTGATGGG
ATGATTTTAGGACCAGAAGATCTGAGTTACCAAATATATGATGTTTCCGGAGAAAGCAATTCAGCAGTTTCTACAGAAGACCTAAAAGAA
TGTCTGAAGAAACAATTAGAATTCTGTTTTTCACGGTACCTGAAAAACCTGCAGTTCCACCGCTTCTGGTCCGTGGATGACACGCAGGTG
CACACGGAATATAGCTCTCTGCGATCCATTGTGGTGGCCAACTATGAAGAGTCCATCAAGATGCCCATCAATGAGCCAGCGCCTGGCAAG
AAGAAGTCCCAGATCCAGGAATATGTGGACTATAACGGGGGCGCTGGGGTCCAGCACATCGCTCTCAAGACCGAAGACATCATCACAGCG
ATTCGCCACTTGAGAGAGAGAGGCCTGGAGTTCTTATCTGTTCCCTCCACGTACTACAAACAACTGCGGGAGAAGCTGAAGACGGCCAAG
ATCAAGGTGAAGGAGAACATTGATGCCCTGGAGGAGCTGAAAATCCTGGTGGACTACGACGAGAAAGGCTACCTCCTGCAGATCTTCACC
AAACCGGTGCAGGACCGGCCCACGCTCTTCCTGGAAGTCATCCAGCGCCACAACCACCAGGGTTTTGGAGCCGGCAACTTCAACTCACTG

>In-frame_LARP4_ENST00000347328_chr12_50824353_+_HPD_ENST00000289004_chr12_122285120_-_984nt
ATGTTGCTTTTCGTGGAGCAGGTAGCATCTAAAGGAACTGGTTTAAATCCTAATGCCAAAGTATGGCAAGAAATTGCTCCTGGAAATACT
GATGCCACCCCAGTAACTCATGGAACTGAAAGCTCTTGGCATGAAATAGCAGCTACATCAGGTGCTCATCCTGAGGGTAATGCAGAGCTC
TCAGAAGATATATGTAAAGAATATGAAGTAATGTATTCTTCATCTTGTGAAACCACAAGAAATACTACAGGCATTGAAGAATCAACTGAT
GGGATGATTTTAGGACCAGAAGATCTGAGTTACCAAATATATGATGTTTCCGGAGAAAGCAATTCAGCAGTTTCTACAGAAGACCTAAAA
GAATGTCTGAAGAAACAATTAGAATTCTGTTTTTCACGGTACCTGAAAAACCTGCAGTTCCACCGCTTCTGGTCCGTGGATGACACGCAG
GTGCACACGGAATATAGCTCTCTGCGATCCATTGTGGTGGCCAACTATGAAGAGTCCATCAAGATGCCCATCAATGAGCCAGCGCCTGGC
AAGAAGAAGTCCCAGATCCAGGAATATGTGGACTATAACGGGGGCGCTGGGGTCCAGCACATCGCTCTCAAGACCGAAGACATCATCACA
GCGATTCGCCACTTGAGAGAGAGAGGCCTGGAGTTCTTATCTGTTCCCTCCACGTACTACAAACAACTGCGGGAGAAGCTGAAGACGGCC
AAGATCAAGGTGAAGGAGAACATTGATGCCCTGGAGGAGCTGAAAATCCTGGTGGACTACGACGAGAAAGGCTACCTCCTGCAGATCTTC
ACCAAACCGGTGCAGGACCGGCCCACGCTCTTCCTGGAAGTCATCCAGCGCCACAACCACCAGGGTTTTGGAGCCGGCAACTTCAACTCA

>In-frame_LARP4_ENST00000347328_chr12_50824353_+_HPD_ENST00000543163_chr12_122285120_-_984nt
ATGTTGCTTTTCGTGGAGCAGGTAGCATCTAAAGGAACTGGTTTAAATCCTAATGCCAAAGTATGGCAAGAAATTGCTCCTGGAAATACT
GATGCCACCCCAGTAACTCATGGAACTGAAAGCTCTTGGCATGAAATAGCAGCTACATCAGGTGCTCATCCTGAGGGTAATGCAGAGCTC
TCAGAAGATATATGTAAAGAATATGAAGTAATGTATTCTTCATCTTGTGAAACCACAAGAAATACTACAGGCATTGAAGAATCAACTGAT
GGGATGATTTTAGGACCAGAAGATCTGAGTTACCAAATATATGATGTTTCCGGAGAAAGCAATTCAGCAGTTTCTACAGAAGACCTAAAA
GAATGTCTGAAGAAACAATTAGAATTCTGTTTTTCACGGTACCTGAAAAACCTGCAGTTCCACCGCTTCTGGTCCGTGGATGACACGCAG
GTGCACACGGAATATAGCTCTCTGCGATCCATTGTGGTGGCCAACTATGAAGAGTCCATCAAGATGCCCATCAATGAGCCAGCGCCTGGC
AAGAAGAAGTCCCAGATCCAGGAATATGTGGACTATAACGGGGGCGCTGGGGTCCAGCACATCGCTCTCAAGACCGAAGACATCATCACA
GCGATTCGCCACTTGAGAGAGAGAGGCCTGGAGTTCTTATCTGTTCCCTCCACGTACTACAAACAACTGCGGGAGAAGCTGAAGACGGCC
AAGATCAAGGTGAAGGAGAACATTGATGCCCTGGAGGAGCTGAAAATCCTGGTGGACTACGACGAGAAAGGCTACCTCCTGCAGATCTTC
ACCAAACCGGTGCAGGACCGGCCCACGCTCTTCCTGGAAGTCATCCAGCGCCACAACCACCAGGGTTTTGGAGCCGGCAACTTCAACTCA

>In-frame_LARP4_ENST00000522085_chr12_50824353_+_HPD_ENST00000289004_chr12_122285120_-_984nt
ATGTTGCTTTTCGTGGAGCAGGTAGCATCTAAAGGAACTGGTTTAAATCCTAATGCCAAAGTATGGCAAGAAATTGCTCCTGGAAATACT
GATGCCACCCCAGTAACTCATGGAACTGAAAGCTCTTGGCATGAAATAGCAGCTACATCAGGTGCTCATCCTGAGGGTAATGCAGAGCTC
TCAGAAGATATATGTAAAGAATATGAAGTAATGTATTCTTCATCTTGTGAAACCACAAGAAATACTACAGGCATTGAAGAATCAACTGAT
GGGATGATTTTAGGACCAGAAGATCTGAGTTACCAAATATATGATGTTTCCGGAGAAAGCAATTCAGCAGTTTCTACAGAAGACCTAAAA
GAATGTCTGAAGAAACAATTAGAATTCTGTTTTTCACGGTACCTGAAAAACCTGCAGTTCCACCGCTTCTGGTCCGTGGATGACACGCAG
GTGCACACGGAATATAGCTCTCTGCGATCCATTGTGGTGGCCAACTATGAAGAGTCCATCAAGATGCCCATCAATGAGCCAGCGCCTGGC
AAGAAGAAGTCCCAGATCCAGGAATATGTGGACTATAACGGGGGCGCTGGGGTCCAGCACATCGCTCTCAAGACCGAAGACATCATCACA
GCGATTCGCCACTTGAGAGAGAGAGGCCTGGAGTTCTTATCTGTTCCCTCCACGTACTACAAACAACTGCGGGAGAAGCTGAAGACGGCC
AAGATCAAGGTGAAGGAGAACATTGATGCCCTGGAGGAGCTGAAAATCCTGGTGGACTACGACGAGAAAGGCTACCTCCTGCAGATCTTC
ACCAAACCGGTGCAGGACCGGCCCACGCTCTTCCTGGAAGTCATCCAGCGCCACAACCACCAGGGTTTTGGAGCCGGCAACTTCAACTCA

