FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 19203

FusionGeneSummary for KRAS_SLC2A14

check button Fusion gene summary
Fusion gene informationFusion gene name: KRAS_SLC2A14
Fusion gene ID: 19203
HgeneTgene
Gene symbol

KRAS

SLC2A14

Gene ID

3845

144195

Gene nameKRAS proto-oncogene, GTPasesolute carrier family 2 member 14
SynonymsC-K-RAS|CFC2|K-RAS2A|K-RAS2B|K-RAS4A|K-RAS4B|K-Ras|KI-RAS|KRAS1|KRAS2|NS|NS3|RALD|RASK2|c-Ki-ras2GLUT14|SLC2A3P3
Cytomap

12p12.1

12p13.31

Type of geneprotein-codingprotein-coding
DescriptionGTPase KRasK-Ras 2K-ras p21 proteinKirsten rat sarcoma viral oncogene homologKirsten rat sarcoma viral proto-oncogenePR310 c-K-ras oncogenec-Ki-rasc-Kirsten-ras proteincellular c-Ki-ras2 proto-oncogenecellular transforming proto-oncogeneoncogenesolute carrier family 2, facilitated glucose transporter member 14glucose transporter type 14solute carrier family 2 (facilitated glucose transporter), member 14solute carrier family 2 (facilitated glucose transporter), member 3 pseudogene 3
Modification date2018052720180522
UniProtAcc

P01116

Q8TDB8

Ensembl transtripts involved in fusion geneENST00000311936, ENST00000557334, 
ENST00000256078, ENST00000556131, 
ENST00000340749, ENST00000543909, 
ENST00000431042, ENST00000542505, 
ENST00000396589, ENST00000535295, 
ENST00000539924, ENST00000542546, 
ENST00000544749, 
Fusion gene scores* DoF score4 X 2 X 4=322 X 1 X 2=4
# samples 42
** MAII scorelog2(4/32*10)=0.321928094887362
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(2/4*10)=2.32192809488736
Context

PubMed: KRAS [Title/Abstract] AND SLC2A14 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDLUADTCGA-75-5122-01AKRASchr12

25398208

-SLC2A14chr12

7985410

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000311936ENST00000340749KRASchr12

25398208

-SLC2A14chr12

7985410

-
In-frameENST00000311936ENST00000543909KRASchr12

25398208

-SLC2A14chr12

7985410

-
In-frameENST00000311936ENST00000431042KRASchr12

25398208

-SLC2A14chr12

7985410

-
5CDS-intronENST00000311936ENST00000542505KRASchr12

25398208

-SLC2A14chr12

7985410

-
5CDS-intronENST00000311936ENST00000396589KRASchr12

25398208

-SLC2A14chr12

7985410

-
5CDS-5UTRENST00000311936ENST00000535295KRASchr12

25398208

-SLC2A14chr12

7985410

-
5CDS-5UTRENST00000311936ENST00000539924KRASchr12

25398208

-SLC2A14chr12

7985410

-
5CDS-5UTRENST00000311936ENST00000542546KRASchr12

25398208

-SLC2A14chr12

7985410

-
5CDS-intronENST00000311936ENST00000544749KRASchr12

25398208

-SLC2A14chr12

7985410

-
In-frameENST00000557334ENST00000340749KRASchr12

25398208

-SLC2A14chr12

7985410

-
In-frameENST00000557334ENST00000543909KRASchr12

25398208

-SLC2A14chr12

7985410

-
In-frameENST00000557334ENST00000431042KRASchr12

25398208

-SLC2A14chr12

7985410

-
5CDS-intronENST00000557334ENST00000542505KRASchr12

25398208

-SLC2A14chr12

7985410

-
5CDS-intronENST00000557334ENST00000396589KRASchr12

25398208

-SLC2A14chr12

7985410

-
5CDS-5UTRENST00000557334ENST00000535295KRASchr12

25398208

-SLC2A14chr12

7985410

-
5CDS-5UTRENST00000557334ENST00000539924KRASchr12

25398208

-SLC2A14chr12

7985410

-
5CDS-5UTRENST00000557334ENST00000542546KRASchr12

25398208

-SLC2A14chr12

7985410

-
5CDS-intronENST00000557334ENST00000544749KRASchr12

25398208

-SLC2A14chr12

7985410

-
In-frameENST00000256078ENST00000340749KRASchr12

25398208

-SLC2A14chr12

7985410

-
In-frameENST00000256078ENST00000543909KRASchr12

25398208

-SLC2A14chr12

7985410

-
In-frameENST00000256078ENST00000431042KRASchr12

25398208

-SLC2A14chr12

7985410

-
5CDS-intronENST00000256078ENST00000542505KRASchr12

25398208

-SLC2A14chr12

7985410

-
5CDS-intronENST00000256078ENST00000396589KRASchr12

25398208

-SLC2A14chr12

7985410

-
5CDS-5UTRENST00000256078ENST00000535295KRASchr12

25398208

-SLC2A14chr12

7985410

-
5CDS-5UTRENST00000256078ENST00000539924KRASchr12

25398208

-SLC2A14chr12

7985410

-
5CDS-5UTRENST00000256078ENST00000542546KRASchr12

25398208

-SLC2A14chr12

7985410

-
5CDS-intronENST00000256078ENST00000544749KRASchr12

25398208

-SLC2A14chr12

7985410

-
Frame-shitENST00000556131ENST00000340749KRASchr12

25398208

-SLC2A14chr12

7985410

-
Frame-shitENST00000556131ENST00000543909KRASchr12

25398208

-SLC2A14chr12

7985410

-
Frame-shitENST00000556131ENST00000431042KRASchr12

25398208

-SLC2A14chr12

7985410

-
5CDS-intronENST00000556131ENST00000542505KRASchr12

25398208

-SLC2A14chr12

7985410

-
5CDS-intronENST00000556131ENST00000396589KRASchr12

25398208

-SLC2A14chr12

7985410

-
5CDS-5UTRENST00000556131ENST00000535295KRASchr12

25398208

-SLC2A14chr12

7985410

-
5CDS-5UTRENST00000556131ENST00000539924KRASchr12

25398208

-SLC2A14chr12

7985410

-
5CDS-5UTRENST00000556131ENST00000542546KRASchr12

25398208

-SLC2A14chr12

7985410

-
5CDS-intronENST00000556131ENST00000544749KRASchr12

25398208

-SLC2A14chr12

7985410

-

Top

FusionProtFeatures for KRAS_SLC2A14


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
KRAS

P01116

SLC2A14

Q8TDB8

Ras proteins bind GDP/GTP and possess intrinsic GTPaseactivity. Plays an important role in the regulation of cellproliferation (PubMed:23698361, PubMed:22711838). Plays a role inpromoting oncogenic events by inducing transcriptional silencingof tumor suppressor genes (TSGs) in colorectal cancer (CRC) cellsin a ZNF304-dependent manner (PubMed:24623306).{ECO:0000269|PubMed:22711838, ECO:0000269|PubMed:23698361,ECO:0000269|PubMed:24623306, ECO:0000305}. Facilitative glucose transporter (By similarity). Mayhave a specific function related to spermatogenesis.{ECO:0000250}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneKRASchr12:25398208chr12:7985410ENST00000256078-2632_4037333MotifNote=Effector region
HgeneKRASchr12:25398208chr12:7985410ENST00000311936-2532_4037189MotifNote=Effector region
HgeneKRASchr12:25398208chr12:7985410ENST00000256078-2610_1837333Nucleotide bindingGTP
HgeneKRASchr12:25398208chr12:7985410ENST00000256078-2629_3537333Nucleotide bindingGTP
HgeneKRASchr12:25398208chr12:7985410ENST00000311936-2510_1837189Nucleotide bindingGTP
HgeneKRASchr12:25398208chr12:7985410ENST00000311936-2529_3537189Nucleotide bindingGTP
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000340749-313304_3106498RegionMonosaccharide binding
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000396589-212304_31029521RegionMonosaccharide binding
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000431042-111304_3106498RegionMonosaccharide binding
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000542505-05304_310-126162RegionMonosaccharide binding
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000543909-616304_31029521RegionMonosaccharide binding
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000340749-313110_1176498Topological domainCytoplasmic
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000340749-313139_1486498Topological domainExtracellular
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000340749-313170_1776498Topological domainCytoplasmic
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000340749-313199_2076498Topological domainExtracellular
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000340749-313229_2936498Topological domainCytoplasmic
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000340749-313315_3286498Topological domainExtracellular
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000340749-313350_3586498Topological domainCytoplasmic
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000340749-313380_3926498Topological domainExtracellular
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000340749-313414_4236498Topological domainCytoplasmic
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000340749-313445_4516498Topological domainExtracellular
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000340749-313473_5206498Topological domainCytoplasmic
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000340749-31351_886498Topological domainExtracellular
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000396589-212110_11729521Topological domainCytoplasmic
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000396589-212139_14829521Topological domainExtracellular
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000396589-212170_17729521Topological domainCytoplasmic
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000396589-212199_20729521Topological domainExtracellular
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000396589-212229_29329521Topological domainCytoplasmic
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000396589-212315_32829521Topological domainExtracellular
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000396589-212350_35829521Topological domainCytoplasmic
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000396589-212380_39229521Topological domainExtracellular
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000396589-212414_42329521Topological domainCytoplasmic
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000396589-212445_45129521Topological domainExtracellular
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000396589-212473_52029521Topological domainCytoplasmic
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000396589-21251_8829521Topological domainExtracellular
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000431042-111110_1176498Topological domainCytoplasmic
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000431042-111139_1486498Topological domainExtracellular
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000431042-111170_1776498Topological domainCytoplasmic
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000431042-111199_2076498Topological domainExtracellular
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000431042-111229_2936498Topological domainCytoplasmic
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000431042-111315_3286498Topological domainExtracellular
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000431042-111350_3586498Topological domainCytoplasmic
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000431042-111380_3926498Topological domainExtracellular
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000431042-111414_4236498Topological domainCytoplasmic
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000431042-111445_4516498Topological domainExtracellular
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000431042-111473_5206498Topological domainCytoplasmic
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000431042-11151_886498Topological domainExtracellular
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000542505-05110_117-126162Topological domainCytoplasmic
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000542505-05139_148-126162Topological domainExtracellular
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000542505-05170_177-126162Topological domainCytoplasmic
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000542505-05199_207-126162Topological domainExtracellular
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000542505-05229_293-126162Topological domainCytoplasmic
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000542505-05315_328-126162Topological domainExtracellular
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000542505-05350_358-126162Topological domainCytoplasmic
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000542505-05380_392-126162Topological domainExtracellular
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000542505-05414_423-126162Topological domainCytoplasmic
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000542505-05445_451-126162Topological domainExtracellular
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000542505-05473_520-126162Topological domainCytoplasmic
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000542505-0551_88-126162Topological domainExtracellular
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000543909-616110_11729521Topological domainCytoplasmic
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000543909-616139_14829521Topological domainExtracellular
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000543909-616170_17729521Topological domainCytoplasmic
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000543909-616199_20729521Topological domainExtracellular
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000543909-616229_29329521Topological domainCytoplasmic
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000543909-616315_32829521Topological domainExtracellular
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000543909-616350_35829521Topological domainCytoplasmic
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000543909-616380_39229521Topological domainExtracellular
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000543909-616414_42329521Topological domainCytoplasmic
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000543909-616445_45129521Topological domainExtracellular
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000543909-616473_52029521Topological domainCytoplasmic
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000543909-61651_8829521Topological domainExtracellular
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000340749-313118_1386498TransmembraneHelical%3B Name%3D3
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000340749-313149_1696498TransmembraneHelical%3B Name%3D4
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000340749-313178_1986498TransmembraneHelical%3B Name%3D5
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000340749-313208_2286498TransmembraneHelical%3B Name%3D6
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000340749-313294_3146498TransmembraneHelical%3B Name%3D7
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000340749-31330_506498TransmembraneHelical%3B Name%3D1
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000340749-313329_3496498TransmembraneHelical%3B Name%3D8
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000340749-313359_3796498TransmembraneHelical%3B Name%3D9
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000340749-313393_4136498TransmembraneHelical%3B Name%3D10
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000340749-313424_4446498TransmembraneHelical%3B Name%3D11
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000340749-313452_4726498TransmembraneHelical%3B Name%3D12
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000340749-31389_1096498TransmembraneHelical%3B Name%3D2
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000396589-212118_13829521TransmembraneHelical%3B Name%3D3
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000396589-212149_16929521TransmembraneHelical%3B Name%3D4
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000396589-212178_19829521TransmembraneHelical%3B Name%3D5
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000396589-212208_22829521TransmembraneHelical%3B Name%3D6
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000396589-212294_31429521TransmembraneHelical%3B Name%3D7
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000396589-21230_5029521TransmembraneHelical%3B Name%3D1
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000396589-212329_34929521TransmembraneHelical%3B Name%3D8
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000396589-212359_37929521TransmembraneHelical%3B Name%3D9
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000396589-212393_41329521TransmembraneHelical%3B Name%3D10
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000396589-212424_44429521TransmembraneHelical%3B Name%3D11
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000396589-212452_47229521TransmembraneHelical%3B Name%3D12
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000396589-21289_10929521TransmembraneHelical%3B Name%3D2
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000431042-111118_1386498TransmembraneHelical%3B Name%3D3
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000431042-111149_1696498TransmembraneHelical%3B Name%3D4
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000431042-111178_1986498TransmembraneHelical%3B Name%3D5
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000431042-111208_2286498TransmembraneHelical%3B Name%3D6
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000431042-111294_3146498TransmembraneHelical%3B Name%3D7
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000431042-11130_506498TransmembraneHelical%3B Name%3D1
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000431042-111329_3496498TransmembraneHelical%3B Name%3D8
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000431042-111359_3796498TransmembraneHelical%3B Name%3D9
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000431042-111393_4136498TransmembraneHelical%3B Name%3D10
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000431042-111424_4446498TransmembraneHelical%3B Name%3D11
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000431042-111452_4726498TransmembraneHelical%3B Name%3D12
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000431042-11189_1096498TransmembraneHelical%3B Name%3D2
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000542505-05118_138-126162TransmembraneHelical%3B Name%3D3
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000542505-05149_169-126162TransmembraneHelical%3B Name%3D4
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000542505-05178_198-126162TransmembraneHelical%3B Name%3D5
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000542505-05208_228-126162TransmembraneHelical%3B Name%3D6
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000542505-05294_314-126162TransmembraneHelical%3B Name%3D7
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000542505-0530_50-126162TransmembraneHelical%3B Name%3D1
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000542505-05329_349-126162TransmembraneHelical%3B Name%3D8
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000542505-05359_379-126162TransmembraneHelical%3B Name%3D9
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000542505-05393_413-126162TransmembraneHelical%3B Name%3D10
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000542505-05424_444-126162TransmembraneHelical%3B Name%3D11
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000542505-05452_472-126162TransmembraneHelical%3B Name%3D12
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000542505-0589_109-126162TransmembraneHelical%3B Name%3D2
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000543909-616118_13829521TransmembraneHelical%3B Name%3D3
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000543909-616149_16929521TransmembraneHelical%3B Name%3D4
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000543909-616178_19829521TransmembraneHelical%3B Name%3D5
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000543909-616208_22829521TransmembraneHelical%3B Name%3D6
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000543909-616294_31429521TransmembraneHelical%3B Name%3D7
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000543909-61630_5029521TransmembraneHelical%3B Name%3D1
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000543909-616329_34929521TransmembraneHelical%3B Name%3D8
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000543909-616359_37929521TransmembraneHelical%3B Name%3D9
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000543909-616393_41329521TransmembraneHelical%3B Name%3D10
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000543909-616424_44429521TransmembraneHelical%3B Name%3D11
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000543909-616452_47229521TransmembraneHelical%3B Name%3D12
TgeneSLC2A14chr12:25398208chr12:7985410ENST00000543909-61689_10929521TransmembraneHelical%3B Name%3D2

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneKRASchr12:25398208chr12:7985410ENST00000256078-26116_11937333Nucleotide bindingGTP
HgeneKRASchr12:25398208chr12:7985410ENST00000256078-2659_6037333Nucleotide bindingGTP
HgeneKRASchr12:25398208chr12:7985410ENST00000311936-25116_11937189Nucleotide bindingGTP
HgeneKRASchr12:25398208chr12:7985410ENST00000311936-2559_6037189Nucleotide bindingGTP
HgeneKRASchr12:25398208chr12:7985410ENST00000256078-26166_18537333RegionNote=Hypervariable region
HgeneKRASchr12:25398208chr12:7985410ENST00000311936-25166_18537189RegionNote=Hypervariable region


Top

FusionGeneSequence for KRAS_SLC2A14


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_KRAS_ENST00000311936_chr12_25398208_-_SLC2A14_ENST00000340749_chr12_7985410_-_529aa
MTETKLVVVGAGGVGKSALTIQLIQNHFVDETDPTIEVTPALIFAITVATIGSFQFGYNTGVINAPETIIKEFINKTLTDKANAPPSEVL
LTNLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLIVNLLAATGGCLMGLCKIAESVEMLILGRLVIGLFCGLCTGFVPMYIGEISPT
ALRGAFGTLNQLGIVIGILVAQIFGLELILGSEELWPVLLGFTILPAILQSAALPCCPESPRFLLINRKKEENATRILQRLWGTQDVSQD
IQEMKDESARMSQEKQVTVLELFRVSSYRQPIIISIVLQLSQQLSGINAVFTYSTGIFKDAGVQQPITATISAGVVNTIFTLLSLFLVER
AGRRTLHMIGLGGMAFCSTLMTVSLLLKNHTNGMSFVCIGAILVFVACFEIGPGPIPWFIVAELFSQGPRPAAMAVAGCSNWTSNFLVGL

