FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 19385

FusionGeneSummary for LAMB1_PARP14

check button Fusion gene summary
Fusion gene informationFusion gene name: LAMB1_PARP14
Fusion gene ID: 19385
HgeneTgene
Gene symbol

LAMB1

PARP14

Gene ID

3912

54625

Gene namelaminin subunit beta 1poly(ADP-ribose) polymerase family member 14
SynonymsCLM|LIS5ARTD8|BAL2|PARP-14|pART8
Cytomap

7q31.1

3q21.1

Type of geneprotein-codingprotein-coding
Descriptionlaminin subunit beta-1laminin B1 chainlaminin, beta 1poly [ADP-ribose] polymerase 14ADP-ribosyltransferase diphtheria toxin-like 8B-aggressive lymphoma 2b aggressive lymphoma protein 2collaborator of STAT6
Modification date2018052220180519
UniProtAcc

P07942

Q460N5

Ensembl transtripts involved in fusion geneENST00000393561, ENST00000222399, 
ENST00000393560, ENST00000474380, 
ENST00000474629, ENST00000475640, 
Fusion gene scores* DoF score10 X 8 X 4=3205 X 6 X 2=60
# samples 106
** MAII scorelog2(10/320*10)=-1.67807190511264
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(6/60*10)=0
Context

PubMed: LAMB1 [Title/Abstract] AND PARP14 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneLAMB1

GO:0030335

positive regulation of cell migration

16289578

HgeneLAMB1

GO:0031175

neuron projection development

15894315

HgeneLAMB1

GO:0034446

substrate adhesion-dependent cell spreading

16236823

HgeneLAMB1

GO:0042476

odontogenesis

15894315

TgenePARP14

GO:0006471

protein ADP-ribosylation

27796300


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBRCATCGA-C8-A134-01ALAMB1chr7

107635332

-PARP14chr3

122446659

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000393561ENST00000474629LAMB1chr7