>In-frame_LARP4_ENST00000522085_chr12_50824353_+_HPD_ENST00000543163_chr12_122285120_-_984nt
ATGTTGCTTTTCGTGGAGCAGGTAGCATCTAAAGGAACTGGTTTAAATCCTAATGCCAAAGTATGGCAAGAAATTGCTCCTGGAAATACT
GATGCCACCCCAGTAACTCATGGAACTGAAAGCTCTTGGCATGAAATAGCAGCTACATCAGGTGCTCATCCTGAGGGTAATGCAGAGCTC
TCAGAAGATATATGTAAAGAATATGAAGTAATGTATTCTTCATCTTGTGAAACCACAAGAAATACTACAGGCATTGAAGAATCAACTGAT
GGGATGATTTTAGGACCAGAAGATCTGAGTTACCAAATATATGATGTTTCCGGAGAAAGCAATTCAGCAGTTTCTACAGAAGACCTAAAA
GAATGTCTGAAGAAACAATTAGAATTCTGTTTTTCACGGTACCTGAAAAACCTGCAGTTCCACCGCTTCTGGTCCGTGGATGACACGCAG
GTGCACACGGAATATAGCTCTCTGCGATCCATTGTGGTGGCCAACTATGAAGAGTCCATCAAGATGCCCATCAATGAGCCAGCGCCTGGC
AAGAAGAAGTCCCAGATCCAGGAATATGTGGACTATAACGGGGGCGCTGGGGTCCAGCACATCGCTCTCAAGACCGAAGACATCATCACA
GCGATTCGCCACTTGAGAGAGAGAGGCCTGGAGTTCTTATCTGTTCCCTCCACGTACTACAAACAACTGCGGGAGAAGCTGAAGACGGCC
AAGATCAAGGTGAAGGAGAACATTGATGCCCTGGAGGAGCTGAAAATCCTGGTGGACTACGACGAGAAAGGCTACCTCCTGCAGATCTTC
ACCAAACCGGTGCAGGACCGGCCCACGCTCTTCCTGGAAGTCATCCAGCGCCACAACCACCAGGGTTTTGGAGCCGGCAACTTCAACTCA

>In-frame_LARP4_ENST00000518561_chr12_50824353_+_HPD_ENST00000289004_chr12_122285120_-_774nt
ATGTATTCTTCATCTTGTGAAACCACAAGAAATACTACAGGCATTGAAGAATCAACTGATGGGATGATTTTAGGACCAGAAGATCTGAGT
TACCAAATATATGATGTTTCCGGAGAAAGCAATTCAGCAGTTTCTACAGAAGACCTAAAAGAATGTCTGAAGAAACAATTAGAATTCTGT
TTTTCACGGTACCTGAAAAACCTGCAGTTCCACCGCTTCTGGTCCGTGGATGACACGCAGGTGCACACGGAATATAGCTCTCTGCGATCC
ATTGTGGTGGCCAACTATGAAGAGTCCATCAAGATGCCCATCAATGAGCCAGCGCCTGGCAAGAAGAAGTCCCAGATCCAGGAATATGTG
GACTATAACGGGGGCGCTGGGGTCCAGCACATCGCTCTCAAGACCGAAGACATCATCACAGCGATTCGCCACTTGAGAGAGAGAGGCCTG
GAGTTCTTATCTGTTCCCTCCACGTACTACAAACAACTGCGGGAGAAGCTGAAGACGGCCAAGATCAAGGTGAAGGAGAACATTGATGCC
CTGGAGGAGCTGAAAATCCTGGTGGACTACGACGAGAAAGGCTACCTCCTGCAGATCTTCACCAAACCGGTGCAGGACCGGCCCACGCTC
TTCCTGGAAGTCATCCAGCGCCACAACCACCAGGGTTTTGGAGCCGGCAACTTCAACTCACTGTTCAAGGCTTTCGAGGAGGAGCAGAAC

>In-frame_LARP4_ENST00000518561_chr12_50824353_+_HPD_ENST00000543163_chr12_122285120_-_774nt
ATGTATTCTTCATCTTGTGAAACCACAAGAAATACTACAGGCATTGAAGAATCAACTGATGGGATGATTTTAGGACCAGAAGATCTGAGT
TACCAAATATATGATGTTTCCGGAGAAAGCAATTCAGCAGTTTCTACAGAAGACCTAAAAGAATGTCTGAAGAAACAATTAGAATTCTGT
TTTTCACGGTACCTGAAAAACCTGCAGTTCCACCGCTTCTGGTCCGTGGATGACACGCAGGTGCACACGGAATATAGCTCTCTGCGATCC
ATTGTGGTGGCCAACTATGAAGAGTCCATCAAGATGCCCATCAATGAGCCAGCGCCTGGCAAGAAGAAGTCCCAGATCCAGGAATATGTG
GACTATAACGGGGGCGCTGGGGTCCAGCACATCGCTCTCAAGACCGAAGACATCATCACAGCGATTCGCCACTTGAGAGAGAGAGGCCTG
GAGTTCTTATCTGTTCCCTCCACGTACTACAAACAACTGCGGGAGAAGCTGAAGACGGCCAAGATCAAGGTGAAGGAGAACATTGATGCC
CTGGAGGAGCTGAAAATCCTGGTGGACTACGACGAGAAAGGCTACCTCCTGCAGATCTTCACCAAACCGGTGCAGGACCGGCCCACGCTC
TTCCTGGAAGTCATCCAGCGCCACAACCACCAGGGTTTTGGAGCCGGCAACTTCAACTCACTGTTCAAGGCTTTCGAGGAGGAGCAGAAC


