FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 19156

FusionGeneSummary for KNSTRN_BUB1B

check button Fusion gene summary
Fusion gene informationFusion gene name: KNSTRN_BUB1B
Fusion gene ID: 19156
HgeneTgene
Gene symbol

KNSTRN

BUB1B

Gene ID

90417

701

Gene namekinetochore localized astrin (SPAG5) binding proteinBUB1 mitotic checkpoint serine/threonine kinase B
SynonymsC15orf23|HSD11|SKAP|TRAF4AF1BUB1beta|BUBR1|Bub1A|MAD3L|MVA1|SSK1|hBUBR1
Cytomap

15q15.1

15q15.1

Type of geneprotein-codingprotein-coding
Descriptionsmall kinetochore-associated proteinTRAF4 associated factor 1kinastrinkinetochore-localized astrin-binding proteinputative TRAF4-associated factor 1small kinetochore associated proteinsmall kinetochore-associated protein, kinetochore-localized astrimitotic checkpoint serine/threonine-protein kinase BUB1 betaBUB1B, mitotic checkpoint serine/threonine kinaseMAD3/BUB1-related protein kinasebudding uninhibited by benzimidazoles 1 homolog betamitotic checkpoint kinase MAD3L
Modification date2018051920180523
UniProtAcc

Q9Y448

O60566

Ensembl transtripts involved in fusion geneENST00000416151, ENST00000249776, 
ENST00000448395, ENST00000608100, 
ENST00000287598, ENST00000412359, 
ENST00000560120, 
Fusion gene scores* DoF score1 X 1 X 1=15 X 4 X 4=80
# samples 14
** MAII scorelog2(1/1*10)=3.32192809488736log2(4/80*10)=-1
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: KNSTRN [Title/Abstract] AND BUB1B [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationKinase involved fusion gene, inframe and retained kinase domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDOVTCGA-25-1323-01AKNSTRNchr15

40684224

+BUB1Bchr15

40498385

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000416151ENST00000287598KNSTRNchr15

40684224

+BUB1Bchr15

40498385

+
In-frameENST00000416151ENST00000412359KNSTRNchr15

40684224

+BUB1Bchr15

40498385

+
5CDS-intronENST00000416151ENST00000560120KNSTRNchr15

40684224

+BUB1Bchr15

40498385

+
In-frameENST00000249776ENST00000287598KNSTRNchr15

40684224

+BUB1Bchr15

40498385

+
In-frameENST00000249776ENST00000412359KNSTRNchr15

40684224

+BUB1Bchr15

40498385

+
5CDS-intronENST00000249776ENST00000560120KNSTRNchr15

40684224

+BUB1Bchr15

40498385

+
3UTR-3CDSENST00000448395ENST00000287598KNSTRNchr15

40684224

+BUB1Bchr15

40498385

+
3UTR-3CDSENST00000448395ENST00000412359KNSTRNchr15

40684224

+BUB1Bchr15

40498385

+
3UTR-intronENST00000448395ENST00000560120KNSTRNchr15

40684224

+BUB1Bchr15

40498385

+
In-frameENST00000608100ENST00000287598KNSTRNchr15

40684224

+BUB1Bchr15

40498385

+
In-frameENST00000608100ENST00000412359KNSTRNchr15

40684224

+BUB1Bchr15

40498385

+
5CDS-intronENST00000608100ENST00000560120KNSTRNchr15

40684224

+BUB1Bchr15

40498385

+

Top

FusionProtFeatures for KNSTRN_BUB1B


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
KNSTRN

Q9Y448

BUB1B

O60566

Essential component of the mitotic spindle required forfaithful chromosome segregation and progression into anaphase(PubMed:19667759). Promotes the metaphase-to-anaphase transitionand is required for chromosome alignment, normal timing of sisterchromatid segregation, and maintenance of spindle polearchitecture (PubMed:19667759, PubMed:22110139). The astrin(SPAG5)-kinastrin (SKAP) complex promotes stable microtubule-kinetochore attachments (PubMed:21402792). Required forkinetochore oscillations and dynamics of microtubule plus-endsduring live cell mitosis, possibly by forming a link betweenspindle microtubule plus-ends and mitotic chromosomes to achievefaithful cell division (PubMed:23035123). May be involved in UV-induced apoptosis via its interaction with PRPF19; however, theseresults need additional evidences (PubMed:24718257).{ECO:0000269|PubMed:19667759, ECO:0000269|PubMed:21402792,ECO:0000269|PubMed:22110139, ECO:0000269|PubMed:23035123,ECO:0000305|PubMed:24718257}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneKNSTRNchr15:40684224chr15:40498385ENST00000249776+89166_216274317Coiled coilOntology_term=ECO:0000255
HgeneKNSTRNchr15:40684224chr15:40498385ENST00000416151+89166_216274287Coiled coilOntology_term=ECO:0000255
HgeneKNSTRNchr15:40684224chr15:40498385ENST00000448395+78166_216253407Coiled coilOntology_term=ECO:0000255
TgeneBUB1Bchr15:40684224chr15:40498385ENST00000287598+1323766_10505781051DomainNote=Protein kinase
TgeneBUB1Bchr15:40684224chr15:40498385ENST00000412359+1323766_10505921065DomainNote=Protein kinase
TgeneBUB1Bchr15:40684224chr15:40498385ENST00000287598+1323772_7805781051Nucleotide bindingATP
TgeneBUB1Bchr15:40684224chr15:40498385ENST00000412359+1323772_7805921065Nucleotide bindingATP