107635332

-PARP14chr3

122446659

+
5CDS-intronENST00000393561ENST00000475640LAMB1chr7

107635332

-PARP14chr3

122446659

+
Frame-shiftENST00000222399ENST00000474629LAMB1chr7

107635332

-PARP14chr3

122446659

+
5CDS-intronENST00000222399ENST00000475640LAMB1chr7

107635332

-PARP14chr3

122446659

+
Frame-shiftENST00000393560ENST00000474629LAMB1chr7

107635332

-PARP14chr3

122446659

+
5CDS-intronENST00000393560ENST00000475640LAMB1chr7

107635332

-PARP14chr3

122446659

+
intron-3CDSENST00000474380ENST00000474629LAMB1chr7

107635332

-PARP14chr3

122446659

+
intron-intronENST00000474380ENST00000475640LAMB1chr7

107635332

-PARP14chr3

122446659

+

Top

FusionProtFeatures for LAMB1_PARP14


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
LAMB1

P07942

PARP14

Q460N5

Binding to cells via a high affinity receptor, lamininis thought to mediate the attachment, migration and organizationof cells into tissues during embryonic development by interactingwith other extracellular matrix components. Involved in theorganization of the laminar architecture of cerebral cortex. It isprobably required for the integrity of the basement membrane/glialimitans that serves as an anchor point for the endfeet of radialglial cells and as a physical barrier to migrating neurons. Radialglial cells play a central role in cerebral cortical development,where they act both as the proliferative unit of the cerebralcortex and a scaffold for neurons migrating toward the pialsurface. {ECO:0000269|PubMed:23472759}. ADP-ribosyltransferase (PubMed:16061477,PubMed:27796300). By mono-ADP-ribosylating STAT1 at 'Glu-657' and'Glu-705' and thus decreasing STAT1 phosphorylation, negativelyregulates pro-inflammatory cytokines production in macrophages inresponse to IFNG stimulation (PubMed:27796300). Mono-ADP-ribosylates STAT6 (By similarity). Enhances STAT6-dependenttranscription (By similarity). In macrophages, positivelyregulates MRC1 expression in response to IL4 stimulation bypromoting STAT6 phosphorylation (PubMed:27796300). Mono-ADP-ribosylates PARP9 (PubMed:27796300).{ECO:0000250|UniProtKB:Q2EMV9, ECO:0000269|PubMed:16061477,ECO:0000269|PubMed:27796300}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneLAMB1chr7:107635332chr3:122446659ENST00000222399-5341216_13151411787Coiled coilOntology_term=ECO:0000255
HgeneLAMB1chr7:107635332chr3:122446659ENST00000222399-5341353_13881411787Coiled coilOntology_term=ECO:0000255
HgeneLAMB1chr7:107635332chr3:122446659ENST00000222399-5341442_17811411787Coiled coilOntology_term=ECO:0000255
HgeneLAMB1chr7:107635332chr3:122446659ENST00000222399-5341028_10831411787DomainLaminin EGF-like 11
HgeneLAMB1chr7:107635332chr3:122446659ENST00000222399-5341084_11311411787DomainLaminin EGF-like 12
HgeneLAMB1chr7:107635332chr3:122446659ENST00000222399-5341132_11781411787DomainLaminin EGF-like 13
HgeneLAMB1chr7:107635332chr3:122446659ENST00000222399-534271_3341411787DomainLaminin EGF-like 1
HgeneLAMB1chr7:107635332chr3:122446659ENST00000222399-53431_2701411787DomainLaminin N-terminal
HgeneLAMB1chr7:107635332chr3:122446659ENST00000222399-534335_3971411787DomainLaminin EGF-like 2
HgeneLAMB1chr7:107635332chr3:122446659ENST00000222399-534398_4571411787DomainLaminin EGF-like 3
HgeneLAMB1chr7:107635332chr3:122446659ENST00000222399-534458_5091411787DomainLaminin EGF-like 4
HgeneLAMB1chr7:107635332chr3:122446659ENST00000222399-534510_5401411787DomainLaminin EGF-like 5%3B truncated
HgeneLAMB1chr7:107635332chr3:122446659ENST00000222399-534549_7671411787DomainLaminin IV type B
HgeneLAMB1chr7:107635332chr3:122446659ENST00000222399-534773_8201411787DomainLaminin EGF-like 6
HgeneLAMB1chr7:107635332chr3:122446659ENST00000222399-534821_8661411787DomainLaminin EGF-like 7
HgeneLAMB1chr7:107635332chr3:122446659ENST00000222399-534867_9161411787DomainLaminin EGF-like 8
HgeneLAMB1chr7:107635332chr3:122446659ENST00000222399-534917_9751411787DomainLaminin EGF-like 9
HgeneLAMB1chr7:107635332chr3:122446659ENST00000222399-534976_10271411787DomainLaminin EGF-like 10
HgeneLAMB1chr7:107635332chr3:122446659ENST00000222399-5341179_13971411787RegionNote=Domain II
HgeneLAMB1chr7:107635332chr3:122446659ENST00000222399-5341398_14301411787RegionNote=Domain alpha
HgeneLAMB1chr7:107635332chr3:122446659ENST00000222399-5341431_17861411787RegionNote=Domain I
TgenePARP14chr7:107635332chr3:122446659ENST00000474629+14171003_119016471802DomainMacro 2
TgenePARP14chr7:107635332chr3:122446659ENST00000474629+14171216_138716471802DomainMacro 3
TgenePARP14chr7:107635332chr3:122446659ENST00000474629+14171523_160116471802DomainWWE
TgenePARP14chr7:107635332chr3:122446659ENST00000474629+14171605_180116471802DomainPARP catalytic
TgenePARP14chr7:107635332chr3:122446659ENST00000474629+1417791_97816471802DomainMacro 1
TgenePARP14chr7:107635332chr3:122446659ENST00000474629+14171023_102416471802RegionSubstrate 2 binding
TgenePARP14chr7:107635332chr3:122446659ENST00000474629+14171046_104916471802RegionSubstrate 2 binding
TgenePARP14chr7:107635332chr3:122446659ENST00000474629+14171133_113716471802RegionSubstrate 2 binding
TgenePARP14chr7:107635332chr3:122446659ENST00000474629+14171175_117816471802RegionSubstrate 2 binding
TgenePARP14chr7:107635332chr3:122446659ENST00000474629+14171235_123616471802RegionSubstrate 3 binding
TgenePARP14chr7:107635332chr3:122446659ENST00000474629+14171332_133616471802RegionSubstrate 3 binding
TgenePARP14chr7:107635332chr3:122446659ENST00000474629+1417922_92616471802RegionSubstrate 1 binding