* Fusion transcript sequences (Full-length transcript).
>In-frame_LARP4_ENST00000293618_chr12_50824353_+_HPD_ENST00000289004_chr12_122285120_-_1387nt
AGACCCGGAAGCAGTTGTTGTTTCAAGGGAGGTGGGACTGGGCGGGTCAGGCCGCAGCGGCTGACGGCAGGGGAGGAGCCGGGTCCACTG
CCGGGTGGAGGGGCAAGGCGAGTGTGTGTCCTTATCCTAGCAATTGGGGCGCGGGCCTGTGAGCCAGTTGGAGTTGCGGCGGCGGGAACG
ATTGGGCTGAGCAGAGGACGACATGTTGCTTTTCGTGGAGCAGGTAGCATCTAAAGGAACTGGTTTAAATCCTAATGCCAAAGTATGGCA
AGAAATTGCTCCTGGAAATACTGATGCCACCCCAGTAACTCATGGAACTGAAAGCTCTTGGCATGAAATAGCAGCTACATCAGGTGCTCA
TCCTGAGGGTAATGCAGAGCTCTCAGAAGATATATGTAAAGAATATGAAGTAATGTATTCTTCATCTTGTGAAACCACAAGAAATACTAC
AGGCATTGAAGAATCAACTGATGGGATGATTTTAGGACCAGAAGATCTGAGTTACCAAATATATGATGTTTCCGGAGAAAGCAATTCAGC
AGTTTCTACAGAAGACCTAAAAGAATGTCTGAAGAAACAATTAGAATTCTGTTTTTCACGGTACCTGAAAAACCTGCAGTTCCACCGCTT
CTGGTCCGTGGATGACACGCAGGTGCACACGGAATATAGCTCTCTGCGATCCATTGTGGTGGCCAACTATGAAGAGTCCATCAAGATGCC
CATCAATGAGCCAGCGCCTGGCAAGAAGAAGTCCCAGATCCAGGAATATGTGGACTATAACGGGGGCGCTGGGGTCCAGCACATCGCTCT
CAAGACCGAAGACATCATCACAGCGATTCGCCACTTGAGAGAGAGAGGCCTGGAGTTCTTATCTGTTCCCTCCACGTACTACAAACAACT
GCGGGAGAAGCTGAAGACGGCCAAGATCAAGGTGAAGGAGAACATTGATGCCCTGGAGGAGCTGAAAATCCTGGTGGACTACGACGAGAA
AGGCTACCTCCTGCAGATCTTCACCAAACCGGTGCAGGACCGGCCCACGCTCTTCCTGGAAGTCATCCAGCGCCACAACCACCAGGGTTT
TGGAGCCGGCAACTTCAACTCACTGTTCAAGGCTTTCGAGGAGGAGCAGAACCTGCGGGGTAACCTCACCAACATGGAGACCAATGGGGT
GGTGCCCGGCATGTAAGCCCCGCCCACCCCACGGAGGCCACAGCCACACAGCCACGCCCCCTGATTCTGGAACTCGCCCAACTTCCCTAC
TGGCTGCTCCCCTTGGGTCCCGCCCACCAGCGGACTCGGCCCCCAAGGCTCCGCCCACACTGACCACGCCCCTCGGCGGGGCCGCCCTCT

>In-frame_LARP4_ENST00000293618_chr12_50824353_+_HPD_ENST00000543163_chr12_122285120_-_1384nt
AGACCCGGAAGCAGTTGTTGTTTCAAGGGAGGTGGGACTGGGCGGGTCAGGCCGCAGCGGCTGACGGCAGGGGAGGAGCCGGGTCCACTG
CCGGGTGGAGGGGCAAGGCGAGTGTGTGTCCTTATCCTAGCAATTGGGGCGCGGGCCTGTGAGCCAGTTGGAGTTGCGGCGGCGGGAACG
ATTGGGCTGAGCAGAGGACGACATGTTGCTTTTCGTGGAGCAGGTAGCATCTAAAGGAACTGGTTTAAATCCTAATGCCAAAGTATGGCA
AGAAATTGCTCCTGGAAATACTGATGCCACCCCAGTAACTCATGGAACTGAAAGCTCTTGGCATGAAATAGCAGCTACATCAGGTGCTCA
TCCTGAGGGTAATGCAGAGCTCTCAGAAGATATATGTAAAGAATATGAAGTAATGTATTCTTCATCTTGTGAAACCACAAGAAATACTAC
AGGCATTGAAGAATCAACTGATGGGATGATTTTAGGACCAGAAGATCTGAGTTACCAAATATATGATGTTTCCGGAGAAAGCAATTCAGC
AGTTTCTACAGAAGACCTAAAAGAATGTCTGAAGAAACAATTAGAATTCTGTTTTTCACGGTACCTGAAAAACCTGCAGTTCCACCGCTT
CTGGTCCGTGGATGACACGCAGGTGCACACGGAATATAGCTCTCTGCGATCCATTGTGGTGGCCAACTATGAAGAGTCCATCAAGATGCC
CATCAATGAGCCAGCGCCTGGCAAGAAGAAGTCCCAGATCCAGGAATATGTGGACTATAACGGGGGCGCTGGGGTCCAGCACATCGCTCT
CAAGACCGAAGACATCATCACAGCGATTCGCCACTTGAGAGAGAGAGGCCTGGAGTTCTTATCTGTTCCCTCCACGTACTACAAACAACT
GCGGGAGAAGCTGAAGACGGCCAAGATCAAGGTGAAGGAGAACATTGATGCCCTGGAGGAGCTGAAAATCCTGGTGGACTACGACGAGAA
AGGCTACCTCCTGCAGATCTTCACCAAACCGGTGCAGGACCGGCCCACGCTCTTCCTGGAAGTCATCCAGCGCCACAACCACCAGGGTTT
TGGAGCCGGCAACTTCAACTCACTGTTCAAGGCTTTCGAGGAGGAGCAGAACCTGCGGGGTAACCTCACCAACATGGAGACCAATGGGGT
GGTGCCCGGCATGTAAGCCCCGCCCACCCCACGGAGGCCACAGCCACACAGCCACGCCCCCTGATTCTGGAACTCGCCCAACTTCCCTAC
TGGCTGCTCCCCTTGGGTCCCGCCCACCAGCGGACTCGGCCCCCAAGGCTCCGCCCACACTGACCACGCCCCTCGGCGGGGCCGCCCTCT

>In-frame_LARP4_ENST00000429001_chr12_50824353_+_HPD_ENST00000289004_chr12_122285120_-_1357nt
AGGCCGCAGCGGCTGACGGCAGGGGAGGAGCCGGGTCCACTGCCGGGTGGAGGGGCAAGGCGAGTGTGTGTCCTTATCCTAGCAATTGGG
GCGCGGGCCTGTGAGCCAGTTGGAGTTGCGGCGGCGGGAACGATTGGGCTGAGCAGAGGACGACATGTTGCTTTTCGTGGAGCAGGTAGC
ATCTAAAGGAACTGGTTTAAATCCTAATGCCAAAGTATGGCAAGAAATTGCTCCTGGAAATACTGATGCCACCCCAGTAACTCATGGAAC
TGAAAGCTCTTGGCATGAAATAGCAGCTACATCAGGTGCTCATCCTGAGGTGTCTGTCTTTAATACAGGTAATGCAGAGCTCTCAGAAGA
TATATGTAAAGAATATGAAGTAATGTATTCTTCATCTTGTGAAACCACAAGAAATACTACAGGCATTGAAGAATCAACTGATGGGATGAT
TTTAGGACCAGAAGATCTGAGTTACCAAATATATGATGTTTCCGGAGAAAGCAATTCAGCAGTTTCTACAGAAGACCTAAAAGAATGTCT
GAAGAAACAATTAGAATTCTGTTTTTCACGGTACCTGAAAAACCTGCAGTTCCACCGCTTCTGGTCCGTGGATGACACGCAGGTGCACAC
GGAATATAGCTCTCTGCGATCCATTGTGGTGGCCAACTATGAAGAGTCCATCAAGATGCCCATCAATGAGCCAGCGCCTGGCAAGAAGAA
GTCCCAGATCCAGGAATATGTGGACTATAACGGGGGCGCTGGGGTCCAGCACATCGCTCTCAAGACCGAAGACATCATCACAGCGATTCG
CCACTTGAGAGAGAGAGGCCTGGAGTTCTTATCTGTTCCCTCCACGTACTACAAACAACTGCGGGAGAAGCTGAAGACGGCCAAGATCAA
GGTGAAGGAGAACATTGATGCCCTGGAGGAGCTGAAAATCCTGGTGGACTACGACGAGAAAGGCTACCTCCTGCAGATCTTCACCAAACC
GGTGCAGGACCGGCCCACGCTCTTCCTGGAAGTCATCCAGCGCCACAACCACCAGGGTTTTGGAGCCGGCAACTTCAACTCACTGTTCAA
GGCTTTCGAGGAGGAGCAGAACCTGCGGGGTAACCTCACCAACATGGAGACCAATGGGGTGGTGCCCGGCATGTAAGCCCCGCCCACCCC
ACGGAGGCCACAGCCACACAGCCACGCCCCCTGATTCTGGAACTCGCCCAACTTCCCTACTGGCTGCTCCCCTTGGGTCCCGCCCACCAG
CGGACTCGGCCCCCAAGGCTCCGCCCACACTGACCACGCCCCTCGGCGGGGCCGCCCTCTGCTCCAGCCCTCCCGATTAAAGCGTGCCCC