>In-frame_KRAS_ENST00000311936_chr12_25398208_-_SLC2A14_ENST00000543909_chr12_7985410_-_529aa
MTETKLVVVGAGGVGKSALTIQLIQNHFVDETDPTIEVTPALIFAITVATIGSFQFGYNTGVINAPETIIKEFINKTLTDKANAPPSEVL
LTNLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLIVNLLAATGGCLMGLCKIAESVEMLILGRLVIGLFCGLCTGFVPMYIGEISPT
ALRGAFGTLNQLGIVIGILVAQIFGLELILGSEELWPVLLGFTILPAILQSAALPCCPESPRFLLINRKKEENATRILQRLWGTQDVSQD
IQEMKDESARMSQEKQVTVLELFRVSSYRQPIIISIVLQLSQQLSGINAVFTYSTGIFKDAGVQQPITATISAGVVNTIFTLLSLFLVER
AGRRTLHMIGLGGMAFCSTLMTVSLLLKNHTNGMSFVCIGAILVFVACFEIGPGPIPWFIVAELFSQGPRPAAMAVAGCSNWTSNFLVGL

>In-frame_KRAS_ENST00000311936_chr12_25398208_-_SLC2A14_ENST00000431042_chr12_7985410_-_529aa
MTETKLVVVGAGGVGKSALTIQLIQNHFVDETDPTIEVTPALIFAITVATIGSFQFGYNTGVINAPETIIKEFINKTLTDKANAPPSEVL
LTNLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLIVNLLAATGGCLMGLCKIAESVEMLILGRLVIGLFCGLCTGFVPMYIGEISPT
ALRGAFGTLNQLGIVIGILVAQIFGLELILGSEELWPVLLGFTILPAILQSAALPCCPESPRFLLINRKKEENATRILQRLWGTQDVSQD
IQEMKDESARMSQEKQVTVLELFRVSSYRQPIIISIVLQLSQQLSGINAVFTYSTGIFKDAGVQQPITATISAGVVNTIFTLLSLFLVER
AGRRTLHMIGLGGMAFCSTLMTVSLLLKNHTNGMSFVCIGAILVFVACFEIGPGPIPWFIVAELFSQGPRPAAMAVAGCSNWTSNFLVGL

>In-frame_KRAS_ENST00000557334_chr12_25398208_-_SLC2A14_ENST00000340749_chr12_7985410_-_529aa
MTETKLVVVGAGGVGKSALTIQLIQNHFVDETDPTIEVTPALIFAITVATIGSFQFGYNTGVINAPETIIKEFINKTLTDKANAPPSEVL
LTNLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLIVNLLAATGGCLMGLCKIAESVEMLILGRLVIGLFCGLCTGFVPMYIGEISPT
ALRGAFGTLNQLGIVIGILVAQIFGLELILGSEELWPVLLGFTILPAILQSAALPCCPESPRFLLINRKKEENATRILQRLWGTQDVSQD
IQEMKDESARMSQEKQVTVLELFRVSSYRQPIIISIVLQLSQQLSGINAVFTYSTGIFKDAGVQQPITATISAGVVNTIFTLLSLFLVER
AGRRTLHMIGLGGMAFCSTLMTVSLLLKNHTNGMSFVCIGAILVFVACFEIGPGPIPWFIVAELFSQGPRPAAMAVAGCSNWTSNFLVGL

>In-frame_KRAS_ENST00000557334_chr12_25398208_-_SLC2A14_ENST00000543909_chr12_7985410_-_529aa
MTETKLVVVGAGGVGKSALTIQLIQNHFVDETDPTIEVTPALIFAITVATIGSFQFGYNTGVINAPETIIKEFINKTLTDKANAPPSEVL
LTNLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLIVNLLAATGGCLMGLCKIAESVEMLILGRLVIGLFCGLCTGFVPMYIGEISPT
ALRGAFGTLNQLGIVIGILVAQIFGLELILGSEELWPVLLGFTILPAILQSAALPCCPESPRFLLINRKKEENATRILQRLWGTQDVSQD
IQEMKDESARMSQEKQVTVLELFRVSSYRQPIIISIVLQLSQQLSGINAVFTYSTGIFKDAGVQQPITATISAGVVNTIFTLLSLFLVER
AGRRTLHMIGLGGMAFCSTLMTVSLLLKNHTNGMSFVCIGAILVFVACFEIGPGPIPWFIVAELFSQGPRPAAMAVAGCSNWTSNFLVGL

>In-frame_KRAS_ENST00000557334_chr12_25398208_-_SLC2A14_ENST00000431042_chr12_7985410_-_529aa
MTETKLVVVGAGGVGKSALTIQLIQNHFVDETDPTIEVTPALIFAITVATIGSFQFGYNTGVINAPETIIKEFINKTLTDKANAPPSEVL
LTNLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLIVNLLAATGGCLMGLCKIAESVEMLILGRLVIGLFCGLCTGFVPMYIGEISPT
ALRGAFGTLNQLGIVIGILVAQIFGLELILGSEELWPVLLGFTILPAILQSAALPCCPESPRFLLINRKKEENATRILQRLWGTQDVSQD
IQEMKDESARMSQEKQVTVLELFRVSSYRQPIIISIVLQLSQQLSGINAVFTYSTGIFKDAGVQQPITATISAGVVNTIFTLLSLFLVER
AGRRTLHMIGLGGMAFCSTLMTVSLLLKNHTNGMSFVCIGAILVFVACFEIGPGPIPWFIVAELFSQGPRPAAMAVAGCSNWTSNFLVGL

>In-frame_KRAS_ENST00000256078_chr12_25398208_-_SLC2A14_ENST00000340749_chr12_7985410_-_529aa
MTETKLVVVGAGGVGKSALTIQLIQNHFVDETDPTIEVTPALIFAITVATIGSFQFGYNTGVINAPETIIKEFINKTLTDKANAPPSEVL
LTNLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLIVNLLAATGGCLMGLCKIAESVEMLILGRLVIGLFCGLCTGFVPMYIGEISPT
ALRGAFGTLNQLGIVIGILVAQIFGLELILGSEELWPVLLGFTILPAILQSAALPCCPESPRFLLINRKKEENATRILQRLWGTQDVSQD
IQEMKDESARMSQEKQVTVLELFRVSSYRQPIIISIVLQLSQQLSGINAVFTYSTGIFKDAGVQQPITATISAGVVNTIFTLLSLFLVER
AGRRTLHMIGLGGMAFCSTLMTVSLLLKNHTNGMSFVCIGAILVFVACFEIGPGPIPWFIVAELFSQGPRPAAMAVAGCSNWTSNFLVGL

>In-frame_KRAS_ENST00000256078_chr12_25398208_-_SLC2A14_ENST00000543909_chr12_7985410_-_529aa
MTETKLVVVGAGGVGKSALTIQLIQNHFVDETDPTIEVTPALIFAITVATIGSFQFGYNTGVINAPETIIKEFINKTLTDKANAPPSEVL
LTNLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLIVNLLAATGGCLMGLCKIAESVEMLILGRLVIGLFCGLCTGFVPMYIGEISPT
ALRGAFGTLNQLGIVIGILVAQIFGLELILGSEELWPVLLGFTILPAILQSAALPCCPESPRFLLINRKKEENATRILQRLWGTQDVSQD
IQEMKDESARMSQEKQVTVLELFRVSSYRQPIIISIVLQLSQQLSGINAVFTYSTGIFKDAGVQQPITATISAGVVNTIFTLLSLFLVER
AGRRTLHMIGLGGMAFCSTLMTVSLLLKNHTNGMSFVCIGAILVFVACFEIGPGPIPWFIVAELFSQGPRPAAMAVAGCSNWTSNFLVGL

>In-frame_KRAS_ENST00000256078_chr12_25398208_-_SLC2A14_ENST00000431042_chr12_7985410_-_529aa
MTETKLVVVGAGGVGKSALTIQLIQNHFVDETDPTIEVTPALIFAITVATIGSFQFGYNTGVINAPETIIKEFINKTLTDKANAPPSEVL
LTNLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLIVNLLAATGGCLMGLCKIAESVEMLILGRLVIGLFCGLCTGFVPMYIGEISPT
ALRGAFGTLNQLGIVIGILVAQIFGLELILGSEELWPVLLGFTILPAILQSAALPCCPESPRFLLINRKKEENATRILQRLWGTQDVSQD
IQEMKDESARMSQEKQVTVLELFRVSSYRQPIIISIVLQLSQQLSGINAVFTYSTGIFKDAGVQQPITATISAGVVNTIFTLLSLFLVER
AGRRTLHMIGLGGMAFCSTLMTVSLLLKNHTNGMSFVCIGAILVFVACFEIGPGPIPWFIVAELFSQGPRPAAMAVAGCSNWTSNFLVGL


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_KRAS_ENST00000311936_chr12_25398208_-_SLC2A14_ENST00000340749_chr12_7985410_-_1587nt
ATGACTGAATATAAACTTGTGGTAGTTGGAGCTGGTGGCGTAGGCAAGAGTGCCTTGACGATACAGCTAATTCAGAATCATTTTGTGGAC
GAATATGATCCAACAATAGAGGTCACCCCAGCTCTGATCTTTGCCATCACAGTTGCTACAATCGGCTCTTTCCAGTTTGGCTACAACACT
GGGGTCATCAATGCTCCTGAGACGATCATAAAGGAATTTATCAATAAAACTTTGACGGACAAGGCAAATGCCCCTCCCTCTGAGGTGCTG
CTCACGAATCTCTGGTCCTTGTCTGTGGCCATATTTTCCGTCGGGGGTATGATCGGCTCCTTTTCCGTCGGACTCTTTGTTAACCGCTTT
GGCAGGCGCAATTCAATGCTGATTGTCAACCTGTTGGCTGCCACTGGTGGCTGCCTTATGGGACTGTGTAAAATAGCTGAGTCAGTTGAA
ATGCTGATCCTGGGCCGCTTGGTTATTGGCCTCTTCTGCGGACTCTGCACAGGTTTTGTGCCCATGTACATTGGAGAGATCTCGCCTACT
GCCCTGAGGGGTGCCTTTGGCACTCTCAACCAGCTGGGCATAGTTATTGGAATTCTGGTGGCCCAGATCTTTGGTCTGGAACTCATCCTT
GGGTCTGAAGAGCTATGGCCGGTGCTATTAGGCTTTACCATCCTTCCAGCTATCCTGCAAAGTGCAGCCCTTCCATGTTGCCCTGAAAGT
CCCAGATTTTTGCTCATTAACAGAAAAAAAGAGGAGAATGCTACGCGGATCCTCCAGCGGTTGTGGGGCACCCAGGATGTATCCCAAGAC
ATCCAGGAGATGAAAGATGAGAGTGCAAGGATGTCACAAGAAAAGCAAGTCACCGTGCTGGAGCTCTTTAGAGTGTCCAGCTACCGACAG
CCCATCATCATTTCCATTGTGCTCCAGCTCTCTCAGCAGCTCTCTGGGATCAATGCTGTGTTCTATTACTCAACAGGAATCTTCAAGGAT
GCAGGTGTTCAACAGCCCATCTATGCCACCATCAGCGCGGGTGTGGTTAATACTATCTTCACTTTACTTTCTCTATTTCTGGTGGAAAGG
GCAGGAAGAAGGACTCTGCATATGATAGGCCTTGGAGGGATGGCTTTTTGTTCCACGCTCATGACTGTTTCTTTGTTATTAAAGAATCAC
TATAATGGGATGAGCTTTGTCTGTATTGGGGCTATCTTGGTCTTTGTGGCCTGTTTTGAAATTGGACCAGGCCCCATTCCCTGGTTTATT
GTGGCCGAACTCTTCAGCCAGGGCCCCCGCCCAGCTGCGATGGCAGTGGCCGGCTGCTCCAACTGGACCTCCAACTTCCTAGTCGGATTG
CTCTTCCCCTCTGCTGCTTACTATTTAGGAGCCTACGTTTTTATTATCTTCACCGGCTTCCTCATTACCTTCTTGGCCTTTACCTTCTTC
AAAGTCCCTGAGACCCGTGGCAGGACTTTTGAGGATATCACACGGGCCTTTGAAGGGCAGGCACACGGTGCAGATAGATCTGGGAAGGAC

>In-frame_KRAS_ENST00000311936_chr12_25398208_-_SLC2A14_ENST00000543909_chr12_7985410_-_1587nt
ATGACTGAATATAAACTTGTGGTAGTTGGAGCTGGTGGCGTAGGCAAGAGTGCCTTGACGATACAGCTAATTCAGAATCATTTTGTGGAC
GAATATGATCCAACAATAGAGGTCACCCCAGCTCTGATCTTTGCCATCACAGTTGCTACAATCGGCTCTTTCCAGTTTGGCTACAACACT
GGGGTCATCAATGCTCCTGAGACGATCATAAAGGAATTTATCAATAAAACTTTGACGGACAAGGCAAATGCCCCTCCCTCTGAGGTGCTG
CTCACGAATCTCTGGTCCTTGTCTGTGGCCATATTTTCCGTCGGGGGTATGATCGGCTCCTTTTCCGTCGGACTCTTTGTTAACCGCTTT
GGCAGGCGCAATTCAATGCTGATTGTCAACCTGTTGGCTGCCACTGGTGGCTGCCTTATGGGACTGTGTAAAATAGCTGAGTCAGTTGAA
ATGCTGATCCTGGGCCGCTTGGTTATTGGCCTCTTCTGCGGACTCTGCACAGGTTTTGTGCCCATGTACATTGGAGAGATCTCGCCTACT
GCCCTGAGGGGTGCCTTTGGCACTCTCAACCAGCTGGGCATAGTTATTGGAATTCTGGTGGCCCAGATCTTTGGTCTGGAACTCATCCTT
GGGTCTGAAGAGCTATGGCCGGTGCTATTAGGCTTTACCATCCTTCCAGCTATCCTGCAAAGTGCAGCCCTTCCATGTTGCCCTGAAAGT
CCCAGATTTTTGCTCATTAACAGAAAAAAAGAGGAGAATGCTACGCGGATCCTCCAGCGGTTGTGGGGCACCCAGGATGTATCCCAAGAC
ATCCAGGAGATGAAAGATGAGAGTGCAAGGATGTCACAAGAAAAGCAAGTCACCGTGCTGGAGCTCTTTAGAGTGTCCAGCTACCGACAG
CCCATCATCATTTCCATTGTGCTCCAGCTCTCTCAGCAGCTCTCTGGGATCAATGCTGTGTTCTATTACTCAACAGGAATCTTCAAGGAT
GCAGGTGTTCAACAGCCCATCTATGCCACCATCAGCGCGGGTGTGGTTAATACTATCTTCACTTTACTTTCTCTATTTCTGGTGGAAAGG
GCAGGAAGAAGGACTCTGCATATGATAGGCCTTGGAGGGATGGCTTTTTGTTCCACGCTCATGACTGTTTCTTTGTTATTAAAGAATCAC
TATAATGGGATGAGCTTTGTCTGTATTGGGGCTATCTTGGTCTTTGTGGCCTGTTTTGAAATTGGACCAGGCCCCATTCCCTGGTTTATT
GTGGCCGAACTCTTCAGCCAGGGCCCCCGCCCAGCTGCGATGGCAGTGGCCGGCTGCTCCAACTGGACCTCCAACTTCCTAGTCGGATTG
CTCTTCCCCTCTGCTGCTTACTATTTAGGAGCCTACGTTTTTATTATCTTCACCGGCTTCCTCATTACCTTCTTGGCCTTTACCTTCTTC
AAAGTCCCTGAGACCCGTGGCAGGACTTTTGAGGATATCACACGGGCCTTTGAAGGGCAGGCACACGGTGCAGATAGATCTGGGAAGGAC