- In-frame and not-retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneKNSTRNchr15:40684224chr15:40498385ENST00000249776+89248_316274317Coiled coilOntology_term=ECO:0000255
HgeneKNSTRNchr15:40684224chr15:40498385ENST00000416151+89248_316274287Coiled coilOntology_term=ECO:0000255
HgeneKNSTRNchr15:40684224chr15:40498385ENST00000448395+78248_316253407Coiled coilOntology_term=ECO:0000255
TgeneBUB1Bchr15:40684224chr15:40498385ENST00000287598+1323209_2155781051Compositional biasNote=Poly-Glu
TgeneBUB1Bchr15:40684224chr15:40498385ENST00000412359+1323209_2155921065Compositional biasNote=Poly-Glu
TgeneBUB1Bchr15:40684224chr15:40498385ENST00000287598+132362_2265781051DomainBUB1 N-terminal
TgeneBUB1Bchr15:40684224chr15:40498385ENST00000412359+132362_2265921065DomainBUB1 N-terminal
TgeneBUB1Bchr15:40684224chr15:40498385ENST00000287598+1323111_1185781051MotifNuclear localization signal
TgeneBUB1Bchr15:40684224chr15:40498385ENST00000287598+1323224_2325781051MotifNote=D-box
TgeneBUB1Bchr15:40684224chr15:40498385ENST00000412359+1323111_1185921065MotifNuclear localization signal
TgeneBUB1Bchr15:40684224chr15:40498385ENST00000412359+1323224_2325921065MotifNote=D-box


Top

FusionGeneSequence for KNSTRN_BUB1B


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_KNSTRN_ENST00000416151_chr15_40684224_+_BUB1B_ENST00000287598_chr15_40498385_+_747aa
MAAPEAPPLDRVFRTTWLSTECDSHPLPPSYRKFLFETQAADLAGGTTVAAGNLLNESEKDCGQDRRAPGVQPCRLVTMTSVVKTVTSLQ
PPSALSGGQPADTQTRATSKSLLPVRSKEVDVSKQLHSGGPENDVTKITKLRRENGQMKATDTATRRNVRKGYKPLSKQKSEEELKDKNQ
LLEAVNKQLHQKLTETQGELKDLTQKVELLEKFRDNCLAILESKGLDPALGSETLASRQESTTDHMDSMLLLETLQEELKLFNETAKKQM
EELQDEFTGIEPLSEDAIITGFRNVTICPNPEDTCDFARAARFVSTPFHEIMSLKDLPSDPERLLPEEDLDVKTSEDQQTACGTIYSQTL
SIKKLSPIIEDSREATHSSGFSGSSASVASTSSIKCLQIPEKLELTNETSENPTQSPWCSQTRRQLLKSLPELSASAELCIEDRPMPKLE
IEKEIELGNEDYCIKREYLICEDYKLFWVAPRNSAELTVIKVSSQPVPWDFTINLKLKERLNEDFDHFCSCTQTQDGCIVWHQTINCFTL
QDLLQHSETITHEITVLIITNLLTIVEMLHKAEIVHGDLSPRCLILRNRIHDPTDCNKNNQALKIVDFSYSVDLRVQLDVFTLSGFRTVQ
ILEGQKILANCSSPYQVDLFGIADLAHLLLFKEHLQVFWDGSFWKLSQNISELKDGELWNKFFVRILNANDEATVSVLGELAAEMNGVFD

>In-frame_KNSTRN_ENST00000416151_chr15_40684224_+_BUB1B_ENST00000412359_chr15_40498385_+_747aa
MAAPEAPPLDRVFRTTWLSTECDSHPLPPSYRKFLFETQAADLAGGTTVAAGNLLNESEKDCGQDRRAPGVQPCRLVTMTSVVKTVTSLQ
PPSALSGGQPADTQTRATSKSLLPVRSKEVDVSKQLHSGGPENDVTKITKLRRENGQMKATDTATRRNVRKGYKPLSKQKSEEELKDKNQ
LLEAVNKQLHQKLTETQGELKDLTQKVELLEKFRDNCLAILESKGLDPALGSETLASRQESTTDHMDSMLLLETLQEELKLFNETAKKQM
EELQDEFTGIEPLSEDAIITGFRNVTICPNPEDTCDFARAARFVSTPFHEIMSLKDLPSDPERLLPEEDLDVKTSEDQQTACGTIYSQTL
SIKKLSPIIEDSREATHSSGFSGSSASVASTSSIKCLQIPEKLELTNETSENPTQSPWCSQTRRQLLKSLPELSASAELCIEDRPMPKLE
IEKEIELGNEDYCIKREYLICEDYKLFWVAPRNSAELTVIKVSSQPVPWDFTINLKLKERLNEDFDHFCSCTQTQDGCIVWHQTINCFTL
QDLLQHSETITHEITVLIITNLLTIVEMLHKAEIVHGDLSPRCLILRNRIHDPTDCNKNNQALKIVDFSYSVDLRVQLDVFTLSGFRTVQ
ILEGQKILANCSSPYQVDLFGIADLAHLLLFKEHLQVFWDGSFWKLSQNISELKDGELWNKFFVRILNANDEATVSVLGELAAEMNGVFD