>In-frame_LARP4_ENST00000429001_chr12_50824353_+_HPD_ENST00000543163_chr12_122285120_-_1354nt
AGGCCGCAGCGGCTGACGGCAGGGGAGGAGCCGGGTCCACTGCCGGGTGGAGGGGCAAGGCGAGTGTGTGTCCTTATCCTAGCAATTGGG
GCGCGGGCCTGTGAGCCAGTTGGAGTTGCGGCGGCGGGAACGATTGGGCTGAGCAGAGGACGACATGTTGCTTTTCGTGGAGCAGGTAGC
ATCTAAAGGAACTGGTTTAAATCCTAATGCCAAAGTATGGCAAGAAATTGCTCCTGGAAATACTGATGCCACCCCAGTAACTCATGGAAC
TGAAAGCTCTTGGCATGAAATAGCAGCTACATCAGGTGCTCATCCTGAGGTGTCTGTCTTTAATACAGGTAATGCAGAGCTCTCAGAAGA
TATATGTAAAGAATATGAAGTAATGTATTCTTCATCTTGTGAAACCACAAGAAATACTACAGGCATTGAAGAATCAACTGATGGGATGAT
TTTAGGACCAGAAGATCTGAGTTACCAAATATATGATGTTTCCGGAGAAAGCAATTCAGCAGTTTCTACAGAAGACCTAAAAGAATGTCT
GAAGAAACAATTAGAATTCTGTTTTTCACGGTACCTGAAAAACCTGCAGTTCCACCGCTTCTGGTCCGTGGATGACACGCAGGTGCACAC
GGAATATAGCTCTCTGCGATCCATTGTGGTGGCCAACTATGAAGAGTCCATCAAGATGCCCATCAATGAGCCAGCGCCTGGCAAGAAGAA
GTCCCAGATCCAGGAATATGTGGACTATAACGGGGGCGCTGGGGTCCAGCACATCGCTCTCAAGACCGAAGACATCATCACAGCGATTCG
CCACTTGAGAGAGAGAGGCCTGGAGTTCTTATCTGTTCCCTCCACGTACTACAAACAACTGCGGGAGAAGCTGAAGACGGCCAAGATCAA
GGTGAAGGAGAACATTGATGCCCTGGAGGAGCTGAAAATCCTGGTGGACTACGACGAGAAAGGCTACCTCCTGCAGATCTTCACCAAACC
GGTGCAGGACCGGCCCACGCTCTTCCTGGAAGTCATCCAGCGCCACAACCACCAGGGTTTTGGAGCCGGCAACTTCAACTCACTGTTCAA
GGCTTTCGAGGAGGAGCAGAACCTGCGGGGTAACCTCACCAACATGGAGACCAATGGGGTGGTGCCCGGCATGTAAGCCCCGCCCACCCC
ACGGAGGCCACAGCCACACAGCCACGCCCCCTGATTCTGGAACTCGCCCAACTTCCCTACTGGCTGCTCCCCTTGGGTCCCGCCCACCAG
CGGACTCGGCCCCCAAGGCTCCGCCCACACTGACCACGCCCCTCGGCGGGGCCGCCCTCTGCTCCAGCCCTCCCGATTAAAGCGTGCCCC

>In-frame_LARP4_ENST00000398473_chr12_50824353_+_HPD_ENST00000289004_chr12_122285120_-_1297nt
CCGGGTGGAGGGGCAAGGCGAGTGTGTGTCCTTATCCTAGCAATTGGGGCGCGGGCCTGTGAGCCAGTTGGAGTTGCGGCGGCGGGAACG
ATTGGGCTGAGCAGAGGACGACATGTTGCTTTTCGTGGAGCAGGTAGCATCTAAAGGAACTGGTTTAAATCCTAATGCCAAAGTATGGCA
AGAAATTGCTCCTGGAAATACTGATGCCACCCCAGTAACTCATGGAACTGAAAGCTCTTGGCATGAAATAGCAGCTACATCAGGTGCTCA
TCCTGAGGGTAATGCAGAGCTCTCAGAAGATATATGTAAAGAATATGAAGTAATGTATTCTTCATCTTGTGAAACCACAAGAAATACTAC
AGGCATTGAAGAATCAACTGATGGGATGATTTTAGGACCAGAAGATCTGAGTTACCAAATATATGATGTTTCCGGAGAAAGCAATTCAGC
AGTTTCTACAGAAGACCTAAAAGAATGTCTGAAGAAACAATTAGAATTCTGTTTTTCACGGTACCTGAAAAACCTGCAGTTCCACCGCTT
CTGGTCCGTGGATGACACGCAGGTGCACACGGAATATAGCTCTCTGCGATCCATTGTGGTGGCCAACTATGAAGAGTCCATCAAGATGCC
CATCAATGAGCCAGCGCCTGGCAAGAAGAAGTCCCAGATCCAGGAATATGTGGACTATAACGGGGGCGCTGGGGTCCAGCACATCGCTCT
CAAGACCGAAGACATCATCACAGCGATTCGCCACTTGAGAGAGAGAGGCCTGGAGTTCTTATCTGTTCCCTCCACGTACTACAAACAACT
GCGGGAGAAGCTGAAGACGGCCAAGATCAAGGTGAAGGAGAACATTGATGCCCTGGAGGAGCTGAAAATCCTGGTGGACTACGACGAGAA
AGGCTACCTCCTGCAGATCTTCACCAAACCGGTGCAGGACCGGCCCACGCTCTTCCTGGAAGTCATCCAGCGCCACAACCACCAGGGTTT
TGGAGCCGGCAACTTCAACTCACTGTTCAAGGCTTTCGAGGAGGAGCAGAACCTGCGGGGTAACCTCACCAACATGGAGACCAATGGGGT
GGTGCCCGGCATGTAAGCCCCGCCCACCCCACGGAGGCCACAGCCACACAGCCACGCCCCCTGATTCTGGAACTCGCCCAACTTCCCTAC
TGGCTGCTCCCCTTGGGTCCCGCCCACCAGCGGACTCGGCCCCCAAGGCTCCGCCCACACTGACCACGCCCCTCGGCGGGGCCGCCCTCT