>In-frame_KRAS_ENST00000311936_chr12_25398208_-_SLC2A14_ENST00000431042_chr12_7985410_-_1587nt
ATGACTGAATATAAACTTGTGGTAGTTGGAGCTGGTGGCGTAGGCAAGAGTGCCTTGACGATACAGCTAATTCAGAATCATTTTGTGGAC
GAATATGATCCAACAATAGAGGTCACCCCAGCTCTGATCTTTGCCATCACAGTTGCTACAATCGGCTCTTTCCAGTTTGGCTACAACACT
GGGGTCATCAATGCTCCTGAGACGATCATAAAGGAATTTATCAATAAAACTTTGACGGACAAGGCAAATGCCCCTCCCTCTGAGGTGCTG
CTCACGAATCTCTGGTCCTTGTCTGTGGCCATATTTTCCGTCGGGGGTATGATCGGCTCCTTTTCCGTCGGACTCTTTGTTAACCGCTTT
GGCAGGCGCAATTCAATGCTGATTGTCAACCTGTTGGCTGCCACTGGTGGCTGCCTTATGGGACTGTGTAAAATAGCTGAGTCAGTTGAA
ATGCTGATCCTGGGCCGCTTGGTTATTGGCCTCTTCTGCGGACTCTGCACAGGTTTTGTGCCCATGTACATTGGAGAGATCTCGCCTACT
GCCCTGAGGGGTGCCTTTGGCACTCTCAACCAGCTGGGCATAGTTATTGGAATTCTGGTGGCCCAGATCTTTGGTCTGGAACTCATCCTT
GGGTCTGAAGAGCTATGGCCGGTGCTATTAGGCTTTACCATCCTTCCAGCTATCCTGCAAAGTGCAGCCCTTCCATGTTGCCCTGAAAGT
CCCAGATTTTTGCTCATTAACAGAAAAAAAGAGGAGAATGCTACGCGGATCCTCCAGCGGTTGTGGGGCACCCAGGATGTATCCCAAGAC
ATCCAGGAGATGAAAGATGAGAGTGCAAGGATGTCACAAGAAAAGCAAGTCACCGTGCTGGAGCTCTTTAGAGTGTCCAGCTACCGACAG
CCCATCATCATTTCCATTGTGCTCCAGCTCTCTCAGCAGCTCTCTGGGATCAATGCTGTGTTCTATTACTCAACAGGAATCTTCAAGGAT
GCAGGTGTTCAACAGCCCATCTATGCCACCATCAGCGCGGGTGTGGTTAATACTATCTTCACTTTACTTTCTCTATTTCTGGTGGAAAGG
GCAGGAAGAAGGACTCTGCATATGATAGGCCTTGGAGGGATGGCTTTTTGTTCCACGCTCATGACTGTTTCTTTGTTATTAAAGAATCAC
TATAATGGGATGAGCTTTGTCTGTATTGGGGCTATCTTGGTCTTTGTGGCCTGTTTTGAAATTGGACCAGGCCCCATTCCCTGGTTTATT
GTGGCCGAACTCTTCAGCCAGGGCCCCCGCCCAGCTGCGATGGCAGTGGCCGGCTGCTCCAACTGGACCTCCAACTTCCTAGTCGGATTG
CTCTTCCCCTCTGCTGCTTACTATTTAGGAGCCTACGTTTTTATTATCTTCACCGGCTTCCTCATTACCTTCTTGGCCTTTACCTTCTTC
AAAGTCCCTGAGACCCGTGGCAGGACTTTTGAGGATATCACACGGGCCTTTGAAGGGCAGGCACACGGTGCAGATAGATCTGGGAAGGAC

>In-frame_KRAS_ENST00000557334_chr12_25398208_-_SLC2A14_ENST00000340749_chr12_7985410_-_1587nt
ATGACTGAATATAAACTTGTGGTAGTTGGAGCTGGTGGCGTAGGCAAGAGTGCCTTGACGATACAGCTAATTCAGAATCATTTTGTGGAC
GAATATGATCCAACAATAGAGGTCACCCCAGCTCTGATCTTTGCCATCACAGTTGCTACAATCGGCTCTTTCCAGTTTGGCTACAACACT
GGGGTCATCAATGCTCCTGAGACGATCATAAAGGAATTTATCAATAAAACTTTGACGGACAAGGCAAATGCCCCTCCCTCTGAGGTGCTG
CTCACGAATCTCTGGTCCTTGTCTGTGGCCATATTTTCCGTCGGGGGTATGATCGGCTCCTTTTCCGTCGGACTCTTTGTTAACCGCTTT
GGCAGGCGCAATTCAATGCTGATTGTCAACCTGTTGGCTGCCACTGGTGGCTGCCTTATGGGACTGTGTAAAATAGCTGAGTCAGTTGAA
ATGCTGATCCTGGGCCGCTTGGTTATTGGCCTCTTCTGCGGACTCTGCACAGGTTTTGTGCCCATGTACATTGGAGAGATCTCGCCTACT
GCCCTGAGGGGTGCCTTTGGCACTCTCAACCAGCTGGGCATAGTTATTGGAATTCTGGTGGCCCAGATCTTTGGTCTGGAACTCATCCTT
GGGTCTGAAGAGCTATGGCCGGTGCTATTAGGCTTTACCATCCTTCCAGCTATCCTGCAAAGTGCAGCCCTTCCATGTTGCCCTGAAAGT
CCCAGATTTTTGCTCATTAACAGAAAAAAAGAGGAGAATGCTACGCGGATCCTCCAGCGGTTGTGGGGCACCCAGGATGTATCCCAAGAC
ATCCAGGAGATGAAAGATGAGAGTGCAAGGATGTCACAAGAAAAGCAAGTCACCGTGCTGGAGCTCTTTAGAGTGTCCAGCTACCGACAG
CCCATCATCATTTCCATTGTGCTCCAGCTCTCTCAGCAGCTCTCTGGGATCAATGCTGTGTTCTATTACTCAACAGGAATCTTCAAGGAT
GCAGGTGTTCAACAGCCCATCTATGCCACCATCAGCGCGGGTGTGGTTAATACTATCTTCACTTTACTTTCTCTATTTCTGGTGGAAAGG
GCAGGAAGAAGGACTCTGCATATGATAGGCCTTGGAGGGATGGCTTTTTGTTCCACGCTCATGACTGTTTCTTTGTTATTAAAGAATCAC
TATAATGGGATGAGCTTTGTCTGTATTGGGGCTATCTTGGTCTTTGTGGCCTGTTTTGAAATTGGACCAGGCCCCATTCCCTGGTTTATT
GTGGCCGAACTCTTCAGCCAGGGCCCCCGCCCAGCTGCGATGGCAGTGGCCGGCTGCTCCAACTGGACCTCCAACTTCCTAGTCGGATTG
CTCTTCCCCTCTGCTGCTTACTATTTAGGAGCCTACGTTTTTATTATCTTCACCGGCTTCCTCATTACCTTCTTGGCCTTTACCTTCTTC
AAAGTCCCTGAGACCCGTGGCAGGACTTTTGAGGATATCACACGGGCCTTTGAAGGGCAGGCACACGGTGCAGATAGATCTGGGAAGGAC

>In-frame_KRAS_ENST00000557334_chr12_25398208_-_SLC2A14_ENST00000543909_chr12_7985410_-_1587nt
ATGACTGAATATAAACTTGTGGTAGTTGGAGCTGGTGGCGTAGGCAAGAGTGCCTTGACGATACAGCTAATTCAGAATCATTTTGTGGAC
GAATATGATCCAACAATAGAGGTCACCCCAGCTCTGATCTTTGCCATCACAGTTGCTACAATCGGCTCTTTCCAGTTTGGCTACAACACT
GGGGTCATCAATGCTCCTGAGACGATCATAAAGGAATTTATCAATAAAACTTTGACGGACAAGGCAAATGCCCCTCCCTCTGAGGTGCTG
CTCACGAATCTCTGGTCCTTGTCTGTGGCCATATTTTCCGTCGGGGGTATGATCGGCTCCTTTTCCGTCGGACTCTTTGTTAACCGCTTT
GGCAGGCGCAATTCAATGCTGATTGTCAACCTGTTGGCTGCCACTGGTGGCTGCCTTATGGGACTGTGTAAAATAGCTGAGTCAGTTGAA
ATGCTGATCCTGGGCCGCTTGGTTATTGGCCTCTTCTGCGGACTCTGCACAGGTTTTGTGCCCATGTACATTGGAGAGATCTCGCCTACT
GCCCTGAGGGGTGCCTTTGGCACTCTCAACCAGCTGGGCATAGTTATTGGAATTCTGGTGGCCCAGATCTTTGGTCTGGAACTCATCCTT
GGGTCTGAAGAGCTATGGCCGGTGCTATTAGGCTTTACCATCCTTCCAGCTATCCTGCAAAGTGCAGCCCTTCCATGTTGCCCTGAAAGT
CCCAGATTTTTGCTCATTAACAGAAAAAAAGAGGAGAATGCTACGCGGATCCTCCAGCGGTTGTGGGGCACCCAGGATGTATCCCAAGAC
ATCCAGGAGATGAAAGATGAGAGTGCAAGGATGTCACAAGAAAAGCAAGTCACCGTGCTGGAGCTCTTTAGAGTGTCCAGCTACCGACAG
CCCATCATCATTTCCATTGTGCTCCAGCTCTCTCAGCAGCTCTCTGGGATCAATGCTGTGTTCTATTACTCAACAGGAATCTTCAAGGAT
GCAGGTGTTCAACAGCCCATCTATGCCACCATCAGCGCGGGTGTGGTTAATACTATCTTCACTTTACTTTCTCTATTTCTGGTGGAAAGG
GCAGGAAGAAGGACTCTGCATATGATAGGCCTTGGAGGGATGGCTTTTTGTTCCACGCTCATGACTGTTTCTTTGTTATTAAAGAATCAC
TATAATGGGATGAGCTTTGTCTGTATTGGGGCTATCTTGGTCTTTGTGGCCTGTTTTGAAATTGGACCAGGCCCCATTCCCTGGTTTATT
GTGGCCGAACTCTTCAGCCAGGGCCCCCGCCCAGCTGCGATGGCAGTGGCCGGCTGCTCCAACTGGACCTCCAACTTCCTAGTCGGATTG
CTCTTCCCCTCTGCTGCTTACTATTTAGGAGCCTACGTTTTTATTATCTTCACCGGCTTCCTCATTACCTTCTTGGCCTTTACCTTCTTC
AAAGTCCCTGAGACCCGTGGCAGGACTTTTGAGGATATCACACGGGCCTTTGAAGGGCAGGCACACGGTGCAGATAGATCTGGGAAGGAC

>In-frame_KRAS_ENST00000557334_chr12_25398208_-_SLC2A14_ENST00000431042_chr12_7985410_-_1587nt
ATGACTGAATATAAACTTGTGGTAGTTGGAGCTGGTGGCGTAGGCAAGAGTGCCTTGACGATACAGCTAATTCAGAATCATTTTGTGGAC
GAATATGATCCAACAATAGAGGTCACCCCAGCTCTGATCTTTGCCATCACAGTTGCTACAATCGGCTCTTTCCAGTTTGGCTACAACACT
GGGGTCATCAATGCTCCTGAGACGATCATAAAGGAATTTATCAATAAAACTTTGACGGACAAGGCAAATGCCCCTCCCTCTGAGGTGCTG
CTCACGAATCTCTGGTCCTTGTCTGTGGCCATATTTTCCGTCGGGGGTATGATCGGCTCCTTTTCCGTCGGACTCTTTGTTAACCGCTTT
GGCAGGCGCAATTCAATGCTGATTGTCAACCTGTTGGCTGCCACTGGTGGCTGCCTTATGGGACTGTGTAAAATAGCTGAGTCAGTTGAA
ATGCTGATCCTGGGCCGCTTGGTTATTGGCCTCTTCTGCGGACTCTGCACAGGTTTTGTGCCCATGTACATTGGAGAGATCTCGCCTACT
GCCCTGAGGGGTGCCTTTGGCACTCTCAACCAGCTGGGCATAGTTATTGGAATTCTGGTGGCCCAGATCTTTGGTCTGGAACTCATCCTT
GGGTCTGAAGAGCTATGGCCGGTGCTATTAGGCTTTACCATCCTTCCAGCTATCCTGCAAAGTGCAGCCCTTCCATGTTGCCCTGAAAGT
CCCAGATTTTTGCTCATTAACAGAAAAAAAGAGGAGAATGCTACGCGGATCCTCCAGCGGTTGTGGGGCACCCAGGATGTATCCCAAGAC
ATCCAGGAGATGAAAGATGAGAGTGCAAGGATGTCACAAGAAAAGCAAGTCACCGTGCTGGAGCTCTTTAGAGTGTCCAGCTACCGACAG
CCCATCATCATTTCCATTGTGCTCCAGCTCTCTCAGCAGCTCTCTGGGATCAATGCTGTGTTCTATTACTCAACAGGAATCTTCAAGGAT
GCAGGTGTTCAACAGCCCATCTATGCCACCATCAGCGCGGGTGTGGTTAATACTATCTTCACTTTACTTTCTCTATTTCTGGTGGAAAGG
GCAGGAAGAAGGACTCTGCATATGATAGGCCTTGGAGGGATGGCTTTTTGTTCCACGCTCATGACTGTTTCTTTGTTATTAAAGAATCAC
TATAATGGGATGAGCTTTGTCTGTATTGGGGCTATCTTGGTCTTTGTGGCCTGTTTTGAAATTGGACCAGGCCCCATTCCCTGGTTTATT
GTGGCCGAACTCTTCAGCCAGGGCCCCCGCCCAGCTGCGATGGCAGTGGCCGGCTGCTCCAACTGGACCTCCAACTTCCTAGTCGGATTG
CTCTTCCCCTCTGCTGCTTACTATTTAGGAGCCTACGTTTTTATTATCTTCACCGGCTTCCTCATTACCTTCTTGGCCTTTACCTTCTTC
AAAGTCCCTGAGACCCGTGGCAGGACTTTTGAGGATATCACACGGGCCTTTGAAGGGCAGGCACACGGTGCAGATAGATCTGGGAAGGAC

>In-frame_KRAS_ENST00000256078_chr12_25398208_-_SLC2A14_ENST00000340749_chr12_7985410_-_1587nt
ATGACTGAATATAAACTTGTGGTAGTTGGAGCTGGTGGCGTAGGCAAGAGTGCCTTGACGATACAGCTAATTCAGAATCATTTTGTGGAC
GAATATGATCCAACAATAGAGGTCACCCCAGCTCTGATCTTTGCCATCACAGTTGCTACAATCGGCTCTTTCCAGTTTGGCTACAACACT
GGGGTCATCAATGCTCCTGAGACGATCATAAAGGAATTTATCAATAAAACTTTGACGGACAAGGCAAATGCCCCTCCCTCTGAGGTGCTG
CTCACGAATCTCTGGTCCTTGTCTGTGGCCATATTTTCCGTCGGGGGTATGATCGGCTCCTTTTCCGTCGGACTCTTTGTTAACCGCTTT
GGCAGGCGCAATTCAATGCTGATTGTCAACCTGTTGGCTGCCACTGGTGGCTGCCTTATGGGACTGTGTAAAATAGCTGAGTCAGTTGAA
ATGCTGATCCTGGGCCGCTTGGTTATTGGCCTCTTCTGCGGACTCTGCACAGGTTTTGTGCCCATGTACATTGGAGAGATCTCGCCTACT
GCCCTGAGGGGTGCCTTTGGCACTCTCAACCAGCTGGGCATAGTTATTGGAATTCTGGTGGCCCAGATCTTTGGTCTGGAACTCATCCTT
GGGTCTGAAGAGCTATGGCCGGTGCTATTAGGCTTTACCATCCTTCCAGCTATCCTGCAAAGTGCAGCCCTTCCATGTTGCCCTGAAAGT
CCCAGATTTTTGCTCATTAACAGAAAAAAAGAGGAGAATGCTACGCGGATCCTCCAGCGGTTGTGGGGCACCCAGGATGTATCCCAAGAC
ATCCAGGAGATGAAAGATGAGAGTGCAAGGATGTCACAAGAAAAGCAAGTCACCGTGCTGGAGCTCTTTAGAGTGTCCAGCTACCGACAG
CCCATCATCATTTCCATTGTGCTCCAGCTCTCTCAGCAGCTCTCTGGGATCAATGCTGTGTTCTATTACTCAACAGGAATCTTCAAGGAT
GCAGGTGTTCAACAGCCCATCTATGCCACCATCAGCGCGGGTGTGGTTAATACTATCTTCACTTTACTTTCTCTATTTCTGGTGGAAAGG
GCAGGAAGAAGGACTCTGCATATGATAGGCCTTGGAGGGATGGCTTTTTGTTCCACGCTCATGACTGTTTCTTTGTTATTAAAGAATCAC
TATAATGGGATGAGCTTTGTCTGTATTGGGGCTATCTTGGTCTTTGTGGCCTGTTTTGAAATTGGACCAGGCCCCATTCCCTGGTTTATT
GTGGCCGAACTCTTCAGCCAGGGCCCCCGCCCAGCTGCGATGGCAGTGGCCGGCTGCTCCAACTGGACCTCCAACTTCCTAGTCGGATTG
CTCTTCCCCTCTGCTGCTTACTATTTAGGAGCCTACGTTTTTATTATCTTCACCGGCTTCCTCATTACCTTCTTGGCCTTTACCTTCTTC
AAAGTCCCTGAGACCCGTGGCAGGACTTTTGAGGATATCACACGGGCCTTTGAAGGGCAGGCACACGGTGCAGATAGATCTGGGAAGGAC