>In-frame_KNSTRN_ENST00000249776_chr15_40684224_+_BUB1B_ENST00000287598_chr15_40498385_+_747aa
MAAPEAPPLDRVFRTTWLSTECDSHPLPPSYRKFLFETQAADLAGGTTVAAGNLLNESEKDCGQDRRAPGVQPCRLVTMTSVVKTVTSLQ
PPSALSGGQPADTQTRATSKSLLPVRSKEVDVSKQLHSGGPENDVTKITKLRRENGQMKATDTATRRNVRKGYKPLSKQKSEEELKDKNQ
LLEAVNKQLHQKLTETQGELKDLTQKVELLEKFRDNCLAILESKGLDPALGSETLASRQESTTDHMDSMLLLETLQEELKLFNETAKKQM
EELQDEFTGIEPLSEDAIITGFRNVTICPNPEDTCDFARAARFVSTPFHEIMSLKDLPSDPERLLPEEDLDVKTSEDQQTACGTIYSQTL
SIKKLSPIIEDSREATHSSGFSGSSASVASTSSIKCLQIPEKLELTNETSENPTQSPWCSQTRRQLLKSLPELSASAELCIEDRPMPKLE
IEKEIELGNEDYCIKREYLICEDYKLFWVAPRNSAELTVIKVSSQPVPWDFTINLKLKERLNEDFDHFCSCTQTQDGCIVWHQTINCFTL
QDLLQHSETITHEITVLIITNLLTIVEMLHKAEIVHGDLSPRCLILRNRIHDPTDCNKNNQALKIVDFSYSVDLRVQLDVFTLSGFRTVQ
ILEGQKILANCSSPYQVDLFGIADLAHLLLFKEHLQVFWDGSFWKLSQNISELKDGELWNKFFVRILNANDEATVSVLGELAAEMNGVFD

>In-frame_KNSTRN_ENST00000249776_chr15_40684224_+_BUB1B_ENST00000412359_chr15_40498385_+_747aa
MAAPEAPPLDRVFRTTWLSTECDSHPLPPSYRKFLFETQAADLAGGTTVAAGNLLNESEKDCGQDRRAPGVQPCRLVTMTSVVKTVTSLQ
PPSALSGGQPADTQTRATSKSLLPVRSKEVDVSKQLHSGGPENDVTKITKLRRENGQMKATDTATRRNVRKGYKPLSKQKSEEELKDKNQ
LLEAVNKQLHQKLTETQGELKDLTQKVELLEKFRDNCLAILESKGLDPALGSETLASRQESTTDHMDSMLLLETLQEELKLFNETAKKQM
EELQDEFTGIEPLSEDAIITGFRNVTICPNPEDTCDFARAARFVSTPFHEIMSLKDLPSDPERLLPEEDLDVKTSEDQQTACGTIYSQTL
SIKKLSPIIEDSREATHSSGFSGSSASVASTSSIKCLQIPEKLELTNETSENPTQSPWCSQTRRQLLKSLPELSASAELCIEDRPMPKLE
IEKEIELGNEDYCIKREYLICEDYKLFWVAPRNSAELTVIKVSSQPVPWDFTINLKLKERLNEDFDHFCSCTQTQDGCIVWHQTINCFTL
QDLLQHSETITHEITVLIITNLLTIVEMLHKAEIVHGDLSPRCLILRNRIHDPTDCNKNNQALKIVDFSYSVDLRVQLDVFTLSGFRTVQ
ILEGQKILANCSSPYQVDLFGIADLAHLLLFKEHLQVFWDGSFWKLSQNISELKDGELWNKFFVRILNANDEATVSVLGELAAEMNGVFD

>In-frame_KNSTRN_ENST00000608100_chr15_40684224_+_BUB1B_ENST00000287598_chr15_40498385_+_669aa
MTSVVKTVTSLQPPSALSGGQPADTQTRATSKSLLPVRSKEVDVSKQLHSGGPENDVTKITKLRRENGQMKATDTATRRNVRKGYKPLSK
QKSEEELKDKNQLLEAVNKQLHQKLTETQGELKDLTQKVELLEKFRDNCLAILESKGLDPALGSETLASRQESTTDHMDSMLLLETLQEE
LKLFNETAKKQMEELQDEFTGIEPLSEDAIITGFRNVTICPNPEDTCDFARAARFVSTPFHEIMSLKDLPSDPERLLPEEDLDVKTSEDQ
QTACGTIYSQTLSIKKLSPIIEDSREATHSSGFSGSSASVASTSSIKCLQIPEKLELTNETSENPTQSPWCSQTRRQLLKSLPELSASAE
LCIEDRPMPKLEIEKEIELGNEDYCIKREYLICEDYKLFWVAPRNSAELTVIKVSSQPVPWDFTINLKLKERLNEDFDHFCSCTQTQDGC
IVWHQTINCFTLQDLLQHSETITHEITVLIITNLLTIVEMLHKAEIVHGDLSPRCLILRNRIHDPTDCNKNNQALKIVDFSYSVDLRVQL
DVFTLSGFRTVQILEGQKILANCSSPYQVDLFGIADLAHLLLFKEHLQVFWDGSFWKLSQNISELKDGELWNKFFVRILNANDEATVSVL