>In-frame_LARP4_ENST00000398473_chr12_50824353_+_HPD_ENST00000543163_chr12_122285120_-_1294nt
CCGGGTGGAGGGGCAAGGCGAGTGTGTGTCCTTATCCTAGCAATTGGGGCGCGGGCCTGTGAGCCAGTTGGAGTTGCGGCGGCGGGAACG
ATTGGGCTGAGCAGAGGACGACATGTTGCTTTTCGTGGAGCAGGTAGCATCTAAAGGAACTGGTTTAAATCCTAATGCCAAAGTATGGCA
AGAAATTGCTCCTGGAAATACTGATGCCACCCCAGTAACTCATGGAACTGAAAGCTCTTGGCATGAAATAGCAGCTACATCAGGTGCTCA
TCCTGAGGGTAATGCAGAGCTCTCAGAAGATATATGTAAAGAATATGAAGTAATGTATTCTTCATCTTGTGAAACCACAAGAAATACTAC
AGGCATTGAAGAATCAACTGATGGGATGATTTTAGGACCAGAAGATCTGAGTTACCAAATATATGATGTTTCCGGAGAAAGCAATTCAGC
AGTTTCTACAGAAGACCTAAAAGAATGTCTGAAGAAACAATTAGAATTCTGTTTTTCACGGTACCTGAAAAACCTGCAGTTCCACCGCTT
CTGGTCCGTGGATGACACGCAGGTGCACACGGAATATAGCTCTCTGCGATCCATTGTGGTGGCCAACTATGAAGAGTCCATCAAGATGCC
CATCAATGAGCCAGCGCCTGGCAAGAAGAAGTCCCAGATCCAGGAATATGTGGACTATAACGGGGGCGCTGGGGTCCAGCACATCGCTCT
CAAGACCGAAGACATCATCACAGCGATTCGCCACTTGAGAGAGAGAGGCCTGGAGTTCTTATCTGTTCCCTCCACGTACTACAAACAACT
GCGGGAGAAGCTGAAGACGGCCAAGATCAAGGTGAAGGAGAACATTGATGCCCTGGAGGAGCTGAAAATCCTGGTGGACTACGACGAGAA
AGGCTACCTCCTGCAGATCTTCACCAAACCGGTGCAGGACCGGCCCACGCTCTTCCTGGAAGTCATCCAGCGCCACAACCACCAGGGTTT
TGGAGCCGGCAACTTCAACTCACTGTTCAAGGCTTTCGAGGAGGAGCAGAACCTGCGGGGTAACCTCACCAACATGGAGACCAATGGGGT
GGTGCCCGGCATGTAAGCCCCGCCCACCCCACGGAGGCCACAGCCACACAGCCACGCCCCCTGATTCTGGAACTCGCCCAACTTCCCTAC
TGGCTGCTCCCCTTGGGTCCCGCCCACCAGCGGACTCGGCCCCCAAGGCTCCGCCCACACTGACCACGCCCCTCGGCGGGGCCGCCCTCT

>In-frame_LARP4_ENST00000518444_chr12_50824353_+_HPD_ENST00000289004_chr12_122285120_-_1264nt
CTTATCCTAGCAATTGGGGCGCGGGCCTGTGAGCCAGTTGGAGTTGCGGCGGCGGGAACGATTGGGCTGAGCAGAGGACGACATGTTGCT
TTTCGTGGAGGTAGCATCTAAAGGAACTGGTTTAAATCCTAATGCCAAAGTATGGCAAGAAATTGCTCCTGGAAATACTGATGCCACCCC
AGTAACTCATGGAACTGAAAGCTCTTGGCATGAAATAGCAGCTACATCAGGTGCTCATCCTGAGGGTAATGCAGAGCTCTCAGAAGATAT
ATGTAAAGAATATGAAGTAATGTATTCTTCATCTTGTGAAACCACAAGAAATACTACAGGCATTGAAGAATCAACTGATGGGATGATTTT
AGGACCAGAAGATCTGAGTTACCAAATATATGATGTTTCCGGAGAAAGCAATTCAGCAGTTTCTACAGAAGACCTAAAAGAATGTCTGAA
GAAACAATTAGAATTCTGTTTTTCACGGTACCTGAAAAACCTGCAGTTCCACCGCTTCTGGTCCGTGGATGACACGCAGGTGCACACGGA
ATATAGCTCTCTGCGATCCATTGTGGTGGCCAACTATGAAGAGTCCATCAAGATGCCCATCAATGAGCCAGCGCCTGGCAAGAAGAAGTC
CCAGATCCAGGAATATGTGGACTATAACGGGGGCGCTGGGGTCCAGCACATCGCTCTCAAGACCGAAGACATCATCACAGCGATTCGCCA
CTTGAGAGAGAGAGGCCTGGAGTTCTTATCTGTTCCCTCCACGTACTACAAACAACTGCGGGAGAAGCTGAAGACGGCCAAGATCAAGGT
GAAGGAGAACATTGATGCCCTGGAGGAGCTGAAAATCCTGGTGGACTACGACGAGAAAGGCTACCTCCTGCAGATCTTCACCAAACCGGT
GCAGGACCGGCCCACGCTCTTCCTGGAAGTCATCCAGCGCCACAACCACCAGGGTTTTGGAGCCGGCAACTTCAACTCACTGTTCAAGGC
TTTCGAGGAGGAGCAGAACCTGCGGGGTAACCTCACCAACATGGAGACCAATGGGGTGGTGCCCGGCATGTAAGCCCCGCCCACCCCACG
GAGGCCACAGCCACACAGCCACGCCCCCTGATTCTGGAACTCGCCCAACTTCCCTACTGGCTGCTCCCCTTGGGTCCCGCCCACCAGCGG
ACTCGGCCCCCAAGGCTCCGCCCACACTGACCACGCCCCTCGGCGGGGCCGCCCTCTGCTCCAGCCCTCCCGATTAAAGCGTGCCCCGGT