>In-frame_KRAS_ENST00000256078_chr12_25398208_-_SLC2A14_ENST00000543909_chr12_7985410_-_1587nt
ATGACTGAATATAAACTTGTGGTAGTTGGAGCTGGTGGCGTAGGCAAGAGTGCCTTGACGATACAGCTAATTCAGAATCATTTTGTGGAC
GAATATGATCCAACAATAGAGGTCACCCCAGCTCTGATCTTTGCCATCACAGTTGCTACAATCGGCTCTTTCCAGTTTGGCTACAACACT
GGGGTCATCAATGCTCCTGAGACGATCATAAAGGAATTTATCAATAAAACTTTGACGGACAAGGCAAATGCCCCTCCCTCTGAGGTGCTG
CTCACGAATCTCTGGTCCTTGTCTGTGGCCATATTTTCCGTCGGGGGTATGATCGGCTCCTTTTCCGTCGGACTCTTTGTTAACCGCTTT
GGCAGGCGCAATTCAATGCTGATTGTCAACCTGTTGGCTGCCACTGGTGGCTGCCTTATGGGACTGTGTAAAATAGCTGAGTCAGTTGAA
ATGCTGATCCTGGGCCGCTTGGTTATTGGCCTCTTCTGCGGACTCTGCACAGGTTTTGTGCCCATGTACATTGGAGAGATCTCGCCTACT
GCCCTGAGGGGTGCCTTTGGCACTCTCAACCAGCTGGGCATAGTTATTGGAATTCTGGTGGCCCAGATCTTTGGTCTGGAACTCATCCTT
GGGTCTGAAGAGCTATGGCCGGTGCTATTAGGCTTTACCATCCTTCCAGCTATCCTGCAAAGTGCAGCCCTTCCATGTTGCCCTGAAAGT
CCCAGATTTTTGCTCATTAACAGAAAAAAAGAGGAGAATGCTACGCGGATCCTCCAGCGGTTGTGGGGCACCCAGGATGTATCCCAAGAC
ATCCAGGAGATGAAAGATGAGAGTGCAAGGATGTCACAAGAAAAGCAAGTCACCGTGCTGGAGCTCTTTAGAGTGTCCAGCTACCGACAG
CCCATCATCATTTCCATTGTGCTCCAGCTCTCTCAGCAGCTCTCTGGGATCAATGCTGTGTTCTATTACTCAACAGGAATCTTCAAGGAT
GCAGGTGTTCAACAGCCCATCTATGCCACCATCAGCGCGGGTGTGGTTAATACTATCTTCACTTTACTTTCTCTATTTCTGGTGGAAAGG
GCAGGAAGAAGGACTCTGCATATGATAGGCCTTGGAGGGATGGCTTTTTGTTCCACGCTCATGACTGTTTCTTTGTTATTAAAGAATCAC
TATAATGGGATGAGCTTTGTCTGTATTGGGGCTATCTTGGTCTTTGTGGCCTGTTTTGAAATTGGACCAGGCCCCATTCCCTGGTTTATT
GTGGCCGAACTCTTCAGCCAGGGCCCCCGCCCAGCTGCGATGGCAGTGGCCGGCTGCTCCAACTGGACCTCCAACTTCCTAGTCGGATTG
CTCTTCCCCTCTGCTGCTTACTATTTAGGAGCCTACGTTTTTATTATCTTCACCGGCTTCCTCATTACCTTCTTGGCCTTTACCTTCTTC
AAAGTCCCTGAGACCCGTGGCAGGACTTTTGAGGATATCACACGGGCCTTTGAAGGGCAGGCACACGGTGCAGATAGATCTGGGAAGGAC

>In-frame_KRAS_ENST00000256078_chr12_25398208_-_SLC2A14_ENST00000431042_chr12_7985410_-_1587nt
ATGACTGAATATAAACTTGTGGTAGTTGGAGCTGGTGGCGTAGGCAAGAGTGCCTTGACGATACAGCTAATTCAGAATCATTTTGTGGAC
GAATATGATCCAACAATAGAGGTCACCCCAGCTCTGATCTTTGCCATCACAGTTGCTACAATCGGCTCTTTCCAGTTTGGCTACAACACT
GGGGTCATCAATGCTCCTGAGACGATCATAAAGGAATTTATCAATAAAACTTTGACGGACAAGGCAAATGCCCCTCCCTCTGAGGTGCTG
CTCACGAATCTCTGGTCCTTGTCTGTGGCCATATTTTCCGTCGGGGGTATGATCGGCTCCTTTTCCGTCGGACTCTTTGTTAACCGCTTT
GGCAGGCGCAATTCAATGCTGATTGTCAACCTGTTGGCTGCCACTGGTGGCTGCCTTATGGGACTGTGTAAAATAGCTGAGTCAGTTGAA
ATGCTGATCCTGGGCCGCTTGGTTATTGGCCTCTTCTGCGGACTCTGCACAGGTTTTGTGCCCATGTACATTGGAGAGATCTCGCCTACT
GCCCTGAGGGGTGCCTTTGGCACTCTCAACCAGCTGGGCATAGTTATTGGAATTCTGGTGGCCCAGATCTTTGGTCTGGAACTCATCCTT
GGGTCTGAAGAGCTATGGCCGGTGCTATTAGGCTTTACCATCCTTCCAGCTATCCTGCAAAGTGCAGCCCTTCCATGTTGCCCTGAAAGT
CCCAGATTTTTGCTCATTAACAGAAAAAAAGAGGAGAATGCTACGCGGATCCTCCAGCGGTTGTGGGGCACCCAGGATGTATCCCAAGAC
ATCCAGGAGATGAAAGATGAGAGTGCAAGGATGTCACAAGAAAAGCAAGTCACCGTGCTGGAGCTCTTTAGAGTGTCCAGCTACCGACAG
CCCATCATCATTTCCATTGTGCTCCAGCTCTCTCAGCAGCTCTCTGGGATCAATGCTGTGTTCTATTACTCAACAGGAATCTTCAAGGAT
GCAGGTGTTCAACAGCCCATCTATGCCACCATCAGCGCGGGTGTGGTTAATACTATCTTCACTTTACTTTCTCTATTTCTGGTGGAAAGG
GCAGGAAGAAGGACTCTGCATATGATAGGCCTTGGAGGGATGGCTTTTTGTTCCACGCTCATGACTGTTTCTTTGTTATTAAAGAATCAC
TATAATGGGATGAGCTTTGTCTGTATTGGGGCTATCTTGGTCTTTGTGGCCTGTTTTGAAATTGGACCAGGCCCCATTCCCTGGTTTATT
GTGGCCGAACTCTTCAGCCAGGGCCCCCGCCCAGCTGCGATGGCAGTGGCCGGCTGCTCCAACTGGACCTCCAACTTCCTAGTCGGATTG
CTCTTCCCCTCTGCTGCTTACTATTTAGGAGCCTACGTTTTTATTATCTTCACCGGCTTCCTCATTACCTTCTTGGCCTTTACCTTCTTC
AAAGTCCCTGAGACCCGTGGCAGGACTTTTGAGGATATCACACGGGCCTTTGAAGGGCAGGCACACGGTGCAGATAGATCTGGGAAGGAC


* Fusion transcript sequences (Full-length transcript).
>In-frame_KRAS_ENST00000311936_chr12_25398208_-_SLC2A14_ENST00000340749_chr12_7985410_-_3583nt
TCCTAGGCGGCGGCCGCGGCGGCGGAGGCAGCAGCGGCGGCGGCAGTGGCGGCGGCGAAGGTGGCGGCGGCTCGGCCAGTACTCCCGGCC
CCCGCCATTTCGGACTGGGAGCGAGCGCGGCGCAGGCACTGAAGGCGGCGGCGGGGCCAGAGGCTCAGCGGCTCCCAGGTGCGGGAGAGA
GGCCTGCTGAAAATGACTGAATATAAACTTGTGGTAGTTGGAGCTGGTGGCGTAGGCAAGAGTGCCTTGACGATACAGCTAATTCAGAAT
CATTTTGTGGACGAATATGATCCAACAATAGAGGTCACCCCAGCTCTGATCTTTGCCATCACAGTTGCTACAATCGGCTCTTTCCAGTTT
GGCTACAACACTGGGGTCATCAATGCTCCTGAGACGATCATAAAGGAATTTATCAATAAAACTTTGACGGACAAGGCAAATGCCCCTCCC
TCTGAGGTGCTGCTCACGAATCTCTGGTCCTTGTCTGTGGCCATATTTTCCGTCGGGGGTATGATCGGCTCCTTTTCCGTCGGACTCTTT
GTTAACCGCTTTGGCAGGCGCAATTCAATGCTGATTGTCAACCTGTTGGCTGCCACTGGTGGCTGCCTTATGGGACTGTGTAAAATAGCT
GAGTCAGTTGAAATGCTGATCCTGGGCCGCTTGGTTATTGGCCTCTTCTGCGGACTCTGCACAGGTTTTGTGCCCATGTACATTGGAGAG
ATCTCGCCTACTGCCCTGAGGGGTGCCTTTGGCACTCTCAACCAGCTGGGCATAGTTATTGGAATTCTGGTGGCCCAGATCTTTGGTCTG
GAACTCATCCTTGGGTCTGAAGAGCTATGGCCGGTGCTATTAGGCTTTACCATCCTTCCAGCTATCCTGCAAAGTGCAGCCCTTCCATGT
TGCCCTGAAAGTCCCAGATTTTTGCTCATTAACAGAAAAAAAGAGGAGAATGCTACGCGGATCCTCCAGCGGTTGTGGGGCACCCAGGAT
GTATCCCAAGACATCCAGGAGATGAAAGATGAGAGTGCAAGGATGTCACAAGAAAAGCAAGTCACCGTGCTGGAGCTCTTTAGAGTGTCC
AGCTACCGACAGCCCATCATCATTTCCATTGTGCTCCAGCTCTCTCAGCAGCTCTCTGGGATCAATGCTGTGTTCTATTACTCAACAGGA
ATCTTCAAGGATGCAGGTGTTCAACAGCCCATCTATGCCACCATCAGCGCGGGTGTGGTTAATACTATCTTCACTTTACTTTCTCTATTT
CTGGTGGAAAGGGCAGGAAGAAGGACTCTGCATATGATAGGCCTTGGAGGGATGGCTTTTTGTTCCACGCTCATGACTGTTTCTTTGTTA
TTAAAGAATCACTATAATGGGATGAGCTTTGTCTGTATTGGGGCTATCTTGGTCTTTGTGGCCTGTTTTGAAATTGGACCAGGCCCCATT
CCCTGGTTTATTGTGGCCGAACTCTTCAGCCAGGGCCCCCGCCCAGCTGCGATGGCAGTGGCCGGCTGCTCCAACTGGACCTCCAACTTC
CTAGTCGGATTGCTCTTCCCCTCTGCTGCTTACTATTTAGGAGCCTACGTTTTTATTATCTTCACCGGCTTCCTCATTACCTTCTTGGCC
TTTACCTTCTTCAAAGTCCCTGAGACCCGTGGCAGGACTTTTGAGGATATCACACGGGCCTTTGAAGGGCAGGCACACGGTGCAGATAGA
TCTGGGAAGGACGGCGTCATGGGGATGAACAGCATCGAGCCTGCTAAGGAGACCACCACCAATGTCTAAGTCATGCCTCCTTCCACCTCC
CTCCCGGCATGGGAAAGCCACCTCTCCCTCAACAAGGGAGAGACTTTATCAGGATGAACCCAGGACTGCTTCTGAATGCTGCTACTTGAT
TTCTTTCTCATCCCACGCACTCCATGAGCACCCCAAGGCTGCAGTTTGTTGGATCTTCAATGGCTTTTTAAATTTTATTTCCTGGACATC
CTCTTCTGCTTAGGAGAGACCGAGTGAACCTACCTTCATTTCAGGAGGGATTGGCCGCTTGGCACATGACAACTTTGCCAGCTTTTCCTC
CCTTGGGTTCTGATATTGCCGCACTAGAGGATATAGGAGAGGAAAAGTAAGGTGCAGTTGCCCCAACCTCAGACTTACCAGGAAGCAGAT
ACATATGAGTGTGGAAGCCGGAGGGTGTTTATGTAAGAGCACCTTCCTCACTTCCATACAGCTCTACGCGGCAAATTAACTTGAGTTTTA
TTTATCTTATCCTCTGGTTTAATTACATAAATATTTATTTTTTAAGTGTAATTTTGCCAAATAATAAAAACAGAAGGAAATTGAGATTAG
AGGGAGGTGTTTAAAGAGAGGTTATAGAGTAAAAGATTTGATGCTGGAGAGGTTAAGGTGCAATAAGAATTCAGGGAGAAATGTTGTTCA
TTATTGGAGGGTAAATGATGTGGTGCCTGAGGTCTGTACATTACCTCTTAACAATTTCTGTCCTTCAGATGGAAACTCTTTGATTTCTCA
GAAAAGTTGTATGCCTATTTAATAAAGCTACTCATTTCCTTTGGAACTTTATCTTTAAGATAATAGTTTACATGTAGTAGTACTTGAAAT
CTAGGATTATTAACTAATATGGGCATTGTAGTTAATGGCGGTTGATGGGTTCTAATTTTGGATGGAGTCCAGGGAAGAGAAAGTGATTTC
TAGAAAGCCTGTTCCCCTCACTGGACGAAATAACTCCTTGTAGTAGTCTCATTACTTTTGAAGTAATCCCGCCACCTATCTAGTGGGAGA
GCCATCCAAATGAGAAACCTAAAATAATTGGTTCTTGGTAGAGATTCATTATTTCTCCACTTTGTTCTTTAGGAGATTTTAGGTGTTGAT
TTTCTGTTTTATTTTAACTCATACCTTTAAAGGAATTCCCCAAAGAATGTTTACAGCAAACTTGGAATTTGTAACCTCAGCTCTGGGAGA
GGATTTTTTTCTGAGCGATTATTATCTAAAGTGTGTTGTTGCTTTAGGCTCACGGCACGCTTGCGTATGTCTGTTACCATGTCACTGTGG
TCCTATGCCGAATGCCCTCAGGGGACTTGAATCTTTCCAATAAACCAGGTTTAGACAGTATGAGTCAATGTGCAGTGCAGCCCACACTTG
AGAGGATGAATGTATGTGCACTGTCACTTTGCTCTGGGTGGAAGTATGTTATTGTTGACTTATTTTCTCTGTGTTTGTTCCTACAGCCCC
TTTTTCATATGTTGCTCAGTCTCCCTTTCCCTTCTTGGTGCTTACACATCTCAGACCCTTTAGCCAAACCCTTGCCAGTGACAGTATTTT
GGTTCTCAGTTCTCACTGTTCCCTCTGCTCCTGGAGCCTTTGAATAAAAATGCACGTAGCTATGGAGTGGGGTTTAGCTGGAAAGGTGGC
CTTCCAACTTCACGTCAACTTCTGGCTCCTCAGTTTGGCAGTAAGGCAGGGAAGTTGTTTTCCTATTTCTCACTGAGAAGATTGTGAATA