>In-frame_KNSTRN_ENST00000608100_chr15_40684224_+_BUB1B_ENST00000412359_chr15_40498385_+_669aa
MTSVVKTVTSLQPPSALSGGQPADTQTRATSKSLLPVRSKEVDVSKQLHSGGPENDVTKITKLRRENGQMKATDTATRRNVRKGYKPLSK
QKSEEELKDKNQLLEAVNKQLHQKLTETQGELKDLTQKVELLEKFRDNCLAILESKGLDPALGSETLASRQESTTDHMDSMLLLETLQEE
LKLFNETAKKQMEELQDEFTGIEPLSEDAIITGFRNVTICPNPEDTCDFARAARFVSTPFHEIMSLKDLPSDPERLLPEEDLDVKTSEDQ
QTACGTIYSQTLSIKKLSPIIEDSREATHSSGFSGSSASVASTSSIKCLQIPEKLELTNETSENPTQSPWCSQTRRQLLKSLPELSASAE
LCIEDRPMPKLEIEKEIELGNEDYCIKREYLICEDYKLFWVAPRNSAELTVIKVSSQPVPWDFTINLKLKERLNEDFDHFCSCTQTQDGC
IVWHQTINCFTLQDLLQHSETITHEITVLIITNLLTIVEMLHKAEIVHGDLSPRCLILRNRIHDPTDCNKNNQALKIVDFSYSVDLRVQL
DVFTLSGFRTVQILEGQKILANCSSPYQVDLFGIADLAHLLLFKEHLQVFWDGSFWKLSQNISELKDGELWNKFFVRILNANDEATVSVL


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_KNSTRN_ENST00000416151_chr15_40684224_+_BUB1B_ENST00000287598_chr15_40498385_+_2241nt
ATGGCGGCTCCCGAAGCCCCGCCCCTGGACAGAGTTTTCCGTACAACATGGCTGTCTACAGAGTGCGATTCCCACCCACTTCCGCCTAGC
TACCGGAAGTTTCTATTTGAAACCCAGGCGGCCGACTTAGCCGGTGGCACGACAGTTGCTGCAGGGAATCTTTTAAACGAGAGCGAGAAG
GACTGCGGGCAGGACCGGCGGGCTCCTGGGGTTCAGCCGTGCCGCCTCGTTACGATGACCAGTGTGGTTAAGACAGTGTATAGCCTGCAG
CCCCCCTCTGCGCTGAGCGGCGGCCAGCCGGCAGACACACAAACTCGGGCCACTTCTAAGAGTCTCTTACCTGTTAGGTCCAAAGAAGTC
GATGTTTCCAAACAGCTTCATTCAGGAGGTCCAGAGAATGATGTTACAAAAATCACCAAACTGAGACGAGAGAATGGGCAAATGAAAGCT
ACTGACACTGCCACCAGAAGGAATGTCAGAAAAGGCTACAAACCACTGAGTAAGCAAAAATCAGAGGAAGAGCTCAAGGACAAGAACCAG
CTGTTAGAAGCCGTCAACAAGCAGTTGCACCAGAAGTTGACTGAAACTCAGGGAGAGCTGAAGGACCTGACCCAGAAGGTAGAGCTGCTG
GAGAAGTTTCGGGACAACTGTTTGGCAATTTTGGAGAGCAAGGGCCTTGATCCAGCTTTAGGCAGTGAGACCCTGGCATCACGACAAGAA
TCCACTACTGATCACATGGACTCTATGTTGCTGTTAGAAACTTTGCAAGAGGAGCTGAAGCTTTTTAACGAAACAGCCAAAAAGCAGATG
GAGGAGTTACAGGATGAATTTACAGGAATTGAACCCTTGAGCGAGGATGCCATTATCACAGGCTTCAGAAATGTAACAATTTGTCCTAAC
CCAGAAGACACTTGTGACTTTGCCAGAGCAGCTCGTTTTGTATCCACTCCTTTTCATGAGATAATGTCCTTGAAGGATCTCCCTTCTGAT
CCTGAGAGACTGTTACCGGAAGAAGATCTAGATGTAAAGACCTCTGAGGACCAGCAGACAGCTTGTGGCACTATCTACAGTCAGACTCTC
AGCATCAAGAAGCTGAGCCCAATTATTGAAGACAGTCGTGAAGCCACACACTCCTCTGGCTTCTCTGGTTCTTCTGCCTCGGTTGCAAGC
ACCTCCTCCATCAAATGTCTTCAAATTCCTGAGAAACTAGAACTTACTAATGAGACTTCAGAAAACCCTACTCAGTCACCATGGTGTTCA
CAGTATCGCAGACAGCTACTGAAGTCCCTACCAGAGTTAAGTGCCTCTGCAGAGTTGTGTATAGAAGACAGACCAATGCCTAAGTTGGAA
ATTGAGAAGGAAATTGAATTAGGTAATGAGGATTACTGCATTAAACGAGAATACCTAATATGTGAAGATTACAAGTTATTCTGGGTGGCG
CCAAGAAACTCTGCAGAATTAACAGTAATAAAGGTATCTTCTCAACCTGTCCCATGGGACTTTTATATCAACCTCAAGTTAAAGGAACGT
TTAAATGAAGATTTTGATCATTTTTGCAGCTGTTATCAATATCAAGATGGCTGTATTGTTTGGCACCAATATATAAACTGCTTCACCCTT
CAGGATCTTCTCCAACACAGTGAATATATTACCCATGAAATAACAGTGTTGATTATTTATAACCTTTTGACAATAGTGGAGATGCTACAC
AAAGCAGAAATAGTCCATGGTGACTTGAGTCCAAGGTGTCTGATTCTCAGAAACAGAATCCACGATCCCTATGATTGTAACAAGAACAAT
CAAGCTTTGAAGATAGTGGACTTTTCCTACAGTGTTGACCTTAGGGTGCAGCTGGATGTTTTTACCCTCAGCGGCTTTCGGACTGTACAG
ATCCTGGAAGGACAAAAGATCCTGGCTAACTGTTCTTCTCCCTACCAGGTAGACCTGTTTGGTATAGCAGATTTAGCACATTTACTATTG
TTCAAGGAACACCTACAGGTCTTCTGGGATGGGTCCTTCTGGAAACTTAGCCAAAATATTTCTGAGCTAAAAGATGGTGAATTGTGGAAT
AAATTCTTTGTGCGGATTCTGAATGCCAATGATGAGGCCACAGTGTCTGTTCTTGGGGAGCTTGCAGCAGAAATGAATGGGGTTTTTGAC