>In-frame_LARP4_ENST00000518444_chr12_50824353_+_HPD_ENST00000543163_chr12_122285120_-_1261nt
CTTATCCTAGCAATTGGGGCGCGGGCCTGTGAGCCAGTTGGAGTTGCGGCGGCGGGAACGATTGGGCTGAGCAGAGGACGACATGTTGCT
TTTCGTGGAGGTAGCATCTAAAGGAACTGGTTTAAATCCTAATGCCAAAGTATGGCAAGAAATTGCTCCTGGAAATACTGATGCCACCCC
AGTAACTCATGGAACTGAAAGCTCTTGGCATGAAATAGCAGCTACATCAGGTGCTCATCCTGAGGGTAATGCAGAGCTCTCAGAAGATAT
ATGTAAAGAATATGAAGTAATGTATTCTTCATCTTGTGAAACCACAAGAAATACTACAGGCATTGAAGAATCAACTGATGGGATGATTTT
AGGACCAGAAGATCTGAGTTACCAAATATATGATGTTTCCGGAGAAAGCAATTCAGCAGTTTCTACAGAAGACCTAAAAGAATGTCTGAA
GAAACAATTAGAATTCTGTTTTTCACGGTACCTGAAAAACCTGCAGTTCCACCGCTTCTGGTCCGTGGATGACACGCAGGTGCACACGGA
ATATAGCTCTCTGCGATCCATTGTGGTGGCCAACTATGAAGAGTCCATCAAGATGCCCATCAATGAGCCAGCGCCTGGCAAGAAGAAGTC
CCAGATCCAGGAATATGTGGACTATAACGGGGGCGCTGGGGTCCAGCACATCGCTCTCAAGACCGAAGACATCATCACAGCGATTCGCCA
CTTGAGAGAGAGAGGCCTGGAGTTCTTATCTGTTCCCTCCACGTACTACAAACAACTGCGGGAGAAGCTGAAGACGGCCAAGATCAAGGT
GAAGGAGAACATTGATGCCCTGGAGGAGCTGAAAATCCTGGTGGACTACGACGAGAAAGGCTACCTCCTGCAGATCTTCACCAAACCGGT
GCAGGACCGGCCCACGCTCTTCCTGGAAGTCATCCAGCGCCACAACCACCAGGGTTTTGGAGCCGGCAACTTCAACTCACTGTTCAAGGC
TTTCGAGGAGGAGCAGAACCTGCGGGGTAACCTCACCAACATGGAGACCAATGGGGTGGTGCCCGGCATGTAAGCCCCGCCCACCCCACG
GAGGCCACAGCCACACAGCCACGCCCCCTGATTCTGGAACTCGCCCAACTTCCCTACTGGCTGCTCCCCTTGGGTCCCGCCCACCAGCGG
ACTCGGCCCCCAAGGCTCCGCCCACACTGACCACGCCCCTCGGCGGGGCCGCCCTCTGCTCCAGCCCTCCCGATTAAAGCGTGCCCCGGT

>In-frame_LARP4_ENST00000347328_chr12_50824353_+_HPD_ENST00000289004_chr12_122285120_-_1211nt
AACGATTGGGCTGAGCAGAGGACGACATGTTGCTTTTCGTGGAGCAGGTAGCATCTAAAGGAACTGGTTTAAATCCTAATGCCAAAGTAT
GGCAAGAAATTGCTCCTGGAAATACTGATGCCACCCCAGTAACTCATGGAACTGAAAGCTCTTGGCATGAAATAGCAGCTACATCAGGTG
CTCATCCTGAGGGTAATGCAGAGCTCTCAGAAGATATATGTAAAGAATATGAAGTAATGTATTCTTCATCTTGTGAAACCACAAGAAATA
CTACAGGCATTGAAGAATCAACTGATGGGATGATTTTAGGACCAGAAGATCTGAGTTACCAAATATATGATGTTTCCGGAGAAAGCAATT
CAGCAGTTTCTACAGAAGACCTAAAAGAATGTCTGAAGAAACAATTAGAATTCTGTTTTTCACGGTACCTGAAAAACCTGCAGTTCCACC
GCTTCTGGTCCGTGGATGACACGCAGGTGCACACGGAATATAGCTCTCTGCGATCCATTGTGGTGGCCAACTATGAAGAGTCCATCAAGA
TGCCCATCAATGAGCCAGCGCCTGGCAAGAAGAAGTCCCAGATCCAGGAATATGTGGACTATAACGGGGGCGCTGGGGTCCAGCACATCG
CTCTCAAGACCGAAGACATCATCACAGCGATTCGCCACTTGAGAGAGAGAGGCCTGGAGTTCTTATCTGTTCCCTCCACGTACTACAAAC
AACTGCGGGAGAAGCTGAAGACGGCCAAGATCAAGGTGAAGGAGAACATTGATGCCCTGGAGGAGCTGAAAATCCTGGTGGACTACGACG
AGAAAGGCTACCTCCTGCAGATCTTCACCAAACCGGTGCAGGACCGGCCCACGCTCTTCCTGGAAGTCATCCAGCGCCACAACCACCAGG
GTTTTGGAGCCGGCAACTTCAACTCACTGTTCAAGGCTTTCGAGGAGGAGCAGAACCTGCGGGGTAACCTCACCAACATGGAGACCAATG
GGGTGGTGCCCGGCATGTAAGCCCCGCCCACCCCACGGAGGCCACAGCCACACAGCCACGCCCCCTGATTCTGGAACTCGCCCAACTTCC
CTACTGGCTGCTCCCCTTGGGTCCCGCCCACCAGCGGACTCGGCCCCCAAGGCTCCGCCCACACTGACCACGCCCCTCGGCGGGGCCGCC

>In-frame_LARP4_ENST00000347328_chr12_50824353_+_HPD_ENST00000543163_chr12_122285120_-_1208nt
AACGATTGGGCTGAGCAGAGGACGACATGTTGCTTTTCGTGGAGCAGGTAGCATCTAAAGGAACTGGTTTAAATCCTAATGCCAAAGTAT
GGCAAGAAATTGCTCCTGGAAATACTGATGCCACCCCAGTAACTCATGGAACTGAAAGCTCTTGGCATGAAATAGCAGCTACATCAGGTG
CTCATCCTGAGGGTAATGCAGAGCTCTCAGAAGATATATGTAAAGAATATGAAGTAATGTATTCTTCATCTTGTGAAACCACAAGAAATA
CTACAGGCATTGAAGAATCAACTGATGGGATGATTTTAGGACCAGAAGATCTGAGTTACCAAATATATGATGTTTCCGGAGAAAGCAATT
CAGCAGTTTCTACAGAAGACCTAAAAGAATGTCTGAAGAAACAATTAGAATTCTGTTTTTCACGGTACCTGAAAAACCTGCAGTTCCACC
GCTTCTGGTCCGTGGATGACACGCAGGTGCACACGGAATATAGCTCTCTGCGATCCATTGTGGTGGCCAACTATGAAGAGTCCATCAAGA
TGCCCATCAATGAGCCAGCGCCTGGCAAGAAGAAGTCCCAGATCCAGGAATATGTGGACTATAACGGGGGCGCTGGGGTCCAGCACATCG
CTCTCAAGACCGAAGACATCATCACAGCGATTCGCCACTTGAGAGAGAGAGGCCTGGAGTTCTTATCTGTTCCCTCCACGTACTACAAAC
AACTGCGGGAGAAGCTGAAGACGGCCAAGATCAAGGTGAAGGAGAACATTGATGCCCTGGAGGAGCTGAAAATCCTGGTGGACTACGACG
AGAAAGGCTACCTCCTGCAGATCTTCACCAAACCGGTGCAGGACCGGCCCACGCTCTTCCTGGAAGTCATCCAGCGCCACAACCACCAGG
GTTTTGGAGCCGGCAACTTCAACTCACTGTTCAAGGCTTTCGAGGAGGAGCAGAACCTGCGGGGTAACCTCACCAACATGGAGACCAATG
GGGTGGTGCCCGGCATGTAAGCCCCGCCCACCCCACGGAGGCCACAGCCACACAGCCACGCCCCCTGATTCTGGAACTCGCCCAACTTCC
CTACTGGCTGCTCCCCTTGGGTCCCGCCCACCAGCGGACTCGGCCCCCAAGGCTCCGCCCACACTGACCACGCCCCTCGGCGGGGCCGCC