>In-frame_KRAS_ENST00000311936_chr12_25398208_-_SLC2A14_ENST00000543909_chr12_7985410_-_3581nt
TCCTAGGCGGCGGCCGCGGCGGCGGAGGCAGCAGCGGCGGCGGCAGTGGCGGCGGCGAAGGTGGCGGCGGCTCGGCCAGTACTCCCGGCC
CCCGCCATTTCGGACTGGGAGCGAGCGCGGCGCAGGCACTGAAGGCGGCGGCGGGGCCAGAGGCTCAGCGGCTCCCAGGTGCGGGAGAGA
GGCCTGCTGAAAATGACTGAATATAAACTTGTGGTAGTTGGAGCTGGTGGCGTAGGCAAGAGTGCCTTGACGATACAGCTAATTCAGAAT
CATTTTGTGGACGAATATGATCCAACAATAGAGGTCACCCCAGCTCTGATCTTTGCCATCACAGTTGCTACAATCGGCTCTTTCCAGTTT
GGCTACAACACTGGGGTCATCAATGCTCCTGAGACGATCATAAAGGAATTTATCAATAAAACTTTGACGGACAAGGCAAATGCCCCTCCC
TCTGAGGTGCTGCTCACGAATCTCTGGTCCTTGTCTGTGGCCATATTTTCCGTCGGGGGTATGATCGGCTCCTTTTCCGTCGGACTCTTT
GTTAACCGCTTTGGCAGGCGCAATTCAATGCTGATTGTCAACCTGTTGGCTGCCACTGGTGGCTGCCTTATGGGACTGTGTAAAATAGCT
GAGTCAGTTGAAATGCTGATCCTGGGCCGCTTGGTTATTGGCCTCTTCTGCGGACTCTGCACAGGTTTTGTGCCCATGTACATTGGAGAG
ATCTCGCCTACTGCCCTGAGGGGTGCCTTTGGCACTCTCAACCAGCTGGGCATAGTTATTGGAATTCTGGTGGCCCAGATCTTTGGTCTG
GAACTCATCCTTGGGTCTGAAGAGCTATGGCCGGTGCTATTAGGCTTTACCATCCTTCCAGCTATCCTGCAAAGTGCAGCCCTTCCATGT
TGCCCTGAAAGTCCCAGATTTTTGCTCATTAACAGAAAAAAAGAGGAGAATGCTACGCGGATCCTCCAGCGGTTGTGGGGCACCCAGGAT
GTATCCCAAGACATCCAGGAGATGAAAGATGAGAGTGCAAGGATGTCACAAGAAAAGCAAGTCACCGTGCTGGAGCTCTTTAGAGTGTCC
AGCTACCGACAGCCCATCATCATTTCCATTGTGCTCCAGCTCTCTCAGCAGCTCTCTGGGATCAATGCTGTGTTCTATTACTCAACAGGA
ATCTTCAAGGATGCAGGTGTTCAACAGCCCATCTATGCCACCATCAGCGCGGGTGTGGTTAATACTATCTTCACTTTACTTTCTCTATTT
CTGGTGGAAAGGGCAGGAAGAAGGACTCTGCATATGATAGGCCTTGGAGGGATGGCTTTTTGTTCCACGCTCATGACTGTTTCTTTGTTA
TTAAAGAATCACTATAATGGGATGAGCTTTGTCTGTATTGGGGCTATCTTGGTCTTTGTGGCCTGTTTTGAAATTGGACCAGGCCCCATT
CCCTGGTTTATTGTGGCCGAACTCTTCAGCCAGGGCCCCCGCCCAGCTGCGATGGCAGTGGCCGGCTGCTCCAACTGGACCTCCAACTTC
CTAGTCGGATTGCTCTTCCCCTCTGCTGCTTACTATTTAGGAGCCTACGTTTTTATTATCTTCACCGGCTTCCTCATTACCTTCTTGGCC
TTTACCTTCTTCAAAGTCCCTGAGACCCGTGGCAGGACTTTTGAGGATATCACACGGGCCTTTGAAGGGCAGGCACACGGTGCAGATAGA
TCTGGGAAGGACGGCGTCATGGGGATGAACAGCATCGAGCCTGCTAAGGAGACCACCACCAATGTCTAAGTCATGCCTCCTTCCACCTCC
CTCCCGGCATGGGAAAGCCACCTCTCCCTCAACAAGGGAGAGACTTTATCAGGATGAACCCAGGACTGCTTCTGAATGCTGCTACTTGAT
TTCTTTCTCATCCCACGCACTCCATGAGCACCCCAAGGCTGCAGTTTGTTGGATCTTCAATGGCTTTTTAAATTTTATTTCCTGGACATC
CTCTTCTGCTTAGGAGAGACCGAGTGAACCTACCTTCATTTCAGGAGGGATTGGCCGCTTGGCACATGACAACTTTGCCAGCTTTTCCTC
CCTTGGGTTCTGATATTGCCGCACTAGAGGATATAGGAGAGGAAAAGTAAGGTGCAGTTGCCCCAACCTCAGACTTACCAGGAAGCAGAT
ACATATGAGTGTGGAAGCCGGAGGGTGTTTATGTAAGAGCACCTTCCTCACTTCCATACAGCTCTACGCGGCAAATTAACTTGAGTTTTA
TTTATCTTATCCTCTGGTTTAATTACATAAATATTTATTTTTTAAGTGTAATTTTGCCAAATAATAAAAACAGAAGGAAATTGAGATTAG
AGGGAGGTGTTTAAAGAGAGGTTATAGAGTAAAAGATTTGATGCTGGAGAGGTTAAGGTGCAATAAGAATTCAGGGAGAAATGTTGTTCA
TTATTGGAGGGTAAATGATGTGGTGCCTGAGGTCTGTACATTACCTCTTAACAATTTCTGTCCTTCAGATGGAAACTCTTTGATTTCTCA
GAAAAGTTGTATGCCTATTTAATAAAGCTACTCATTTCCTTTGGAACTTTATCTTTAAGATAATAGTTTACATGTAGTAGTACTTGAAAT
CTAGGATTATTAACTAATATGGGCATTGTAGTTAATGGCGGTTGATGGGTTCTAATTTTGGATGGAGTCCAGGGAAGAGAAAGTGATTTC
TAGAAAGCCTGTTCCCCTCACTGGACGAAATAACTCCTTGTAGTAGTCTCATTACTTTTGAAGTAATCCCGCCACCTATCTAGTGGGAGA
GCCATCCAAATGAGAAACCTAAAATAATTGGTTCTTGGTAGAGATTCATTATTTCTCCACTTTGTTCTTTAGGAGATTTTAGGTGTTGAT
TTTCTGTTTTATTTTAACTCATACCTTTAAAGGAATTCCCCAAAGAATGTTTACAGCAAACTTGGAATTTGTAACCTCAGCTCTGGGAGA
GGATTTTTTTCTGAGCGATTATTATCTAAAGTGTGTTGTTGCTTTAGGCTCACGGCACGCTTGCGTATGTCTGTTACCATGTCACTGTGG
TCCTATGCCGAATGCCCTCAGGGGACTTGAATCTTTCCAATAAACCAGGTTTAGACAGTATGAGTCAATGTGCAGTGCAGCCCACACTTG
AGAGGATGAATGTATGTGCACTGTCACTTTGCTCTGGGTGGAAGTATGTTATTGTTGACTTATTTTCTCTGTGTTTGTTCCTACAGCCCC
TTTTTCATATGTTGCTCAGTCTCCCTTTCCCTTCTTGGTGCTTACACATCTCAGACCCTTTAGCCAAACCCTTGCCAGTGACAGTATTTT
GGTTCTCAGTTCTCACTGTTCCCTCTGCTCCTGGAGCCTTTGAATAAAAATGCACGTAGCTATGGAGTGGGGTTTAGCTGGAAAGGTGGC
CTTCCAACTTCACGTCAACTTCTGGCTCCTCAGTTTGGCAGTAAGGCAGGGAAGTTGTTTTCCTATTTCTCACTGAGAAGATTGTGAATA

>In-frame_KRAS_ENST00000311936_chr12_25398208_-_SLC2A14_ENST00000431042_chr12_7985410_-_3576nt
TCCTAGGCGGCGGCCGCGGCGGCGGAGGCAGCAGCGGCGGCGGCAGTGGCGGCGGCGAAGGTGGCGGCGGCTCGGCCAGTACTCCCGGCC
CCCGCCATTTCGGACTGGGAGCGAGCGCGGCGCAGGCACTGAAGGCGGCGGCGGGGCCAGAGGCTCAGCGGCTCCCAGGTGCGGGAGAGA
GGCCTGCTGAAAATGACTGAATATAAACTTGTGGTAGTTGGAGCTGGTGGCGTAGGCAAGAGTGCCTTGACGATACAGCTAATTCAGAAT
CATTTTGTGGACGAATATGATCCAACAATAGAGGTCACCCCAGCTCTGATCTTTGCCATCACAGTTGCTACAATCGGCTCTTTCCAGTTT
GGCTACAACACTGGGGTCATCAATGCTCCTGAGACGATCATAAAGGAATTTATCAATAAAACTTTGACGGACAAGGCAAATGCCCCTCCC
TCTGAGGTGCTGCTCACGAATCTCTGGTCCTTGTCTGTGGCCATATTTTCCGTCGGGGGTATGATCGGCTCCTTTTCCGTCGGACTCTTT
GTTAACCGCTTTGGCAGGCGCAATTCAATGCTGATTGTCAACCTGTTGGCTGCCACTGGTGGCTGCCTTATGGGACTGTGTAAAATAGCT
GAGTCAGTTGAAATGCTGATCCTGGGCCGCTTGGTTATTGGCCTCTTCTGCGGACTCTGCACAGGTTTTGTGCCCATGTACATTGGAGAG
ATCTCGCCTACTGCCCTGAGGGGTGCCTTTGGCACTCTCAACCAGCTGGGCATAGTTATTGGAATTCTGGTGGCCCAGATCTTTGGTCTG
GAACTCATCCTTGGGTCTGAAGAGCTATGGCCGGTGCTATTAGGCTTTACCATCCTTCCAGCTATCCTGCAAAGTGCAGCCCTTCCATGT
TGCCCTGAAAGTCCCAGATTTTTGCTCATTAACAGAAAAAAAGAGGAGAATGCTACGCGGATCCTCCAGCGGTTGTGGGGCACCCAGGAT
GTATCCCAAGACATCCAGGAGATGAAAGATGAGAGTGCAAGGATGTCACAAGAAAAGCAAGTCACCGTGCTGGAGCTCTTTAGAGTGTCC
AGCTACCGACAGCCCATCATCATTTCCATTGTGCTCCAGCTCTCTCAGCAGCTCTCTGGGATCAATGCTGTGTTCTATTACTCAACAGGA
ATCTTCAAGGATGCAGGTGTTCAACAGCCCATCTATGCCACCATCAGCGCGGGTGTGGTTAATACTATCTTCACTTTACTTTCTCTATTT
CTGGTGGAAAGGGCAGGAAGAAGGACTCTGCATATGATAGGCCTTGGAGGGATGGCTTTTTGTTCCACGCTCATGACTGTTTCTTTGTTA
TTAAAGAATCACTATAATGGGATGAGCTTTGTCTGTATTGGGGCTATCTTGGTCTTTGTGGCCTGTTTTGAAATTGGACCAGGCCCCATT
CCCTGGTTTATTGTGGCCGAACTCTTCAGCCAGGGCCCCCGCCCAGCTGCGATGGCAGTGGCCGGCTGCTCCAACTGGACCTCCAACTTC
CTAGTCGGATTGCTCTTCCCCTCTGCTGCTTACTATTTAGGAGCCTACGTTTTTATTATCTTCACCGGCTTCCTCATTACCTTCTTGGCC
TTTACCTTCTTCAAAGTCCCTGAGACCCGTGGCAGGACTTTTGAGGATATCACACGGGCCTTTGAAGGGCAGGCACACGGTGCAGATAGA
TCTGGGAAGGACGGCGTCATGGGGATGAACAGCATCGAGCCTGCTAAGGAGACCACCACCAATGTCTAAGTCATGCCTCCTTCCACCTCC
CTCCCGGCATGGGAAAGCCACCTCTCCCTCAACAAGGGAGAGACTTTATCAGGATGAACCCAGGACTGCTTCTGAATGCTGCTACTTGAT
TTCTTTCTCATCCCACGCACTCCATGAGCACCCCAAGGCTGCAGTTTGTTGGATCTTCAATGGCTTTTTAAATTTTATTTCCTGGACATC
CTCTTCTGCTTAGGAGAGACCGAGTGAACCTACCTTCATTTCAGGAGGGATTGGCCGCTTGGCACATGACAACTTTGCCAGCTTTTCCTC
CCTTGGGTTCTGATATTGCCGCACTAGAGGATATAGGAGAGGAAAAGTAAGGTGCAGTTGCCCCAACCTCAGACTTACCAGGAAGCAGAT
ACATATGAGTGTGGAAGCCGGAGGGTGTTTATGTAAGAGCACCTTCCTCACTTCCATACAGCTCTACGCGGCAAATTAACTTGAGTTTTA
TTTATCTTATCCTCTGGTTTAATTACATAAATATTTATTTTTTAAGTGTAATTTTGCCAAATAATAAAAACAGAAGGAAATTGAGATTAG
AGGGAGGTGTTTAAAGAGAGGTTATAGAGTAAAAGATTTGATGCTGGAGAGGTTAAGGTGCAATAAGAATTCAGGGAGAAATGTTGTTCA
TTATTGGAGGGTAAATGATGTGGTGCCTGAGGTCTGTACATTACCTCTTAACAATTTCTGTCCTTCAGATGGAAACTCTTTGATTTCTCA
GAAAAGTTGTATGCCTATTTAATAAAGCTACTCATTTCCTTTGGAACTTTATCTTTAAGATAATAGTTTACATGTAGTAGTACTTGAAAT
CTAGGATTATTAACTAATATGGGCATTGTAGTTAATGGCGGTTGATGGGTTCTAATTTTGGATGGAGTCCAGGGAAGAGAAAGTGATTTC
TAGAAAGCCTGTTCCCCTCACTGGACGAAATAACTCCTTGTAGTAGTCTCATTACTTTTGAAGTAATCCCGCCACCTATCTAGTGGGAGA
GCCATCCAAATGAGAAACCTAAAATAATTGGTTCTTGGTAGAGATTCATTATTTCTCCACTTTGTTCTTTAGGAGATTTTAGGTGTTGAT
TTTCTGTTTTATTTTAACTCATACCTTTAAAGGAATTCCCCAAAGAATGTTTACAGCAAACTTGGAATTTGTAACCTCAGCTCTGGGAGA
GGATTTTTTTCTGAGCGATTATTATCTAAAGTGTGTTGTTGCTTTAGGCTCACGGCACGCTTGCGTATGTCTGTTACCATGTCACTGTGG
TCCTATGCCGAATGCCCTCAGGGGACTTGAATCTTTCCAATAAACCAGGTTTAGACAGTATGAGTCAATGTGCAGTGCAGCCCACACTTG
AGAGGATGAATGTATGTGCACTGTCACTTTGCTCTGGGTGGAAGTATGTTATTGTTGACTTATTTTCTCTGTGTTTGTTCCTACAGCCCC
TTTTTCATATGTTGCTCAGTCTCCCTTTCCCTTCTTGGTGCTTACACATCTCAGACCCTTTAGCCAAACCCTTGCCAGTGACAGTATTTT
GGTTCTCAGTTCTCACTGTTCCCTCTGCTCCTGGAGCCTTTGAATAAAAATGCACGTAGCTATGGAGTGGGGTTTAGCTGGAAAGGTGGC
CTTCCAACTTCACGTCAACTTCTGGCTCCTCAGTTTGGCAGTAAGGCAGGGAAGTTGTTTTCCTATTTCTCACTGAGAAGATTGTGAATA

>In-frame_KRAS_ENST00000557334_chr12_25398208_-_SLC2A14_ENST00000340749_chr12_7985410_-_3588nt
GATTTTCCTAGGCGGCGGCCGCGGCGGCGGAGGCAGCAGCGGCGGCGGCAGTGGCGGCGGCGAAGGTGGCGGCGGCTCGGCCAGTACTCC
CGGCCCCCGCCATTTCGGACTGGGAGCGAGCGCGGCGCAGGCACTGAAGGCGGCGGCGGGGCCAGAGGCTCAGCGGCTCCCAGGTGCGGG
AGAGAGGCCTGCTGAAAATGACTGAATATAAACTTGTGGTAGTTGGAGCTGGTGGCGTAGGCAAGAGTGCCTTGACGATACAGCTAATTC
AGAATCATTTTGTGGACGAATATGATCCAACAATAGAGGTCACCCCAGCTCTGATCTTTGCCATCACAGTTGCTACAATCGGCTCTTTCC
AGTTTGGCTACAACACTGGGGTCATCAATGCTCCTGAGACGATCATAAAGGAATTTATCAATAAAACTTTGACGGACAAGGCAAATGCCC
CTCCCTCTGAGGTGCTGCTCACGAATCTCTGGTCCTTGTCTGTGGCCATATTTTCCGTCGGGGGTATGATCGGCTCCTTTTCCGTCGGAC
TCTTTGTTAACCGCTTTGGCAGGCGCAATTCAATGCTGATTGTCAACCTGTTGGCTGCCACTGGTGGCTGCCTTATGGGACTGTGTAAAA
TAGCTGAGTCAGTTGAAATGCTGATCCTGGGCCGCTTGGTTATTGGCCTCTTCTGCGGACTCTGCACAGGTTTTGTGCCCATGTACATTG
GAGAGATCTCGCCTACTGCCCTGAGGGGTGCCTTTGGCACTCTCAACCAGCTGGGCATAGTTATTGGAATTCTGGTGGCCCAGATCTTTG
GTCTGGAACTCATCCTTGGGTCTGAAGAGCTATGGCCGGTGCTATTAGGCTTTACCATCCTTCCAGCTATCCTGCAAAGTGCAGCCCTTC
CATGTTGCCCTGAAAGTCCCAGATTTTTGCTCATTAACAGAAAAAAAGAGGAGAATGCTACGCGGATCCTCCAGCGGTTGTGGGGCACCC
AGGATGTATCCCAAGACATCCAGGAGATGAAAGATGAGAGTGCAAGGATGTCACAAGAAAAGCAAGTCACCGTGCTGGAGCTCTTTAGAG
TGTCCAGCTACCGACAGCCCATCATCATTTCCATTGTGCTCCAGCTCTCTCAGCAGCTCTCTGGGATCAATGCTGTGTTCTATTACTCAA
CAGGAATCTTCAAGGATGCAGGTGTTCAACAGCCCATCTATGCCACCATCAGCGCGGGTGTGGTTAATACTATCTTCACTTTACTTTCTC
TATTTCTGGTGGAAAGGGCAGGAAGAAGGACTCTGCATATGATAGGCCTTGGAGGGATGGCTTTTTGTTCCACGCTCATGACTGTTTCTT
TGTTATTAAAGAATCACTATAATGGGATGAGCTTTGTCTGTATTGGGGCTATCTTGGTCTTTGTGGCCTGTTTTGAAATTGGACCAGGCC
CCATTCCCTGGTTTATTGTGGCCGAACTCTTCAGCCAGGGCCCCCGCCCAGCTGCGATGGCAGTGGCCGGCTGCTCCAACTGGACCTCCA
ACTTCCTAGTCGGATTGCTCTTCCCCTCTGCTGCTTACTATTTAGGAGCCTACGTTTTTATTATCTTCACCGGCTTCCTCATTACCTTCT
TGGCCTTTACCTTCTTCAAAGTCCCTGAGACCCGTGGCAGGACTTTTGAGGATATCACACGGGCCTTTGAAGGGCAGGCACACGGTGCAG
ATAGATCTGGGAAGGACGGCGTCATGGGGATGAACAGCATCGAGCCTGCTAAGGAGACCACCACCAATGTCTAAGTCATGCCTCCTTCCA
CCTCCCTCCCGGCATGGGAAAGCCACCTCTCCCTCAACAAGGGAGAGACTTTATCAGGATGAACCCAGGACTGCTTCTGAATGCTGCTAC
TTGATTTCTTTCTCATCCCACGCACTCCATGAGCACCCCAAGGCTGCAGTTTGTTGGATCTTCAATGGCTTTTTAAATTTTATTTCCTGG
ACATCCTCTTCTGCTTAGGAGAGACCGAGTGAACCTACCTTCATTTCAGGAGGGATTGGCCGCTTGGCACATGACAACTTTGCCAGCTTT
TCCTCCCTTGGGTTCTGATATTGCCGCACTAGAGGATATAGGAGAGGAAAAGTAAGGTGCAGTTGCCCCAACCTCAGACTTACCAGGAAG
CAGATACATATGAGTGTGGAAGCCGGAGGGTGTTTATGTAAGAGCACCTTCCTCACTTCCATACAGCTCTACGCGGCAAATTAACTTGAG
TTTTATTTATCTTATCCTCTGGTTTAATTACATAAATATTTATTTTTTAAGTGTAATTTTGCCAAATAATAAAAACAGAAGGAAATTGAG
ATTAGAGGGAGGTGTTTAAAGAGAGGTTATAGAGTAAAAGATTTGATGCTGGAGAGGTTAAGGTGCAATAAGAATTCAGGGAGAAATGTT
GTTCATTATTGGAGGGTAAATGATGTGGTGCCTGAGGTCTGTACATTACCTCTTAACAATTTCTGTCCTTCAGATGGAAACTCTTTGATT
TCTCAGAAAAGTTGTATGCCTATTTAATAAAGCTACTCATTTCCTTTGGAACTTTATCTTTAAGATAATAGTTTACATGTAGTAGTACTT
GAAATCTAGGATTATTAACTAATATGGGCATTGTAGTTAATGGCGGTTGATGGGTTCTAATTTTGGATGGAGTCCAGGGAAGAGAAAGTG
ATTTCTAGAAAGCCTGTTCCCCTCACTGGACGAAATAACTCCTTGTAGTAGTCTCATTACTTTTGAAGTAATCCCGCCACCTATCTAGTG
GGAGAGCCATCCAAATGAGAAACCTAAAATAATTGGTTCTTGGTAGAGATTCATTATTTCTCCACTTTGTTCTTTAGGAGATTTTAGGTG
TTGATTTTCTGTTTTATTTTAACTCATACCTTTAAAGGAATTCCCCAAAGAATGTTTACAGCAAACTTGGAATTTGTAACCTCAGCTCTG
GGAGAGGATTTTTTTCTGAGCGATTATTATCTAAAGTGTGTTGTTGCTTTAGGCTCACGGCACGCTTGCGTATGTCTGTTACCATGTCAC
TGTGGTCCTATGCCGAATGCCCTCAGGGGACTTGAATCTTTCCAATAAACCAGGTTTAGACAGTATGAGTCAATGTGCAGTGCAGCCCAC
ACTTGAGAGGATGAATGTATGTGCACTGTCACTTTGCTCTGGGTGGAAGTATGTTATTGTTGACTTATTTTCTCTGTGTTTGTTCCTACA
GCCCCTTTTTCATATGTTGCTCAGTCTCCCTTTCCCTTCTTGGTGCTTACACATCTCAGACCCTTTAGCCAAACCCTTGCCAGTGACAGT
ATTTTGGTTCTCAGTTCTCACTGTTCCCTCTGCTCCTGGAGCCTTTGAATAAAAATGCACGTAGCTATGGAGTGGGGTTTAGCTGGAAAG
GTGGCCTTCCAACTTCACGTCAACTTCTGGCTCCTCAGTTTGGCAGTAAGGCAGGGAAGTTGTTTTCCTATTTCTCACTGAGAAGATTGT