>In-frame_KNSTRN_ENST00000416151_chr15_40684224_+_BUB1B_ENST00000412359_chr15_40498385_+_2241nt
ATGGCGGCTCCCGAAGCCCCGCCCCTGGACAGAGTTTTCCGTACAACATGGCTGTCTACAGAGTGCGATTCCCACCCACTTCCGCCTAGC
TACCGGAAGTTTCTATTTGAAACCCAGGCGGCCGACTTAGCCGGTGGCACGACAGTTGCTGCAGGGAATCTTTTAAACGAGAGCGAGAAG
GACTGCGGGCAGGACCGGCGGGCTCCTGGGGTTCAGCCGTGCCGCCTCGTTACGATGACCAGTGTGGTTAAGACAGTGTATAGCCTGCAG
CCCCCCTCTGCGCTGAGCGGCGGCCAGCCGGCAGACACACAAACTCGGGCCACTTCTAAGAGTCTCTTACCTGTTAGGTCCAAAGAAGTC
GATGTTTCCAAACAGCTTCATTCAGGAGGTCCAGAGAATGATGTTACAAAAATCACCAAACTGAGACGAGAGAATGGGCAAATGAAAGCT
ACTGACACTGCCACCAGAAGGAATGTCAGAAAAGGCTACAAACCACTGAGTAAGCAAAAATCAGAGGAAGAGCTCAAGGACAAGAACCAG
CTGTTAGAAGCCGTCAACAAGCAGTTGCACCAGAAGTTGACTGAAACTCAGGGAGAGCTGAAGGACCTGACCCAGAAGGTAGAGCTGCTG
GAGAAGTTTCGGGACAACTGTTTGGCAATTTTGGAGAGCAAGGGCCTTGATCCAGCTTTAGGCAGTGAGACCCTGGCATCACGACAAGAA
TCCACTACTGATCACATGGACTCTATGTTGCTGTTAGAAACTTTGCAAGAGGAGCTGAAGCTTTTTAACGAAACAGCCAAAAAGCAGATG
GAGGAGTTACAGGATGAATTTACAGGAATTGAACCCTTGAGCGAGGATGCCATTATCACAGGCTTCAGAAATGTAACAATTTGTCCTAAC
CCAGAAGACACTTGTGACTTTGCCAGAGCAGCTCGTTTTGTATCCACTCCTTTTCATGAGATAATGTCCTTGAAGGATCTCCCTTCTGAT
CCTGAGAGACTGTTACCGGAAGAAGATCTAGATGTAAAGACCTCTGAGGACCAGCAGACAGCTTGTGGCACTATCTACAGTCAGACTCTC
AGCATCAAGAAGCTGAGCCCAATTATTGAAGACAGTCGTGAAGCCACACACTCCTCTGGCTTCTCTGGTTCTTCTGCCTCGGTTGCAAGC
ACCTCCTCCATCAAATGTCTTCAAATTCCTGAGAAACTAGAACTTACTAATGAGACTTCAGAAAACCCTACTCAGTCACCATGGTGTTCA
CAGTATCGCAGACAGCTACTGAAGTCCCTACCAGAGTTAAGTGCCTCTGCAGAGTTGTGTATAGAAGACAGACCAATGCCTAAGTTGGAA
ATTGAGAAGGAAATTGAATTAGGTAATGAGGATTACTGCATTAAACGAGAATACCTAATATGTGAAGATTACAAGTTATTCTGGGTGGCG
CCAAGAAACTCTGCAGAATTAACAGTAATAAAGGTATCTTCTCAACCTGTCCCATGGGACTTTTATATCAACCTCAAGTTAAAGGAACGT
TTAAATGAAGATTTTGATCATTTTTGCAGCTGTTATCAATATCAAGATGGCTGTATTGTTTGGCACCAATATATAAACTGCTTCACCCTT
CAGGATCTTCTCCAACACAGTGAATATATTACCCATGAAATAACAGTGTTGATTATTTATAACCTTTTGACAATAGTGGAGATGCTACAC
AAAGCAGAAATAGTCCATGGTGACTTGAGTCCAAGGTGTCTGATTCTCAGAAACAGAATCCACGATCCCTATGATTGTAACAAGAACAAT
CAAGCTTTGAAGATAGTGGACTTTTCCTACAGTGTTGACCTTAGGGTGCAGCTGGATGTTTTTACCCTCAGCGGCTTTCGGACTGTACAG
ATCCTGGAAGGACAAAAGATCCTGGCTAACTGTTCTTCTCCCTACCAGGTAGACCTGTTTGGTATAGCAGATTTAGCACATTTACTATTG
TTCAAGGAACACCTACAGGTCTTCTGGGATGGGTCCTTCTGGAAACTTAGCCAAAATATTTCTGAGCTAAAAGATGGTGAATTGTGGAAT
AAATTCTTTGTGCGGATTCTGAATGCCAATGATGAGGCCACAGTGTCTGTTCTTGGGGAGCTTGCAGCAGAAATGAATGGGGTTTTTGAC