>In-frame_LARP4_ENST00000522085_chr12_50824353_+_HPD_ENST00000289004_chr12_122285120_-_1288nt
GGGGCAAGGCGAGTGTGTGTCCTTATCCTAGCAATTGGGGCGCGGGCCTGTGAGCCAGTTGGAGTTGCGGCGGCGGGAACGATTGGGCTG
AGCAGAGGACGACATGTTGCTTTTCGTGGAGCAGGTAGCATCTAAAGGAACTGGTTTAAATCCTAATGCCAAAGTATGGCAAGAAATTGC
TCCTGGAAATACTGATGCCACCCCAGTAACTCATGGAACTGAAAGCTCTTGGCATGAAATAGCAGCTACATCAGGTGCTCATCCTGAGGG
TAATGCAGAGCTCTCAGAAGATATATGTAAAGAATATGAAGTAATGTATTCTTCATCTTGTGAAACCACAAGAAATACTACAGGCATTGA
AGAATCAACTGATGGGATGATTTTAGGACCAGAAGATCTGAGTTACCAAATATATGATGTTTCCGGAGAAAGCAATTCAGCAGTTTCTAC
AGAAGACCTAAAAGAATGTCTGAAGAAACAATTAGAATTCTGTTTTTCACGGTACCTGAAAAACCTGCAGTTCCACCGCTTCTGGTCCGT
GGATGACACGCAGGTGCACACGGAATATAGCTCTCTGCGATCCATTGTGGTGGCCAACTATGAAGAGTCCATCAAGATGCCCATCAATGA
GCCAGCGCCTGGCAAGAAGAAGTCCCAGATCCAGGAATATGTGGACTATAACGGGGGCGCTGGGGTCCAGCACATCGCTCTCAAGACCGA
AGACATCATCACAGCGATTCGCCACTTGAGAGAGAGAGGCCTGGAGTTCTTATCTGTTCCCTCCACGTACTACAAACAACTGCGGGAGAA
GCTGAAGACGGCCAAGATCAAGGTGAAGGAGAACATTGATGCCCTGGAGGAGCTGAAAATCCTGGTGGACTACGACGAGAAAGGCTACCT
CCTGCAGATCTTCACCAAACCGGTGCAGGACCGGCCCACGCTCTTCCTGGAAGTCATCCAGCGCCACAACCACCAGGGTTTTGGAGCCGG
CAACTTCAACTCACTGTTCAAGGCTTTCGAGGAGGAGCAGAACCTGCGGGGTAACCTCACCAACATGGAGACCAATGGGGTGGTGCCCGG
CATGTAAGCCCCGCCCACCCCACGGAGGCCACAGCCACACAGCCACGCCCCCTGATTCTGGAACTCGCCCAACTTCCCTACTGGCTGCTC
CCCTTGGGTCCCGCCCACCAGCGGACTCGGCCCCCAAGGCTCCGCCCACACTGACCACGCCCCTCGGCGGGGCCGCCCTCTGCTCCAGCC

>In-frame_LARP4_ENST00000522085_chr12_50824353_+_HPD_ENST00000543163_chr12_122285120_-_1285nt
GGGGCAAGGCGAGTGTGTGTCCTTATCCTAGCAATTGGGGCGCGGGCCTGTGAGCCAGTTGGAGTTGCGGCGGCGGGAACGATTGGGCTG
AGCAGAGGACGACATGTTGCTTTTCGTGGAGCAGGTAGCATCTAAAGGAACTGGTTTAAATCCTAATGCCAAAGTATGGCAAGAAATTGC
TCCTGGAAATACTGATGCCACCCCAGTAACTCATGGAACTGAAAGCTCTTGGCATGAAATAGCAGCTACATCAGGTGCTCATCCTGAGGG
TAATGCAGAGCTCTCAGAAGATATATGTAAAGAATATGAAGTAATGTATTCTTCATCTTGTGAAACCACAAGAAATACTACAGGCATTGA
AGAATCAACTGATGGGATGATTTTAGGACCAGAAGATCTGAGTTACCAAATATATGATGTTTCCGGAGAAAGCAATTCAGCAGTTTCTAC
AGAAGACCTAAAAGAATGTCTGAAGAAACAATTAGAATTCTGTTTTTCACGGTACCTGAAAAACCTGCAGTTCCACCGCTTCTGGTCCGT
GGATGACACGCAGGTGCACACGGAATATAGCTCTCTGCGATCCATTGTGGTGGCCAACTATGAAGAGTCCATCAAGATGCCCATCAATGA
GCCAGCGCCTGGCAAGAAGAAGTCCCAGATCCAGGAATATGTGGACTATAACGGGGGCGCTGGGGTCCAGCACATCGCTCTCAAGACCGA
AGACATCATCACAGCGATTCGCCACTTGAGAGAGAGAGGCCTGGAGTTCTTATCTGTTCCCTCCACGTACTACAAACAACTGCGGGAGAA
GCTGAAGACGGCCAAGATCAAGGTGAAGGAGAACATTGATGCCCTGGAGGAGCTGAAAATCCTGGTGGACTACGACGAGAAAGGCTACCT
CCTGCAGATCTTCACCAAACCGGTGCAGGACCGGCCCACGCTCTTCCTGGAAGTCATCCAGCGCCACAACCACCAGGGTTTTGGAGCCGG
CAACTTCAACTCACTGTTCAAGGCTTTCGAGGAGGAGCAGAACCTGCGGGGTAACCTCACCAACATGGAGACCAATGGGGTGGTGCCCGG
CATGTAAGCCCCGCCCACCCCACGGAGGCCACAGCCACACAGCCACGCCCCCTGATTCTGGAACTCGCCCAACTTCCCTACTGGCTGCTC
CCCTTGGGTCCCGCCCACCAGCGGACTCGGCCCCCAAGGCTCCGCCCACACTGACCACGCCCCTCGGCGGGGCCGCCCTCTGCTCCAGCC