Top

FusionGeneSequence for LAMB1_PARP14


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_LAMB1_ENST00000393561_chr7_107635332_-_PARP14_ENST00000474629_chr3_122446659_+_320aa
MDCPLSAPTPPPPLVRFFRAPLPACVPPTLLPVLPAALCRARVRAQEPEFSYGCAEGSCYPATGDLLIGRAQKLSVTSTCGLHKPEPYCI
VSHLQEDKKCFICNSQDPYHETLNPDSHLIENVVTTFAPNRLKIWWQSENGVENVTIQLDLEAEFHFTHLIMTFKIERIQNPDLWNSYQA
KKKTMDAKNGQTMNEKQLFHGTDAGSVPHVNRNGFNRSYAGKNAVAYGKGTYFAVNANYSANDTYSRPDANGRKHVYYVRVLTGIYTHGN


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_LAMB1_ENST00000393561_chr7_107635332_-_PARP14_ENST00000474629_chr3_122446659_+_960nt
ATGGACTGTCCTCTCTCCGCACCCACTCCCCCGCCCCCGCTTGTTCGTTTTTTTCGGGCTCCACTCCCTGCTTGTGTCCCCCCAACTCTG
TTGCCTGTCCTTCCCGCAGCCCTGTGCAGAGCCCGAGTGCGCGCTCAGGAACCCGAGTTCAGCTACGGCTGCGCAGAAGGCAGCTGCTAT
CCCGCCACGGGCGACCTTCTCATCGGCCGAGCACAGAAGCTTTCGGTGACCTCGACGTGCGGGCTGCACAAGCCCGAACCCTACTGTATC
GTCAGCCACTTGCAGGAGGACAAAAAATGCTTCATATGCAATTCCCAAGATCCTTATCATGAGACCCTGAATCCTGACAGCCATCTCATT
GAAAATGTGGTCACTACATTTGCTCCAAACCGCCTTAAGATTTGGTGGCAATCTGAAAATGGTGTGGAAAATGTAACTATCCAACTGGAT
TTGGAAGCAGAATTCCATTTTACTCATCTCATAATGACTTTCAAGATTGAGAGGATCCAGAATCCAGATCTCTGGAATAGCTACCAGGCA
AAGAAAAAAACTATGGATGCCAAGAATGGCCAGACAATGAATGAGAAGCAACTCTTCCATGGGACAGATGCCGGCTCCGTGCCACACGTC
AATCGAAATGGCTTTAACCGCAGCTATGCCGGAAAGAATGCTGTGGCATATGGAAAGGGAACCTATTTTGCTGTCAATGCCAATTATTCT
GCCAATGATACGTACTCCAGACCAGATGCAAATGGGAGAAAGCATGTGTATTATGTGCGAGTACTTACTGGAATCTATACACATGGAAAT
CATTCATTAATTGTGCCTCCTTCAAAGAACCCTCAAAATCCTACTGACCTGTATGACACTGTCACAGATAATGTGCACCATCCAAGTTTA