>In-frame_KRAS_ENST00000557334_chr12_25398208_-_SLC2A14_ENST00000543909_chr12_7985410_-_3586nt
GATTTTCCTAGGCGGCGGCCGCGGCGGCGGAGGCAGCAGCGGCGGCGGCAGTGGCGGCGGCGAAGGTGGCGGCGGCTCGGCCAGTACTCC
CGGCCCCCGCCATTTCGGACTGGGAGCGAGCGCGGCGCAGGCACTGAAGGCGGCGGCGGGGCCAGAGGCTCAGCGGCTCCCAGGTGCGGG
AGAGAGGCCTGCTGAAAATGACTGAATATAAACTTGTGGTAGTTGGAGCTGGTGGCGTAGGCAAGAGTGCCTTGACGATACAGCTAATTC
AGAATCATTTTGTGGACGAATATGATCCAACAATAGAGGTCACCCCAGCTCTGATCTTTGCCATCACAGTTGCTACAATCGGCTCTTTCC
AGTTTGGCTACAACACTGGGGTCATCAATGCTCCTGAGACGATCATAAAGGAATTTATCAATAAAACTTTGACGGACAAGGCAAATGCCC
CTCCCTCTGAGGTGCTGCTCACGAATCTCTGGTCCTTGTCTGTGGCCATATTTTCCGTCGGGGGTATGATCGGCTCCTTTTCCGTCGGAC
TCTTTGTTAACCGCTTTGGCAGGCGCAATTCAATGCTGATTGTCAACCTGTTGGCTGCCACTGGTGGCTGCCTTATGGGACTGTGTAAAA
TAGCTGAGTCAGTTGAAATGCTGATCCTGGGCCGCTTGGTTATTGGCCTCTTCTGCGGACTCTGCACAGGTTTTGTGCCCATGTACATTG
GAGAGATCTCGCCTACTGCCCTGAGGGGTGCCTTTGGCACTCTCAACCAGCTGGGCATAGTTATTGGAATTCTGGTGGCCCAGATCTTTG
GTCTGGAACTCATCCTTGGGTCTGAAGAGCTATGGCCGGTGCTATTAGGCTTTACCATCCTTCCAGCTATCCTGCAAAGTGCAGCCCTTC
CATGTTGCCCTGAAAGTCCCAGATTTTTGCTCATTAACAGAAAAAAAGAGGAGAATGCTACGCGGATCCTCCAGCGGTTGTGGGGCACCC
AGGATGTATCCCAAGACATCCAGGAGATGAAAGATGAGAGTGCAAGGATGTCACAAGAAAAGCAAGTCACCGTGCTGGAGCTCTTTAGAG
TGTCCAGCTACCGACAGCCCATCATCATTTCCATTGTGCTCCAGCTCTCTCAGCAGCTCTCTGGGATCAATGCTGTGTTCTATTACTCAA
CAGGAATCTTCAAGGATGCAGGTGTTCAACAGCCCATCTATGCCACCATCAGCGCGGGTGTGGTTAATACTATCTTCACTTTACTTTCTC
TATTTCTGGTGGAAAGGGCAGGAAGAAGGACTCTGCATATGATAGGCCTTGGAGGGATGGCTTTTTGTTCCACGCTCATGACTGTTTCTT
TGTTATTAAAGAATCACTATAATGGGATGAGCTTTGTCTGTATTGGGGCTATCTTGGTCTTTGTGGCCTGTTTTGAAATTGGACCAGGCC
CCATTCCCTGGTTTATTGTGGCCGAACTCTTCAGCCAGGGCCCCCGCCCAGCTGCGATGGCAGTGGCCGGCTGCTCCAACTGGACCTCCA
ACTTCCTAGTCGGATTGCTCTTCCCCTCTGCTGCTTACTATTTAGGAGCCTACGTTTTTATTATCTTCACCGGCTTCCTCATTACCTTCT
TGGCCTTTACCTTCTTCAAAGTCCCTGAGACCCGTGGCAGGACTTTTGAGGATATCACACGGGCCTTTGAAGGGCAGGCACACGGTGCAG
ATAGATCTGGGAAGGACGGCGTCATGGGGATGAACAGCATCGAGCCTGCTAAGGAGACCACCACCAATGTCTAAGTCATGCCTCCTTCCA
CCTCCCTCCCGGCATGGGAAAGCCACCTCTCCCTCAACAAGGGAGAGACTTTATCAGGATGAACCCAGGACTGCTTCTGAATGCTGCTAC
TTGATTTCTTTCTCATCCCACGCACTCCATGAGCACCCCAAGGCTGCAGTTTGTTGGATCTTCAATGGCTTTTTAAATTTTATTTCCTGG
ACATCCTCTTCTGCTTAGGAGAGACCGAGTGAACCTACCTTCATTTCAGGAGGGATTGGCCGCTTGGCACATGACAACTTTGCCAGCTTT
TCCTCCCTTGGGTTCTGATATTGCCGCACTAGAGGATATAGGAGAGGAAAAGTAAGGTGCAGTTGCCCCAACCTCAGACTTACCAGGAAG
CAGATACATATGAGTGTGGAAGCCGGAGGGTGTTTATGTAAGAGCACCTTCCTCACTTCCATACAGCTCTACGCGGCAAATTAACTTGAG
TTTTATTTATCTTATCCTCTGGTTTAATTACATAAATATTTATTTTTTAAGTGTAATTTTGCCAAATAATAAAAACAGAAGGAAATTGAG
ATTAGAGGGAGGTGTTTAAAGAGAGGTTATAGAGTAAAAGATTTGATGCTGGAGAGGTTAAGGTGCAATAAGAATTCAGGGAGAAATGTT
GTTCATTATTGGAGGGTAAATGATGTGGTGCCTGAGGTCTGTACATTACCTCTTAACAATTTCTGTCCTTCAGATGGAAACTCTTTGATT
TCTCAGAAAAGTTGTATGCCTATTTAATAAAGCTACTCATTTCCTTTGGAACTTTATCTTTAAGATAATAGTTTACATGTAGTAGTACTT
GAAATCTAGGATTATTAACTAATATGGGCATTGTAGTTAATGGCGGTTGATGGGTTCTAATTTTGGATGGAGTCCAGGGAAGAGAAAGTG
ATTTCTAGAAAGCCTGTTCCCCTCACTGGACGAAATAACTCCTTGTAGTAGTCTCATTACTTTTGAAGTAATCCCGCCACCTATCTAGTG
GGAGAGCCATCCAAATGAGAAACCTAAAATAATTGGTTCTTGGTAGAGATTCATTATTTCTCCACTTTGTTCTTTAGGAGATTTTAGGTG
TTGATTTTCTGTTTTATTTTAACTCATACCTTTAAAGGAATTCCCCAAAGAATGTTTACAGCAAACTTGGAATTTGTAACCTCAGCTCTG
GGAGAGGATTTTTTTCTGAGCGATTATTATCTAAAGTGTGTTGTTGCTTTAGGCTCACGGCACGCTTGCGTATGTCTGTTACCATGTCAC
TGTGGTCCTATGCCGAATGCCCTCAGGGGACTTGAATCTTTCCAATAAACCAGGTTTAGACAGTATGAGTCAATGTGCAGTGCAGCCCAC
ACTTGAGAGGATGAATGTATGTGCACTGTCACTTTGCTCTGGGTGGAAGTATGTTATTGTTGACTTATTTTCTCTGTGTTTGTTCCTACA
GCCCCTTTTTCATATGTTGCTCAGTCTCCCTTTCCCTTCTTGGTGCTTACACATCTCAGACCCTTTAGCCAAACCCTTGCCAGTGACAGT
ATTTTGGTTCTCAGTTCTCACTGTTCCCTCTGCTCCTGGAGCCTTTGAATAAAAATGCACGTAGCTATGGAGTGGGGTTTAGCTGGAAAG
GTGGCCTTCCAACTTCACGTCAACTTCTGGCTCCTCAGTTTGGCAGTAAGGCAGGGAAGTTGTTTTCCTATTTCTCACTGAGAAGATTGT

>In-frame_KRAS_ENST00000557334_chr12_25398208_-_SLC2A14_ENST00000431042_chr12_7985410_-_3581nt
GATTTTCCTAGGCGGCGGCCGCGGCGGCGGAGGCAGCAGCGGCGGCGGCAGTGGCGGCGGCGAAGGTGGCGGCGGCTCGGCCAGTACTCC
CGGCCCCCGCCATTTCGGACTGGGAGCGAGCGCGGCGCAGGCACTGAAGGCGGCGGCGGGGCCAGAGGCTCAGCGGCTCCCAGGTGCGGG
AGAGAGGCCTGCTGAAAATGACTGAATATAAACTTGTGGTAGTTGGAGCTGGTGGCGTAGGCAAGAGTGCCTTGACGATACAGCTAATTC
AGAATCATTTTGTGGACGAATATGATCCAACAATAGAGGTCACCCCAGCTCTGATCTTTGCCATCACAGTTGCTACAATCGGCTCTTTCC
AGTTTGGCTACAACACTGGGGTCATCAATGCTCCTGAGACGATCATAAAGGAATTTATCAATAAAACTTTGACGGACAAGGCAAATGCCC
CTCCCTCTGAGGTGCTGCTCACGAATCTCTGGTCCTTGTCTGTGGCCATATTTTCCGTCGGGGGTATGATCGGCTCCTTTTCCGTCGGAC
TCTTTGTTAACCGCTTTGGCAGGCGCAATTCAATGCTGATTGTCAACCTGTTGGCTGCCACTGGTGGCTGCCTTATGGGACTGTGTAAAA
TAGCTGAGTCAGTTGAAATGCTGATCCTGGGCCGCTTGGTTATTGGCCTCTTCTGCGGACTCTGCACAGGTTTTGTGCCCATGTACATTG
GAGAGATCTCGCCTACTGCCCTGAGGGGTGCCTTTGGCACTCTCAACCAGCTGGGCATAGTTATTGGAATTCTGGTGGCCCAGATCTTTG
GTCTGGAACTCATCCTTGGGTCTGAAGAGCTATGGCCGGTGCTATTAGGCTTTACCATCCTTCCAGCTATCCTGCAAAGTGCAGCCCTTC
CATGTTGCCCTGAAAGTCCCAGATTTTTGCTCATTAACAGAAAAAAAGAGGAGAATGCTACGCGGATCCTCCAGCGGTTGTGGGGCACCC
AGGATGTATCCCAAGACATCCAGGAGATGAAAGATGAGAGTGCAAGGATGTCACAAGAAAAGCAAGTCACCGTGCTGGAGCTCTTTAGAG
TGTCCAGCTACCGACAGCCCATCATCATTTCCATTGTGCTCCAGCTCTCTCAGCAGCTCTCTGGGATCAATGCTGTGTTCTATTACTCAA
CAGGAATCTTCAAGGATGCAGGTGTTCAACAGCCCATCTATGCCACCATCAGCGCGGGTGTGGTTAATACTATCTTCACTTTACTTTCTC
TATTTCTGGTGGAAAGGGCAGGAAGAAGGACTCTGCATATGATAGGCCTTGGAGGGATGGCTTTTTGTTCCACGCTCATGACTGTTTCTT
TGTTATTAAAGAATCACTATAATGGGATGAGCTTTGTCTGTATTGGGGCTATCTTGGTCTTTGTGGCCTGTTTTGAAATTGGACCAGGCC
CCATTCCCTGGTTTATTGTGGCCGAACTCTTCAGCCAGGGCCCCCGCCCAGCTGCGATGGCAGTGGCCGGCTGCTCCAACTGGACCTCCA
ACTTCCTAGTCGGATTGCTCTTCCCCTCTGCTGCTTACTATTTAGGAGCCTACGTTTTTATTATCTTCACCGGCTTCCTCATTACCTTCT
TGGCCTTTACCTTCTTCAAAGTCCCTGAGACCCGTGGCAGGACTTTTGAGGATATCACACGGGCCTTTGAAGGGCAGGCACACGGTGCAG
ATAGATCTGGGAAGGACGGCGTCATGGGGATGAACAGCATCGAGCCTGCTAAGGAGACCACCACCAATGTCTAAGTCATGCCTCCTTCCA
CCTCCCTCCCGGCATGGGAAAGCCACCTCTCCCTCAACAAGGGAGAGACTTTATCAGGATGAACCCAGGACTGCTTCTGAATGCTGCTAC
TTGATTTCTTTCTCATCCCACGCACTCCATGAGCACCCCAAGGCTGCAGTTTGTTGGATCTTCAATGGCTTTTTAAATTTTATTTCCTGG
ACATCCTCTTCTGCTTAGGAGAGACCGAGTGAACCTACCTTCATTTCAGGAGGGATTGGCCGCTTGGCACATGACAACTTTGCCAGCTTT
TCCTCCCTTGGGTTCTGATATTGCCGCACTAGAGGATATAGGAGAGGAAAAGTAAGGTGCAGTTGCCCCAACCTCAGACTTACCAGGAAG
CAGATACATATGAGTGTGGAAGCCGGAGGGTGTTTATGTAAGAGCACCTTCCTCACTTCCATACAGCTCTACGCGGCAAATTAACTTGAG
TTTTATTTATCTTATCCTCTGGTTTAATTACATAAATATTTATTTTTTAAGTGTAATTTTGCCAAATAATAAAAACAGAAGGAAATTGAG
ATTAGAGGGAGGTGTTTAAAGAGAGGTTATAGAGTAAAAGATTTGATGCTGGAGAGGTTAAGGTGCAATAAGAATTCAGGGAGAAATGTT
GTTCATTATTGGAGGGTAAATGATGTGGTGCCTGAGGTCTGTACATTACCTCTTAACAATTTCTGTCCTTCAGATGGAAACTCTTTGATT
TCTCAGAAAAGTTGTATGCCTATTTAATAAAGCTACTCATTTCCTTTGGAACTTTATCTTTAAGATAATAGTTTACATGTAGTAGTACTT
GAAATCTAGGATTATTAACTAATATGGGCATTGTAGTTAATGGCGGTTGATGGGTTCTAATTTTGGATGGAGTCCAGGGAAGAGAAAGTG
ATTTCTAGAAAGCCTGTTCCCCTCACTGGACGAAATAACTCCTTGTAGTAGTCTCATTACTTTTGAAGTAATCCCGCCACCTATCTAGTG
GGAGAGCCATCCAAATGAGAAACCTAAAATAATTGGTTCTTGGTAGAGATTCATTATTTCTCCACTTTGTTCTTTAGGAGATTTTAGGTG
TTGATTTTCTGTTTTATTTTAACTCATACCTTTAAAGGAATTCCCCAAAGAATGTTTACAGCAAACTTGGAATTTGTAACCTCAGCTCTG
GGAGAGGATTTTTTTCTGAGCGATTATTATCTAAAGTGTGTTGTTGCTTTAGGCTCACGGCACGCTTGCGTATGTCTGTTACCATGTCAC
TGTGGTCCTATGCCGAATGCCCTCAGGGGACTTGAATCTTTCCAATAAACCAGGTTTAGACAGTATGAGTCAATGTGCAGTGCAGCCCAC
ACTTGAGAGGATGAATGTATGTGCACTGTCACTTTGCTCTGGGTGGAAGTATGTTATTGTTGACTTATTTTCTCTGTGTTTGTTCCTACA
GCCCCTTTTTCATATGTTGCTCAGTCTCCCTTTCCCTTCTTGGTGCTTACACATCTCAGACCCTTTAGCCAAACCCTTGCCAGTGACAGT
ATTTTGGTTCTCAGTTCTCACTGTTCCCTCTGCTCCTGGAGCCTTTGAATAAAAATGCACGTAGCTATGGAGTGGGGTTTAGCTGGAAAG
GTGGCCTTCCAACTTCACGTCAACTTCTGGCTCCTCAGTTTGGCAGTAAGGCAGGGAAGTTGTTTTCCTATTTCTCACTGAGAAGATTGT