>In-frame_LARP4_ENST00000518561_chr12_50824353_+_HPD_ENST00000289004_chr12_122285120_-_1289nt
TGTGAGCCAGTTGGAGTTGCGGCGGCGGGAACGATTGGGCTGAGCAGAGGACGACATGTTGCTTTTCGTGGAGCATTTATGGGGTTAAGT
GGCATGGGATTTCTGTTTCTGATAGTAAATAGCAGGTAGCATCTAAAGGAACTGGTTTAAATCCTAATGCCAAAGTATGGCAAGAAATTG
CTCCTGGAAATACTGATGCCACCCCAGTAACTCATGGAACTGAAAGCTCTTGGCATGAAATAGCAGCTACATCAGGTGCTCATCCTGAGG
GTAATGCAGAGCTCTCAGAAGATATATGTAAAGAATATGAAGTAATGTATTCTTCATCTTGTGAAACCACAAGAAATACTACAGGCATTG
AAGAATCAACTGATGGGATGATTTTAGGACCAGAAGATCTGAGTTACCAAATATATGATGTTTCCGGAGAAAGCAATTCAGCAGTTTCTA
CAGAAGACCTAAAAGAATGTCTGAAGAAACAATTAGAATTCTGTTTTTCACGGTACCTGAAAAACCTGCAGTTCCACCGCTTCTGGTCCG
TGGATGACACGCAGGTGCACACGGAATATAGCTCTCTGCGATCCATTGTGGTGGCCAACTATGAAGAGTCCATCAAGATGCCCATCAATG
AGCCAGCGCCTGGCAAGAAGAAGTCCCAGATCCAGGAATATGTGGACTATAACGGGGGCGCTGGGGTCCAGCACATCGCTCTCAAGACCG
AAGACATCATCACAGCGATTCGCCACTTGAGAGAGAGAGGCCTGGAGTTCTTATCTGTTCCCTCCACGTACTACAAACAACTGCGGGAGA
AGCTGAAGACGGCCAAGATCAAGGTGAAGGAGAACATTGATGCCCTGGAGGAGCTGAAAATCCTGGTGGACTACGACGAGAAAGGCTACC
TCCTGCAGATCTTCACCAAACCGGTGCAGGACCGGCCCACGCTCTTCCTGGAAGTCATCCAGCGCCACAACCACCAGGGTTTTGGAGCCG
GCAACTTCAACTCACTGTTCAAGGCTTTCGAGGAGGAGCAGAACCTGCGGGGTAACCTCACCAACATGGAGACCAATGGGGTGGTGCCCG
GCATGTAAGCCCCGCCCACCCCACGGAGGCCACAGCCACACAGCCACGCCCCCTGATTCTGGAACTCGCCCAACTTCCCTACTGGCTGCT
CCCCTTGGGTCCCGCCCACCAGCGGACTCGGCCCCCAAGGCTCCGCCCACACTGACCACGCCCCTCGGCGGGGCCGCCCTCTGCTCCAGC

>In-frame_LARP4_ENST00000518561_chr12_50824353_+_HPD_ENST00000543163_chr12_122285120_-_1286nt
TGTGAGCCAGTTGGAGTTGCGGCGGCGGGAACGATTGGGCTGAGCAGAGGACGACATGTTGCTTTTCGTGGAGCATTTATGGGGTTAAGT
GGCATGGGATTTCTGTTTCTGATAGTAAATAGCAGGTAGCATCTAAAGGAACTGGTTTAAATCCTAATGCCAAAGTATGGCAAGAAATTG
CTCCTGGAAATACTGATGCCACCCCAGTAACTCATGGAACTGAAAGCTCTTGGCATGAAATAGCAGCTACATCAGGTGCTCATCCTGAGG
GTAATGCAGAGCTCTCAGAAGATATATGTAAAGAATATGAAGTAATGTATTCTTCATCTTGTGAAACCACAAGAAATACTACAGGCATTG
AAGAATCAACTGATGGGATGATTTTAGGACCAGAAGATCTGAGTTACCAAATATATGATGTTTCCGGAGAAAGCAATTCAGCAGTTTCTA
CAGAAGACCTAAAAGAATGTCTGAAGAAACAATTAGAATTCTGTTTTTCACGGTACCTGAAAAACCTGCAGTTCCACCGCTTCTGGTCCG
TGGATGACACGCAGGTGCACACGGAATATAGCTCTCTGCGATCCATTGTGGTGGCCAACTATGAAGAGTCCATCAAGATGCCCATCAATG
AGCCAGCGCCTGGCAAGAAGAAGTCCCAGATCCAGGAATATGTGGACTATAACGGGGGCGCTGGGGTCCAGCACATCGCTCTCAAGACCG
AAGACATCATCACAGCGATTCGCCACTTGAGAGAGAGAGGCCTGGAGTTCTTATCTGTTCCCTCCACGTACTACAAACAACTGCGGGAGA
AGCTGAAGACGGCCAAGATCAAGGTGAAGGAGAACATTGATGCCCTGGAGGAGCTGAAAATCCTGGTGGACTACGACGAGAAAGGCTACC
TCCTGCAGATCTTCACCAAACCGGTGCAGGACCGGCCCACGCTCTTCCTGGAAGTCATCCAGCGCCACAACCACCAGGGTTTTGGAGCCG
GCAACTTCAACTCACTGTTCAAGGCTTTCGAGGAGGAGCAGAACCTGCGGGGTAACCTCACCAACATGGAGACCAATGGGGTGGTGCCCG
GCATGTAAGCCCCGCCCACCCCACGGAGGCCACAGCCACACAGCCACGCCCCCTGATTCTGGAACTCGCCCAACTTCCCTACTGGCTGCT
CCCCTTGGGTCCCGCCCACCAGCGGACTCGGCCCCCAAGGCTCCGCCCACACTGACCACGCCCCTCGGCGGGGCCGCCCTCTGCTCCAGC


Top

FusionGenePPI for LARP4_HPD


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
LARP4ELAVL1, SIRT7, CUL3, COPS6, APP, MPG, TARDBP, LIN28A, LIN28B, CRX, BHLHE40, EGFR, GNB2L1, NTRK1, MYO1C, NPM1, RPL10, AKAP1, RNF126, G3BP1HPDHIVEP1, CDKN1A, IKBKG, HRSP12, ASPSCR1, RBMX


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
HgeneLARP4chr12:50824353chr12:122285120ENST00000293618+41513_22132654PABPC1
HgeneLARP4chr12:50824353chr12:122285120ENST00000347328+41513_22132654PABPC1
HgeneLARP4chr12:50824353chr12:122285120ENST00000398473+41613_22132725PABPC1
HgeneLARP4chr12:50824353chr12:122285120ENST00000429001+41613_22138731PABPC1
HgeneLARP4chr12:50824353chr12:122285120ENST00000518444+41613_22131724PABPC1
HgeneLARP4chr12:50824353chr12:122285120ENST00000522085+41113_22132446PABPC1


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneLARP4chr12:50824353chr12:122285120ENST00000293618+415111_303132654the poly-A tract of mRNA
HgeneLARP4chr12:50824353chr12:122285120ENST00000347328+415111_303132654the poly-A tract of mRNA
HgeneLARP4chr12:50824353chr12:122285120ENST00000398473+416111_303132725the poly-A tract of mRNA
HgeneLARP4chr12:50824353chr12:122285120ENST00000429001+416111_303138731the poly-A tract of mRNA
HgeneLARP4chr12:50824353chr12:122285120ENST00000518444+416111_303131724the poly-A tract of mRNA
HgeneLARP4chr12:50824353chr12:122285120ENST00000522085+411111_303132446the poly-A tract of mRNA


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for LARP4_HPD


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
TgeneHPDP32754DB00348Nitisinone4-hydroxyphenylpyruvate dioxygenasesmall moleculeapproved|investigational

Top

RelatedDiseases for LARP4_HPD


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneLARP4C0032460Polycystic Ovary Syndrome1CTD_human
TgeneHPDC0268623Tyrosinemia, Type III2ORPHANET;UNIPROT
TgeneHPDC4277682Chemical and Drug Induced Liver Injury2CTD_human