>In-frame_KNSTRN_ENST00000249776_chr15_40684224_+_BUB1B_ENST00000287598_chr15_40498385_+_2241nt
ATGGCGGCTCCCGAAGCCCCGCCCCTGGACAGAGTTTTCCGTACAACATGGCTGTCTACAGAGTGCGATTCCCACCCACTTCCGCCTAGC
TACCGGAAGTTTCTATTTGAAACCCAGGCGGCCGACTTAGCCGGTGGCACGACAGTTGCTGCAGGGAATCTTTTAAACGAGAGCGAGAAG
GACTGCGGGCAGGACCGGCGGGCTCCTGGGGTTCAGCCGTGCCGCCTCGTTACGATGACCAGTGTGGTTAAGACAGTGTATAGCCTGCAG
CCCCCCTCTGCGCTGAGCGGCGGCCAGCCGGCAGACACACAAACTCGGGCCACTTCTAAGAGTCTCTTACCTGTTAGGTCCAAAGAAGTC
GATGTTTCCAAACAGCTTCATTCAGGAGGTCCAGAGAATGATGTTACAAAAATCACCAAACTGAGACGAGAGAATGGGCAAATGAAAGCT
ACTGACACTGCCACCAGAAGGAATGTCAGAAAAGGCTACAAACCACTGAGTAAGCAAAAATCAGAGGAAGAGCTCAAGGACAAGAACCAG
CTGTTAGAAGCCGTCAACAAGCAGTTGCACCAGAAGTTGACTGAAACTCAGGGAGAGCTGAAGGACCTGACCCAGAAGGTAGAGCTGCTG
GAGAAGTTTCGGGACAACTGTTTGGCAATTTTGGAGAGCAAGGGCCTTGATCCAGCTTTAGGCAGTGAGACCCTGGCATCACGACAAGAA
TCCACTACTGATCACATGGACTCTATGTTGCTGTTAGAAACTTTGCAAGAGGAGCTGAAGCTTTTTAACGAAACAGCCAAAAAGCAGATG
GAGGAGTTACAGGATGAATTTACAGGAATTGAACCCTTGAGCGAGGATGCCATTATCACAGGCTTCAGAAATGTAACAATTTGTCCTAAC
CCAGAAGACACTTGTGACTTTGCCAGAGCAGCTCGTTTTGTATCCACTCCTTTTCATGAGATAATGTCCTTGAAGGATCTCCCTTCTGAT
CCTGAGAGACTGTTACCGGAAGAAGATCTAGATGTAAAGACCTCTGAGGACCAGCAGACAGCTTGTGGCACTATCTACAGTCAGACTCTC
AGCATCAAGAAGCTGAGCCCAATTATTGAAGACAGTCGTGAAGCCACACACTCCTCTGGCTTCTCTGGTTCTTCTGCCTCGGTTGCAAGC
ACCTCCTCCATCAAATGTCTTCAAATTCCTGAGAAACTAGAACTTACTAATGAGACTTCAGAAAACCCTACTCAGTCACCATGGTGTTCA
CAGTATCGCAGACAGCTACTGAAGTCCCTACCAGAGTTAAGTGCCTCTGCAGAGTTGTGTATAGAAGACAGACCAATGCCTAAGTTGGAA
ATTGAGAAGGAAATTGAATTAGGTAATGAGGATTACTGCATTAAACGAGAATACCTAATATGTGAAGATTACAAGTTATTCTGGGTGGCG
CCAAGAAACTCTGCAGAATTAACAGTAATAAAGGTATCTTCTCAACCTGTCCCATGGGACTTTTATATCAACCTCAAGTTAAAGGAACGT
TTAAATGAAGATTTTGATCATTTTTGCAGCTGTTATCAATATCAAGATGGCTGTATTGTTTGGCACCAATATATAAACTGCTTCACCCTT
CAGGATCTTCTCCAACACAGTGAATATATTACCCATGAAATAACAGTGTTGATTATTTATAACCTTTTGACAATAGTGGAGATGCTACAC
AAAGCAGAAATAGTCCATGGTGACTTGAGTCCAAGGTGTCTGATTCTCAGAAACAGAATCCACGATCCCTATGATTGTAACAAGAACAAT
CAAGCTTTGAAGATAGTGGACTTTTCCTACAGTGTTGACCTTAGGGTGCAGCTGGATGTTTTTACCCTCAGCGGCTTTCGGACTGTACAG
ATCCTGGAAGGACAAAAGATCCTGGCTAACTGTTCTTCTCCCTACCAGGTAGACCTGTTTGGTATAGCAGATTTAGCACATTTACTATTG
TTCAAGGAACACCTACAGGTCTTCTGGGATGGGTCCTTCTGGAAACTTAGCCAAAATATTTCTGAGCTAAAAGATGGTGAATTGTGGAAT
AAATTCTTTGTGCGGATTCTGAATGCCAATGATGAGGCCACAGTGTCTGTTCTTGGGGAGCTTGCAGCAGAAATGAATGGGGTTTTTGAC