>In-frame_KRAS_ENST00000256078_chr12_25398208_-_SLC2A14_ENST00000340749_chr12_7985410_-_3455nt
CTGAAGGCGGCGGCGGGGCCAGAGGCTCAGCGGCTCCCAGGTGCGGGAGAGAGGCCTGCTGAAAATGACTGAATATAAACTTGTGGTAGT
TGGAGCTGGTGGCGTAGGCAAGAGTGCCTTGACGATACAGCTAATTCAGAATCATTTTGTGGACGAATATGATCCAACAATAGAGGTCAC
CCCAGCTCTGATCTTTGCCATCACAGTTGCTACAATCGGCTCTTTCCAGTTTGGCTACAACACTGGGGTCATCAATGCTCCTGAGACGAT
CATAAAGGAATTTATCAATAAAACTTTGACGGACAAGGCAAATGCCCCTCCCTCTGAGGTGCTGCTCACGAATCTCTGGTCCTTGTCTGT
GGCCATATTTTCCGTCGGGGGTATGATCGGCTCCTTTTCCGTCGGACTCTTTGTTAACCGCTTTGGCAGGCGCAATTCAATGCTGATTGT
CAACCTGTTGGCTGCCACTGGTGGCTGCCTTATGGGACTGTGTAAAATAGCTGAGTCAGTTGAAATGCTGATCCTGGGCCGCTTGGTTAT
TGGCCTCTTCTGCGGACTCTGCACAGGTTTTGTGCCCATGTACATTGGAGAGATCTCGCCTACTGCCCTGAGGGGTGCCTTTGGCACTCT
CAACCAGCTGGGCATAGTTATTGGAATTCTGGTGGCCCAGATCTTTGGTCTGGAACTCATCCTTGGGTCTGAAGAGCTATGGCCGGTGCT
ATTAGGCTTTACCATCCTTCCAGCTATCCTGCAAAGTGCAGCCCTTCCATGTTGCCCTGAAAGTCCCAGATTTTTGCTCATTAACAGAAA
AAAAGAGGAGAATGCTACGCGGATCCTCCAGCGGTTGTGGGGCACCCAGGATGTATCCCAAGACATCCAGGAGATGAAAGATGAGAGTGC
AAGGATGTCACAAGAAAAGCAAGTCACCGTGCTGGAGCTCTTTAGAGTGTCCAGCTACCGACAGCCCATCATCATTTCCATTGTGCTCCA
GCTCTCTCAGCAGCTCTCTGGGATCAATGCTGTGTTCTATTACTCAACAGGAATCTTCAAGGATGCAGGTGTTCAACAGCCCATCTATGC
CACCATCAGCGCGGGTGTGGTTAATACTATCTTCACTTTACTTTCTCTATTTCTGGTGGAAAGGGCAGGAAGAAGGACTCTGCATATGAT
AGGCCTTGGAGGGATGGCTTTTTGTTCCACGCTCATGACTGTTTCTTTGTTATTAAAGAATCACTATAATGGGATGAGCTTTGTCTGTAT
TGGGGCTATCTTGGTCTTTGTGGCCTGTTTTGAAATTGGACCAGGCCCCATTCCCTGGTTTATTGTGGCCGAACTCTTCAGCCAGGGCCC
CCGCCCAGCTGCGATGGCAGTGGCCGGCTGCTCCAACTGGACCTCCAACTTCCTAGTCGGATTGCTCTTCCCCTCTGCTGCTTACTATTT
AGGAGCCTACGTTTTTATTATCTTCACCGGCTTCCTCATTACCTTCTTGGCCTTTACCTTCTTCAAAGTCCCTGAGACCCGTGGCAGGAC
TTTTGAGGATATCACACGGGCCTTTGAAGGGCAGGCACACGGTGCAGATAGATCTGGGAAGGACGGCGTCATGGGGATGAACAGCATCGA
GCCTGCTAAGGAGACCACCACCAATGTCTAAGTCATGCCTCCTTCCACCTCCCTCCCGGCATGGGAAAGCCACCTCTCCCTCAACAAGGG
AGAGACTTTATCAGGATGAACCCAGGACTGCTTCTGAATGCTGCTACTTGATTTCTTTCTCATCCCACGCACTCCATGAGCACCCCAAGG
CTGCAGTTTGTTGGATCTTCAATGGCTTTTTAAATTTTATTTCCTGGACATCCTCTTCTGCTTAGGAGAGACCGAGTGAACCTACCTTCA
TTTCAGGAGGGATTGGCCGCTTGGCACATGACAACTTTGCCAGCTTTTCCTCCCTTGGGTTCTGATATTGCCGCACTAGAGGATATAGGA
GAGGAAAAGTAAGGTGCAGTTGCCCCAACCTCAGACTTACCAGGAAGCAGATACATATGAGTGTGGAAGCCGGAGGGTGTTTATGTAAGA
GCACCTTCCTCACTTCCATACAGCTCTACGCGGCAAATTAACTTGAGTTTTATTTATCTTATCCTCTGGTTTAATTACATAAATATTTAT
TTTTTAAGTGTAATTTTGCCAAATAATAAAAACAGAAGGAAATTGAGATTAGAGGGAGGTGTTTAAAGAGAGGTTATAGAGTAAAAGATT
TGATGCTGGAGAGGTTAAGGTGCAATAAGAATTCAGGGAGAAATGTTGTTCATTATTGGAGGGTAAATGATGTGGTGCCTGAGGTCTGTA
CATTACCTCTTAACAATTTCTGTCCTTCAGATGGAAACTCTTTGATTTCTCAGAAAAGTTGTATGCCTATTTAATAAAGCTACTCATTTC
CTTTGGAACTTTATCTTTAAGATAATAGTTTACATGTAGTAGTACTTGAAATCTAGGATTATTAACTAATATGGGCATTGTAGTTAATGG
CGGTTGATGGGTTCTAATTTTGGATGGAGTCCAGGGAAGAGAAAGTGATTTCTAGAAAGCCTGTTCCCCTCACTGGACGAAATAACTCCT
TGTAGTAGTCTCATTACTTTTGAAGTAATCCCGCCACCTATCTAGTGGGAGAGCCATCCAAATGAGAAACCTAAAATAATTGGTTCTTGG
TAGAGATTCATTATTTCTCCACTTTGTTCTTTAGGAGATTTTAGGTGTTGATTTTCTGTTTTATTTTAACTCATACCTTTAAAGGAATTC
CCCAAAGAATGTTTACAGCAAACTTGGAATTTGTAACCTCAGCTCTGGGAGAGGATTTTTTTCTGAGCGATTATTATCTAAAGTGTGTTG
TTGCTTTAGGCTCACGGCACGCTTGCGTATGTCTGTTACCATGTCACTGTGGTCCTATGCCGAATGCCCTCAGGGGACTTGAATCTTTCC
AATAAACCAGGTTTAGACAGTATGAGTCAATGTGCAGTGCAGCCCACACTTGAGAGGATGAATGTATGTGCACTGTCACTTTGCTCTGGG
TGGAAGTATGTTATTGTTGACTTATTTTCTCTGTGTTTGTTCCTACAGCCCCTTTTTCATATGTTGCTCAGTCTCCCTTTCCCTTCTTGG
TGCTTACACATCTCAGACCCTTTAGCCAAACCCTTGCCAGTGACAGTATTTTGGTTCTCAGTTCTCACTGTTCCCTCTGCTCCTGGAGCC
TTTGAATAAAAATGCACGTAGCTATGGAGTGGGGTTTAGCTGGAAAGGTGGCCTTCCAACTTCACGTCAACTTCTGGCTCCTCAGTTTGG
CAGTAAGGCAGGGAAGTTGTTTTCCTATTTCTCACTGAGAAGATTGTGAATATTTCCATATGGATTTTCCATTATTGTTTGTTTGATTCT

>In-frame_KRAS_ENST00000256078_chr12_25398208_-_SLC2A14_ENST00000543909_chr12_7985410_-_3453nt
CTGAAGGCGGCGGCGGGGCCAGAGGCTCAGCGGCTCCCAGGTGCGGGAGAGAGGCCTGCTGAAAATGACTGAATATAAACTTGTGGTAGT
TGGAGCTGGTGGCGTAGGCAAGAGTGCCTTGACGATACAGCTAATTCAGAATCATTTTGTGGACGAATATGATCCAACAATAGAGGTCAC
CCCAGCTCTGATCTTTGCCATCACAGTTGCTACAATCGGCTCTTTCCAGTTTGGCTACAACACTGGGGTCATCAATGCTCCTGAGACGAT
CATAAAGGAATTTATCAATAAAACTTTGACGGACAAGGCAAATGCCCCTCCCTCTGAGGTGCTGCTCACGAATCTCTGGTCCTTGTCTGT
GGCCATATTTTCCGTCGGGGGTATGATCGGCTCCTTTTCCGTCGGACTCTTTGTTAACCGCTTTGGCAGGCGCAATTCAATGCTGATTGT
CAACCTGTTGGCTGCCACTGGTGGCTGCCTTATGGGACTGTGTAAAATAGCTGAGTCAGTTGAAATGCTGATCCTGGGCCGCTTGGTTAT
TGGCCTCTTCTGCGGACTCTGCACAGGTTTTGTGCCCATGTACATTGGAGAGATCTCGCCTACTGCCCTGAGGGGTGCCTTTGGCACTCT
CAACCAGCTGGGCATAGTTATTGGAATTCTGGTGGCCCAGATCTTTGGTCTGGAACTCATCCTTGGGTCTGAAGAGCTATGGCCGGTGCT
ATTAGGCTTTACCATCCTTCCAGCTATCCTGCAAAGTGCAGCCCTTCCATGTTGCCCTGAAAGTCCCAGATTTTTGCTCATTAACAGAAA
AAAAGAGGAGAATGCTACGCGGATCCTCCAGCGGTTGTGGGGCACCCAGGATGTATCCCAAGACATCCAGGAGATGAAAGATGAGAGTGC
AAGGATGTCACAAGAAAAGCAAGTCACCGTGCTGGAGCTCTTTAGAGTGTCCAGCTACCGACAGCCCATCATCATTTCCATTGTGCTCCA
GCTCTCTCAGCAGCTCTCTGGGATCAATGCTGTGTTCTATTACTCAACAGGAATCTTCAAGGATGCAGGTGTTCAACAGCCCATCTATGC
CACCATCAGCGCGGGTGTGGTTAATACTATCTTCACTTTACTTTCTCTATTTCTGGTGGAAAGGGCAGGAAGAAGGACTCTGCATATGAT
AGGCCTTGGAGGGATGGCTTTTTGTTCCACGCTCATGACTGTTTCTTTGTTATTAAAGAATCACTATAATGGGATGAGCTTTGTCTGTAT
TGGGGCTATCTTGGTCTTTGTGGCCTGTTTTGAAATTGGACCAGGCCCCATTCCCTGGTTTATTGTGGCCGAACTCTTCAGCCAGGGCCC
CCGCCCAGCTGCGATGGCAGTGGCCGGCTGCTCCAACTGGACCTCCAACTTCCTAGTCGGATTGCTCTTCCCCTCTGCTGCTTACTATTT
AGGAGCCTACGTTTTTATTATCTTCACCGGCTTCCTCATTACCTTCTTGGCCTTTACCTTCTTCAAAGTCCCTGAGACCCGTGGCAGGAC
TTTTGAGGATATCACACGGGCCTTTGAAGGGCAGGCACACGGTGCAGATAGATCTGGGAAGGACGGCGTCATGGGGATGAACAGCATCGA
GCCTGCTAAGGAGACCACCACCAATGTCTAAGTCATGCCTCCTTCCACCTCCCTCCCGGCATGGGAAAGCCACCTCTCCCTCAACAAGGG
AGAGACTTTATCAGGATGAACCCAGGACTGCTTCTGAATGCTGCTACTTGATTTCTTTCTCATCCCACGCACTCCATGAGCACCCCAAGG
CTGCAGTTTGTTGGATCTTCAATGGCTTTTTAAATTTTATTTCCTGGACATCCTCTTCTGCTTAGGAGAGACCGAGTGAACCTACCTTCA
TTTCAGGAGGGATTGGCCGCTTGGCACATGACAACTTTGCCAGCTTTTCCTCCCTTGGGTTCTGATATTGCCGCACTAGAGGATATAGGA
GAGGAAAAGTAAGGTGCAGTTGCCCCAACCTCAGACTTACCAGGAAGCAGATACATATGAGTGTGGAAGCCGGAGGGTGTTTATGTAAGA
GCACCTTCCTCACTTCCATACAGCTCTACGCGGCAAATTAACTTGAGTTTTATTTATCTTATCCTCTGGTTTAATTACATAAATATTTAT
TTTTTAAGTGTAATTTTGCCAAATAATAAAAACAGAAGGAAATTGAGATTAGAGGGAGGTGTTTAAAGAGAGGTTATAGAGTAAAAGATT
TGATGCTGGAGAGGTTAAGGTGCAATAAGAATTCAGGGAGAAATGTTGTTCATTATTGGAGGGTAAATGATGTGGTGCCTGAGGTCTGTA
CATTACCTCTTAACAATTTCTGTCCTTCAGATGGAAACTCTTTGATTTCTCAGAAAAGTTGTATGCCTATTTAATAAAGCTACTCATTTC
CTTTGGAACTTTATCTTTAAGATAATAGTTTACATGTAGTAGTACTTGAAATCTAGGATTATTAACTAATATGGGCATTGTAGTTAATGG
CGGTTGATGGGTTCTAATTTTGGATGGAGTCCAGGGAAGAGAAAGTGATTTCTAGAAAGCCTGTTCCCCTCACTGGACGAAATAACTCCT
TGTAGTAGTCTCATTACTTTTGAAGTAATCCCGCCACCTATCTAGTGGGAGAGCCATCCAAATGAGAAACCTAAAATAATTGGTTCTTGG
TAGAGATTCATTATTTCTCCACTTTGTTCTTTAGGAGATTTTAGGTGTTGATTTTCTGTTTTATTTTAACTCATACCTTTAAAGGAATTC
CCCAAAGAATGTTTACAGCAAACTTGGAATTTGTAACCTCAGCTCTGGGAGAGGATTTTTTTCTGAGCGATTATTATCTAAAGTGTGTTG
TTGCTTTAGGCTCACGGCACGCTTGCGTATGTCTGTTACCATGTCACTGTGGTCCTATGCCGAATGCCCTCAGGGGACTTGAATCTTTCC
AATAAACCAGGTTTAGACAGTATGAGTCAATGTGCAGTGCAGCCCACACTTGAGAGGATGAATGTATGTGCACTGTCACTTTGCTCTGGG
TGGAAGTATGTTATTGTTGACTTATTTTCTCTGTGTTTGTTCCTACAGCCCCTTTTTCATATGTTGCTCAGTCTCCCTTTCCCTTCTTGG
TGCTTACACATCTCAGACCCTTTAGCCAAACCCTTGCCAGTGACAGTATTTTGGTTCTCAGTTCTCACTGTTCCCTCTGCTCCTGGAGCC
TTTGAATAAAAATGCACGTAGCTATGGAGTGGGGTTTAGCTGGAAAGGTGGCCTTCCAACTTCACGTCAACTTCTGGCTCCTCAGTTTGG
CAGTAAGGCAGGGAAGTTGTTTTCCTATTTCTCACTGAGAAGATTGTGAATATTTCCATATGGATTTTCCATTATTGTTTGTTTGATTCT