* Fusion transcript sequences (Full-length transcript).
>In-frame_LAMB1_ENST00000393561_chr7_107635332_-_PARP14_ENST00000474629_chr3_122446659_+_3388nt
GGGGCTGATCAGGGTGGGCGCGAGCGTCGGTGGGTTTCCCGGGAGGGAGGCTCTCGCTGCTGGACAGACCTGATGACGTGTGTGGGTTTC
TTTCCGTGTCCTTCTCCTTTCGGAGTCCCTGCCTTCCCAGCCTCTCCTGCGCTCATCTCTCCATTGTCTTTTCTGTGCATTTTGCTTTCT
TCCGAATGGACTGTCCTCTCTCCGCACCCACTCCCCCGCCCCCGCTTGTTCGTTTTTTTCGGGCTCCACTCCCTGCTTGTGTCCCCCCAA
CTCTGTTGCCTGTCCTTCCCGCAGCCCTGTGCAGAGCCCGAGTGCGCGCTCAGGAACCCGAGTTCAGCTACGGCTGCGCAGAAGGCAGCT
GCTATCCCGCCACGGGCGACCTTCTCATCGGCCGAGCACAGAAGCTTTCGGTGACCTCGACGTGCGGGCTGCACAAGCCCGAACCCTACT
GTATCGTCAGCCACTTGCAGGAGGACAAAAAATGCTTCATATGCAATTCCCAAGATCCTTATCATGAGACCCTGAATCCTGACAGCCATC
TCATTGAAAATGTGGTCACTACATTTGCTCCAAACCGCCTTAAGATTTGGTGGCAATCTGAAAATGGTGTGGAAAATGTAACTATCCAAC
TGGATTTGGAAGCAGAATTCCATTTTACTCATCTCATAATGACTTTCAAGATTGAGAGGATCCAGAATCCAGATCTCTGGAATAGCTACC
AGGCAAAGAAAAAAACTATGGATGCCAAGAATGGCCAGACAATGAATGAGAAGCAACTCTTCCATGGGACAGATGCCGGCTCCGTGCCAC
ACGTCAATCGAAATGGCTTTAACCGCAGCTATGCCGGAAAGAATGCTGTGGCATATGGAAAGGGAACCTATTTTGCTGTCAATGCCAATT
ATTCTGCCAATGATACGTACTCCAGACCAGATGCAAATGGGAGAAAGCATGTGTATTATGTGCGAGTACTTACTGGAATCTATACACATG
GAAATCATTCATTAATTGTGCCTCCTTCAAAGAACCCTCAAAATCCTACTGACCTGTATGACACTGTCACAGATAATGTGCACCATCCAA
GTTTATTTGTGGCATTTTATGACTACCAAGCATACCCAGAGTACCTTATTACGTTTAGAAAATAACACTTTGGTATCCTTCCCACAAAAT
TATTCTCCATTTGTACATATCTAGTTGTAAAACAAGTTTTAGCTTTTTTTTTTAATTCCTCTTAACAGATTTTTCTAATATCCAAGGATC
ATTCTTTGTCGCTGAAGTCAGTCTTTCTTCAGCTTCCCTTTCATAATGGAAATGAACTTATTATCTTGAGAGCAAATAACTTGGAAAATT
TAAATGAGATAATGCAGTTGCAACTGTGTGTCCACAAGTATGGACATCAAATCTGTGGGAAAAGAACAGGTTTGTATTTTCAGGAAGGAG
AGAATAACAGTCTTATAGACAGAGGGCACAGCTAAGCACAGCTGCCACTGCAGGAGACAGGCCCCATGTCAGGATGCCATAGTGCTGTGG
GGAGCACAGTATTACCCAGTGGGTAGGGCTTCTGTCTTCCCTGGGAGCAGGGATGGTATCTTAGTCAATTTTTTTCCCTTGAGATGAGGT
CTGTGCCTGATGTACAACGGATACTCCATAAATGTTTGACAAACCAACGAAGAATGAAAAAAAGCCTAGTCAGACTCCCATCCAAAGTAG
GAACTATCTCTTTAACATTCTTGACTCACTATCACTTTACCTCAAATTGAACAGATTCCATGACGGAACTTCATTCTTCACAAACTAGCC
AGTGACATGTGGGACAGCTCTGGCCAGGGCTCTGGGACTGCAGTGTACTTGCGCTCTGCACGGTCCAGGAGCTGTGATGTGGCTGTGGTC
TAGGGGAATCCTGCCTGCCCCATGGAGTTGCGCAGCACAACCCTGGCTCCAATTGCCAGAAGGCTCTTTTTAATGCTGAACCAAAATGTG