>In-frame_KNSTRN_ENST00000249776_chr15_40684224_+_BUB1B_ENST00000412359_chr15_40498385_+_2241nt
ATGGCGGCTCCCGAAGCCCCGCCCCTGGACAGAGTTTTCCGTACAACATGGCTGTCTACAGAGTGCGATTCCCACCCACTTCCGCCTAGC
TACCGGAAGTTTCTATTTGAAACCCAGGCGGCCGACTTAGCCGGTGGCACGACAGTTGCTGCAGGGAATCTTTTAAACGAGAGCGAGAAG
GACTGCGGGCAGGACCGGCGGGCTCCTGGGGTTCAGCCGTGCCGCCTCGTTACGATGACCAGTGTGGTTAAGACAGTGTATAGCCTGCAG
CCCCCCTCTGCGCTGAGCGGCGGCCAGCCGGCAGACACACAAACTCGGGCCACTTCTAAGAGTCTCTTACCTGTTAGGTCCAAAGAAGTC
GATGTTTCCAAACAGCTTCATTCAGGAGGTCCAGAGAATGATGTTACAAAAATCACCAAACTGAGACGAGAGAATGGGCAAATGAAAGCT
ACTGACACTGCCACCAGAAGGAATGTCAGAAAAGGCTACAAACCACTGAGTAAGCAAAAATCAGAGGAAGAGCTCAAGGACAAGAACCAG
CTGTTAGAAGCCGTCAACAAGCAGTTGCACCAGAAGTTGACTGAAACTCAGGGAGAGCTGAAGGACCTGACCCAGAAGGTAGAGCTGCTG
GAGAAGTTTCGGGACAACTGTTTGGCAATTTTGGAGAGCAAGGGCCTTGATCCAGCTTTAGGCAGTGAGACCCTGGCATCACGACAAGAA
TCCACTACTGATCACATGGACTCTATGTTGCTGTTAGAAACTTTGCAAGAGGAGCTGAAGCTTTTTAACGAAACAGCCAAAAAGCAGATG
GAGGAGTTACAGGATGAATTTACAGGAATTGAACCCTTGAGCGAGGATGCCATTATCACAGGCTTCAGAAATGTAACAATTTGTCCTAAC
CCAGAAGACACTTGTGACTTTGCCAGAGCAGCTCGTTTTGTATCCACTCCTTTTCATGAGATAATGTCCTTGAAGGATCTCCCTTCTGAT
CCTGAGAGACTGTTACCGGAAGAAGATCTAGATGTAAAGACCTCTGAGGACCAGCAGACAGCTTGTGGCACTATCTACAGTCAGACTCTC
AGCATCAAGAAGCTGAGCCCAATTATTGAAGACAGTCGTGAAGCCACACACTCCTCTGGCTTCTCTGGTTCTTCTGCCTCGGTTGCAAGC
ACCTCCTCCATCAAATGTCTTCAAATTCCTGAGAAACTAGAACTTACTAATGAGACTTCAGAAAACCCTACTCAGTCACCATGGTGTTCA
CAGTATCGCAGACAGCTACTGAAGTCCCTACCAGAGTTAAGTGCCTCTGCAGAGTTGTGTATAGAAGACAGACCAATGCCTAAGTTGGAA
ATTGAGAAGGAAATTGAATTAGGTAATGAGGATTACTGCATTAAACGAGAATACCTAATATGTGAAGATTACAAGTTATTCTGGGTGGCG
CCAAGAAACTCTGCAGAATTAACAGTAATAAAGGTATCTTCTCAACCTGTCCCATGGGACTTTTATATCAACCTCAAGTTAAAGGAACGT
TTAAATGAAGATTTTGATCATTTTTGCAGCTGTTATCAATATCAAGATGGCTGTATTGTTTGGCACCAATATATAAACTGCTTCACCCTT
CAGGATCTTCTCCAACACAGTGAATATATTACCCATGAAATAACAGTGTTGATTATTTATAACCTTTTGACAATAGTGGAGATGCTACAC
AAAGCAGAAATAGTCCATGGTGACTTGAGTCCAAGGTGTCTGATTCTCAGAAACAGAATCCACGATCCCTATGATTGTAACAAGAACAAT
CAAGCTTTGAAGATAGTGGACTTTTCCTACAGTGTTGACCTTAGGGTGCAGCTGGATGTTTTTACCCTCAGCGGCTTTCGGACTGTACAG
ATCCTGGAAGGACAAAAGATCCTGGCTAACTGTTCTTCTCCCTACCAGGTAGACCTGTTTGGTATAGCAGATTTAGCACATTTACTATTG
TTCAAGGAACACCTACAGGTCTTCTGGGATGGGTCCTTCTGGAAACTTAGCCAAAATATTTCTGAGCTAAAAGATGGTGAATTGTGGAAT
AAATTCTTTGTGCGGATTCTGAATGCCAATGATGAGGCCACAGTGTCTGTTCTTGGGGAGCTTGCAGCAGAAATGAATGGGGTTTTTGAC