>In-frame_KRAS_ENST00000256078_chr12_25398208_-_SLC2A14_ENST00000431042_chr12_7985410_-_3448nt
CTGAAGGCGGCGGCGGGGCCAGAGGCTCAGCGGCTCCCAGGTGCGGGAGAGAGGCCTGCTGAAAATGACTGAATATAAACTTGTGGTAGT
TGGAGCTGGTGGCGTAGGCAAGAGTGCCTTGACGATACAGCTAATTCAGAATCATTTTGTGGACGAATATGATCCAACAATAGAGGTCAC
CCCAGCTCTGATCTTTGCCATCACAGTTGCTACAATCGGCTCTTTCCAGTTTGGCTACAACACTGGGGTCATCAATGCTCCTGAGACGAT
CATAAAGGAATTTATCAATAAAACTTTGACGGACAAGGCAAATGCCCCTCCCTCTGAGGTGCTGCTCACGAATCTCTGGTCCTTGTCTGT
GGCCATATTTTCCGTCGGGGGTATGATCGGCTCCTTTTCCGTCGGACTCTTTGTTAACCGCTTTGGCAGGCGCAATTCAATGCTGATTGT
CAACCTGTTGGCTGCCACTGGTGGCTGCCTTATGGGACTGTGTAAAATAGCTGAGTCAGTTGAAATGCTGATCCTGGGCCGCTTGGTTAT
TGGCCTCTTCTGCGGACTCTGCACAGGTTTTGTGCCCATGTACATTGGAGAGATCTCGCCTACTGCCCTGAGGGGTGCCTTTGGCACTCT
CAACCAGCTGGGCATAGTTATTGGAATTCTGGTGGCCCAGATCTTTGGTCTGGAACTCATCCTTGGGTCTGAAGAGCTATGGCCGGTGCT
ATTAGGCTTTACCATCCTTCCAGCTATCCTGCAAAGTGCAGCCCTTCCATGTTGCCCTGAAAGTCCCAGATTTTTGCTCATTAACAGAAA
AAAAGAGGAGAATGCTACGCGGATCCTCCAGCGGTTGTGGGGCACCCAGGATGTATCCCAAGACATCCAGGAGATGAAAGATGAGAGTGC
AAGGATGTCACAAGAAAAGCAAGTCACCGTGCTGGAGCTCTTTAGAGTGTCCAGCTACCGACAGCCCATCATCATTTCCATTGTGCTCCA
GCTCTCTCAGCAGCTCTCTGGGATCAATGCTGTGTTCTATTACTCAACAGGAATCTTCAAGGATGCAGGTGTTCAACAGCCCATCTATGC
CACCATCAGCGCGGGTGTGGTTAATACTATCTTCACTTTACTTTCTCTATTTCTGGTGGAAAGGGCAGGAAGAAGGACTCTGCATATGAT
AGGCCTTGGAGGGATGGCTTTTTGTTCCACGCTCATGACTGTTTCTTTGTTATTAAAGAATCACTATAATGGGATGAGCTTTGTCTGTAT
TGGGGCTATCTTGGTCTTTGTGGCCTGTTTTGAAATTGGACCAGGCCCCATTCCCTGGTTTATTGTGGCCGAACTCTTCAGCCAGGGCCC
CCGCCCAGCTGCGATGGCAGTGGCCGGCTGCTCCAACTGGACCTCCAACTTCCTAGTCGGATTGCTCTTCCCCTCTGCTGCTTACTATTT
AGGAGCCTACGTTTTTATTATCTTCACCGGCTTCCTCATTACCTTCTTGGCCTTTACCTTCTTCAAAGTCCCTGAGACCCGTGGCAGGAC
TTTTGAGGATATCACACGGGCCTTTGAAGGGCAGGCACACGGTGCAGATAGATCTGGGAAGGACGGCGTCATGGGGATGAACAGCATCGA
GCCTGCTAAGGAGACCACCACCAATGTCTAAGTCATGCCTCCTTCCACCTCCCTCCCGGCATGGGAAAGCCACCTCTCCCTCAACAAGGG
AGAGACTTTATCAGGATGAACCCAGGACTGCTTCTGAATGCTGCTACTTGATTTCTTTCTCATCCCACGCACTCCATGAGCACCCCAAGG
CTGCAGTTTGTTGGATCTTCAATGGCTTTTTAAATTTTATTTCCTGGACATCCTCTTCTGCTTAGGAGAGACCGAGTGAACCTACCTTCA
TTTCAGGAGGGATTGGCCGCTTGGCACATGACAACTTTGCCAGCTTTTCCTCCCTTGGGTTCTGATATTGCCGCACTAGAGGATATAGGA
GAGGAAAAGTAAGGTGCAGTTGCCCCAACCTCAGACTTACCAGGAAGCAGATACATATGAGTGTGGAAGCCGGAGGGTGTTTATGTAAGA
GCACCTTCCTCACTTCCATACAGCTCTACGCGGCAAATTAACTTGAGTTTTATTTATCTTATCCTCTGGTTTAATTACATAAATATTTAT
TTTTTAAGTGTAATTTTGCCAAATAATAAAAACAGAAGGAAATTGAGATTAGAGGGAGGTGTTTAAAGAGAGGTTATAGAGTAAAAGATT
TGATGCTGGAGAGGTTAAGGTGCAATAAGAATTCAGGGAGAAATGTTGTTCATTATTGGAGGGTAAATGATGTGGTGCCTGAGGTCTGTA
CATTACCTCTTAACAATTTCTGTCCTTCAGATGGAAACTCTTTGATTTCTCAGAAAAGTTGTATGCCTATTTAATAAAGCTACTCATTTC
CTTTGGAACTTTATCTTTAAGATAATAGTTTACATGTAGTAGTACTTGAAATCTAGGATTATTAACTAATATGGGCATTGTAGTTAATGG
CGGTTGATGGGTTCTAATTTTGGATGGAGTCCAGGGAAGAGAAAGTGATTTCTAGAAAGCCTGTTCCCCTCACTGGACGAAATAACTCCT
TGTAGTAGTCTCATTACTTTTGAAGTAATCCCGCCACCTATCTAGTGGGAGAGCCATCCAAATGAGAAACCTAAAATAATTGGTTCTTGG
TAGAGATTCATTATTTCTCCACTTTGTTCTTTAGGAGATTTTAGGTGTTGATTTTCTGTTTTATTTTAACTCATACCTTTAAAGGAATTC
CCCAAAGAATGTTTACAGCAAACTTGGAATTTGTAACCTCAGCTCTGGGAGAGGATTTTTTTCTGAGCGATTATTATCTAAAGTGTGTTG
TTGCTTTAGGCTCACGGCACGCTTGCGTATGTCTGTTACCATGTCACTGTGGTCCTATGCCGAATGCCCTCAGGGGACTTGAATCTTTCC
AATAAACCAGGTTTAGACAGTATGAGTCAATGTGCAGTGCAGCCCACACTTGAGAGGATGAATGTATGTGCACTGTCACTTTGCTCTGGG
TGGAAGTATGTTATTGTTGACTTATTTTCTCTGTGTTTGTTCCTACAGCCCCTTTTTCATATGTTGCTCAGTCTCCCTTTCCCTTCTTGG
TGCTTACACATCTCAGACCCTTTAGCCAAACCCTTGCCAGTGACAGTATTTTGGTTCTCAGTTCTCACTGTTCCCTCTGCTCCTGGAGCC
TTTGAATAAAAATGCACGTAGCTATGGAGTGGGGTTTAGCTGGAAAGGTGGCCTTCCAACTTCACGTCAACTTCTGGCTCCTCAGTTTGG
CAGTAAGGCAGGGAAGTTGTTTTCCTATTTCTCACTGAGAAGATTGTGAATATTTCCATATGGATTTTCCATTATTGTTTGTTTGATTCT


Top

FusionGenePPI for KRAS_SLC2A14


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
KRASRAP1GDS1, HNRNPC, RASSF2, SHOC2, PIK3CA, RALGDS, RAF1, RASSF5, EPB42, PIK3CG, RASGRF2, DNAJA3, PDE4DIP, CCT7, EEF1A1, IGSF21, CALM1, ELAVL1, APP, PHB, EGLN1, LPAR1, RGL2, ADH6, PIK3R2, DDX47, DDX50, MAPK1, BTRC, BCL2, TRAF6, ARAF, MDFI, PSMA3, RBPMS, ZDHHC17, UNK, THOC1, TAF1, MAP2K1, PRPF31, JMJD4, KMT2E, MTNR1A, DIRAS3, RPS19, ZNF764, SVIL, RNFT1, KDM5B, CD83, CWC22, MFHAS1, TTC27, NXT2, PNPLA4, SFPQ, SNRPF, NUP98, TBC1D8, LMLN, ANAPC10, C12orf66, HKDC1, NONO, SLC9A8, ADAM10, RILPL2, RPL18A, PRPF3, COCH, SNRPD2, NAB1, NAPA, LTA4H, C16orf72, STK32A, BCAS2, CCDC114, NHEJ1, A2M, ABCB5, ACSM4, ACTR2, ACVRL1, ADAM22, ADAMTSL5, ADCY8, ALKBH3, ALKBH7, ANAPC1, ANAPC4, ANXA5, NAE1, NAA10, ARID1B, ARL4A, ARPC2, ARPC3, ASB16, CSRNP1, BFSP1, RPF2, BRIX1, RPF1, MRGPRG-AS1, FAM160A2, C11orf72, C12orf56, RGCC, SPACA7, URI1, SHCBP1L, TTPAL, MIS18A, LINC01547, EFCAB12, FNDC9, C6, C6orf48, TMEM248, RPP25L, C9orf84, CCDC171, CA12, CACNA2D2, CALR, CARM1, CASC5, CATSPER1, CCDC112, CCDC120, CCIN, CCNA2, CCT2, CDC16, CDC27, CDC73, CDCA8, CDH5, CDKL3, CHN1, CLCN1, CNOT1, COPS2, COPS4, COPS5, COPS8, COX4I2, CREG1, CRNKL1, CRNN, CTNNAL1, CTNS, CTTNBP2, CXCL16, BCORL1, CXorf40A, CYP11B1, DAG1, DCLK2, DCTN4, DDX43, DGCR14, DHRS7C, DHX38, DIDO1, DNM3, DNTTIP1, DYNLL2, EDA2R, EFNB2, EIF3A, EIF3G, EIF3C, EIF4A3, EMID1, ENPP4, ENPP5, EPRS, ERH, EXOSC10, EXOSC4, F2RL3, FAM115C, FANCA, FBL, KDM2A, FBXL20, FBXO36, FBXW7, FCGR1A, FEZ2, EBLN2, FLJ90680, FLRT2, FOXR1, FREM1, FRMPD1, GATA6, GATAD2A, GCM2, GDF10, GLI3, GMPPB, GNL3L, GON4L, GPR56, HCAR1, GRAP2, GRIP2, GSPT1, HCK, HIGD2A, HMGN2, HOXB5, HOXD1, HSD3B2, HSD3B7, HSDL2, HSPA14, HSPA9, HSPD1, HUWE1, IARS, IARS2, IBTK, IKBKAP, IL1RAP, IREB2, ITM2A, JAK1, KDM3B, KARS, KCMF1, KCNH7, KCTD12, KDELC1, KIAA0101, RGP1, KIAA0509, ISY1, TNRC18, KIF2C, KLHL25, KPRP, KRAS, KRT32, LCE5A, C14orf183, LOC255654, LOC283575, LOC284379, LOC285556, LRRC10, LRRC32, LSM5, MATN2, MCPH1, METAP2, MID1, MLF2, KMT2A, GSDMC, MNDA, MOB3A, WDR83, MPDZ, MRPL30, MRPL49, MRPS36P4, MTX2, MVP, MYLIP, NADK, NAGS, NAP1L6, NAA15, NAV3, NBR2, NCAPD2, NCL, NDUFA9, NEK1, NF1, NMNAT1, NOL3, NOP56, NOL8, NOP10, NPM1P13, NQO2, NR5A1, NUP205, NUP93, NXF1, OIP5, OR2H2, OR4K1, OSBPL9, PARP12, PHF7, PHKBP2, PIN1, PINK1, PIP4K2A, PLA2G2A, PLK1, POLA1, POLM, POLR3B, POLR3F, PON2, PPP1R8, PROM1, PSEN1, PSKH2, PSMA5, PSMB5, PSMB6, PSMD12, PTPN1, QARS, RCHY1, RELN, RFX4, RHBDL2, RIMS1, RLF, RNF40, RPA2, RQCD1, RRP9, RRS1, RSBN1, RTN2, SAE1, SDCCAG8, SEC14L3, SERPINB5, SH2D3A, SH3PXD2B, SHFM1, SLC11A2, SLITRK2, SNAP23, SNRPN, SNW1, SNX2, SPAST, SPATA17, SPTBN5, SPTY2D1, STT3A, SUV39H2, SYPL2, SYTL2, TAS2R62P, TBCD, TEAD2, TGIF2, TIMM22, TK2, TMED10, TMEM177, NDC1, VMP1, TOMM20, TPP2, TRIM3, TRIM36, TRIM39, TRIM44, TSPAN15, TSSK1B, TTC21B, TUBGCP4, TWIST1, UBAC2, UBA1, UBE2D1, UBE2I, UBE2M, UBE2R2, UBE3B, UBTF, UQCR10, UHRF2, USP30, USP6, USP9Y, VNN1, VPRBP, WDR36, WDR37, DCAF13, WFDC12, WWC1, XPO1, ZBTB5, ZC3H10, ZC3H13, ZC3H15, ZC3H18, ZC3HAV1L, ZGPAT, ZMAT1, ZNF260, ZNF584, BCAS3, CCL5, IL24, OSGIN1, THRSP, MOCS2, COX3, CYTB, QDPR, TNFSF13, UQCRC1, FRAT1, ZMYND8, LIMA1, PML, ABCD3, RPS29, SORBS3, TXNL4A, GOLIM4, MED4, NUP107, TTC31, COPS7B, FAM83D, C1orf131, LSM11, PTGR2, NCBP2-AS2, C14orf80, FAM129B, EGFR, SHC1, SOS1, GRB2, DUSP22, RIN1, BRAF, RCE1, ICMT, PREX1, ARL6IP5, LYPD4, NDUFA13, RHOASLC2A14SDHA, CDH1, SLC2A3, EPN1, HBB, HBA2, SMAP2, WDR73


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for KRAS_SLC2A14


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for KRAS_SLC2A14


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneKRASC0024121Lung Neoplasms31CTD_human
HgeneKRASC0699791Stomach Carcinoma9HPO;UNIPROT
HgeneKRASC0007131Non-Small Cell Lung Carcinoma6CTD_human
HgeneKRASC0009375Colonic Neoplasms6CTD_human
HgeneKRASC0030297Pancreatic Neoplasm6CTD_human;HPO
HgeneKRASC0027659Neoplasms, Experimental5CTD_human
HgeneKRASC0152013Adenocarcinoma of lung (disorder)5CTD_human
HgeneKRASC3809005CARDIOFACIOCUTANEOUS SYNDROME 25UNIPROT
HgeneKRASC0001430Adenoma4CTD_human
HgeneKRASC0018923Hemangiosarcoma4CTD_human
HgeneKRASC0028326Noonan Syndrome4CTD_human;ORPHANET
HgeneKRASC0001418Adenocarcinoma3CTD_human
HgeneKRASC0009404Colorectal Neoplasms3CTD_human
HgeneKRASC1860991NOONAN SYNDROME 33CTD_human;UNIPROT
HgeneKRASC0007137Squamous cell carcinoma2CTD_human
HgeneKRASC0023903Liver neoplasms2CTD_human
HgeneKRASC0038356Stomach Neoplasms2CTD_human
HgeneKRASC0206698Cholangiocarcinoma2CTD_human
HgeneKRASC0587248Costello syndrome (disorder)2CTD_human
HgeneKRASC2239176Liver carcinoma2CTD_human
HgeneKRASC0004114Astrocytoma1CTD_human
HgeneKRASC0007528Cecal Neoplasms1CTD_human
HgeneKRASC0007621Neoplastic Cell Transformation1CTD_human
HgeneKRASC0014175Endometriosis1CTD_human
HgeneKRASC0016978gallbladder neoplasm1CTD_human
HgeneKRASC0023897Liver Diseases, Parasitic1CTD_human
HgeneKRASC0023904Liver Neoplasms, Experimental1CTD_human
HgeneKRASC0024299Lymphoma1CTD_human
HgeneKRASC0026640Mouth Neoplasms1CTD_human
HgeneKRASC0027627Neoplasm Metastasis1CTD_human
HgeneKRASC0027819Neuroblastoma1CTD_human
HgeneKRASC0030849Penile Neoplasms1CTD_human
HgeneKRASC0040136Thyroid Neoplasm1CTD_human
HgeneKRASC0042138Uterine Neoplasms1CTD_human
HgeneKRASC0206682Follicular thyroid carcinoma1CTD_human
HgeneKRASC0349639Juvenile Myelomonocytic Leukemia1CTD_human;HPO;ORPHANET
HgeneKRASC0596263Carcinogenesis1CTD_human
HgeneKRASC0887833Carcinoma, Pancreatic Ductal1CTD_human
HgeneKRASC0919267ovarian neoplasm1CTD_human
HgeneKRASC1275081Cardio-facio-cutaneous syndrome1CTD_human;ORPHANET
HgeneKRASC2931822Nasopharyngeal carcinoma1CTD_human
HgeneKRASC3495559Juvenile arthritis1CTD_human
HgeneKRASC3854181Nevus sebaceous1CTD_human;HPO;ORPHANET