CCTTTTTTTTTTTTTTTTTGAGATGGAGTTTCACTCTTGTTGCCCAGGCTGGAGTGCAATGGCGCGATCTCAGCTCACTGCAGCCACTGC
CTCCCAGGTTCAAGTGATTCTCCTGCCTCAGCCTCCCGAGTAGCTGGGATTACAGGCATGCGCTAACACACCCAGCTAATTTTGTATTTT
TAGTAGAGACGAGGTTTCTCCATGTTCGACAGGCTGGTCTCGAACTCCCACCTCAGCCTCCCAAACTGCTGGGATTACAGGTGTGAGCCA
CCGTGACCAGCCAATGTGCCTTCTTATAGTGTCTACTCATTGGTCTTTGTTCTGCCCAGTGATAACAATGGGATAACGCCTGCTACACAT
CTTCATTGTGAAACCCTTCCCCTGTGCTGAGATTAAATGAACTCTAAGATTATTAAATAGTATATTTTCCTTGACAGCCTAGCGTTTGAT
GATTTTAAAGCCTTATGTATAAATAAACCAAAGGAAGTAAGCAGTCATATTGCTAATTTGCTAACTCCTATCTATTGAATGGTGAAGTTT
TAAAAATTTCCCCAGGTAAGTTTAAGATTCAAACACCATCTATTGAGCACCTACATTGTGTGCCAGGTAGTAAAATAGGTGCTTTCATAC
ACATTGTCTCAATTCCTGTGAGGTCAGAATTATCTCTGCATTTGAAACTTGAGGAAACATGCTCAGAGTGCAAGAAGCTTCCTTGCCTGA
GATCACCTAGAAAGGAACCCTCAGAGCCGGCAACTGAATCTTGGTCCCTGTGATGTCAAGCCCATTGCTCTCCCACTGCAGAACATGGCC
TCTAGATTAATGCCACCGATTCAGGAACACCTCCGACAGTCTTGAAATACCCCCATGTTGCCTTGTTTGTTTTTTCCTTCTGGCTTCTTC
TATTACAGTCTCTTCATTGGAAGCTCTGTAGGCCAAGGCCAGAGCTGATACTGACACGGAGCCAATGCAGATAGCACATCAGATGCTAGG
GGTCGCTGGGAGGATTAAGGGACTTAATCTGCTAGGAACACCTGTACTTGAAGTGGAGGAGGCTAGGGGGCCACAGTTGCTGCTTCATTA
ACATAGAGGTTTTGGATTTTTTTCTCTTGTGGTTTGTTTTTTAAGTGGATTGGCAGACTCCTTGTTGCTTAAGAGTGGCTTTCTAGGCAG
GCCACTGGCATCTGAATTCATCATTGACAATAAATGTAAGAAATTGGAATAAAAAAGAGAGACCTGCTGTTATTCGCTTTTGTTCTCCAG
TGATTTGATTAACTCAGGGCAAGGCTGAATATCAGAGTGTATCGCACTGAAGAATAATAATCCATTCAGTAATGTTATAGTTATCCTCAA


Top

FusionGenePPI for LAMB1_PARP14


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
LAMB1TGFB1, ATXN7, CACNA1A, LAMC1, UBC, ATXN7L2, GFI1B, FBXO6, NQO1, DPY30, HSPD1, PDIA3, ERBB2IP, HECW2, KIAA1033, POLR2E, ANTXR2, PA2G4, LGALS3, NTF3, OGN, LGALS9, TMEM25, PTPRK, CD96, PSMD5, NTRK1, PSMC5, KIF11, FGFR1OP, SERPINA12, OS9, DEFA1, COLEC12, CRP, LYZL2, PSG8, BCAM, LMNAPARP14GPI, STAT6, FCER2, HDAC2, HDAC3, CUL2, IKBKG, RPA1, RPA2, RPA3, DTX3L, PARP9, GAN, PARP10


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for LAMB1_PARP14


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for LAMB1_PARP14


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneLAMB1C0004352Autistic Disorder1CTD_human
HgeneLAMB1C0009324Ulcerative Colitis1CTD_human
HgeneLAMB1C0009363Congenital ocular coloboma (disorder)1CTD_human
HgeneLAMB1C0014175Endometriosis1CTD_human