>In-frame_KNSTRN_ENST00000608100_chr15_40684224_+_BUB1B_ENST00000287598_chr15_40498385_+_2007nt
ATGACCAGTGTGGTTAAGACAGTGTATAGCCTGCAGCCCCCCTCTGCGCTGAGCGGCGGCCAGCCGGCAGACACACAAACTCGGGCCACT
TCTAAGAGTCTCTTACCTGTTAGGTCCAAAGAAGTCGATGTTTCCAAACAGCTTCATTCAGGAGGTCCAGAGAATGATGTTACAAAAATC
ACCAAACTGAGACGAGAGAATGGGCAAATGAAAGCTACTGACACTGCCACCAGAAGGAATGTCAGAAAAGGCTACAAACCACTGAGTAAG
CAAAAATCAGAGGAAGAGCTCAAGGACAAGAACCAGCTGTTAGAAGCCGTCAACAAGCAGTTGCACCAGAAGTTGACTGAAACTCAGGGA
GAGCTGAAGGACCTGACCCAGAAGGTAGAGCTGCTGGAGAAGTTTCGGGACAACTGTTTGGCAATTTTGGAGAGCAAGGGCCTTGATCCA
GCTTTAGGCAGTGAGACCCTGGCATCACGACAAGAATCCACTACTGATCACATGGACTCTATGTTGCTGTTAGAAACTTTGCAAGAGGAG
CTGAAGCTTTTTAACGAAACAGCCAAAAAGCAGATGGAGGAGTTACAGGATGAATTTACAGGAATTGAACCCTTGAGCGAGGATGCCATT
ATCACAGGCTTCAGAAATGTAACAATTTGTCCTAACCCAGAAGACACTTGTGACTTTGCCAGAGCAGCTCGTTTTGTATCCACTCCTTTT
CATGAGATAATGTCCTTGAAGGATCTCCCTTCTGATCCTGAGAGACTGTTACCGGAAGAAGATCTAGATGTAAAGACCTCTGAGGACCAG
CAGACAGCTTGTGGCACTATCTACAGTCAGACTCTCAGCATCAAGAAGCTGAGCCCAATTATTGAAGACAGTCGTGAAGCCACACACTCC
TCTGGCTTCTCTGGTTCTTCTGCCTCGGTTGCAAGCACCTCCTCCATCAAATGTCTTCAAATTCCTGAGAAACTAGAACTTACTAATGAG
ACTTCAGAAAACCCTACTCAGTCACCATGGTGTTCACAGTATCGCAGACAGCTACTGAAGTCCCTACCAGAGTTAAGTGCCTCTGCAGAG
TTGTGTATAGAAGACAGACCAATGCCTAAGTTGGAAATTGAGAAGGAAATTGAATTAGGTAATGAGGATTACTGCATTAAACGAGAATAC
CTAATATGTGAAGATTACAAGTTATTCTGGGTGGCGCCAAGAAACTCTGCAGAATTAACAGTAATAAAGGTATCTTCTCAACCTGTCCCA
TGGGACTTTTATATCAACCTCAAGTTAAAGGAACGTTTAAATGAAGATTTTGATCATTTTTGCAGCTGTTATCAATATCAAGATGGCTGT
ATTGTTTGGCACCAATATATAAACTGCTTCACCCTTCAGGATCTTCTCCAACACAGTGAATATATTACCCATGAAATAACAGTGTTGATT
ATTTATAACCTTTTGACAATAGTGGAGATGCTACACAAAGCAGAAATAGTCCATGGTGACTTGAGTCCAAGGTGTCTGATTCTCAGAAAC
AGAATCCACGATCCCTATGATTGTAACAAGAACAATCAAGCTTTGAAGATAGTGGACTTTTCCTACAGTGTTGACCTTAGGGTGCAGCTG
GATGTTTTTACCCTCAGCGGCTTTCGGACTGTACAGATCCTGGAAGGACAAAAGATCCTGGCTAACTGTTCTTCTCCCTACCAGGTAGAC
CTGTTTGGTATAGCAGATTTAGCACATTTACTATTGTTCAAGGAACACCTACAGGTCTTCTGGGATGGGTCCTTCTGGAAACTTAGCCAA
AATATTTCTGAGCTAAAAGATGGTGAATTGTGGAATAAATTCTTTGTGCGGATTCTGAATGCCAATGATGAGGCCACAGTGTCTGTTCTT
GGGGAGCTTGCAGCAGAAATGAATGGGGTTTTTGACACTACATTCCAAAGTCACCTGAACAAAGCCTTATGGAAGGTAGGGAAGTTAACT

>In-frame_KNSTRN_ENST00000608100_chr15_40684224_+_BUB1B_ENST00000412359_chr15_40498385_+_2007nt
ATGACCAGTGTGGTTAAGACAGTGTATAGCCTGCAGCCCCCCTCTGCGCTGAGCGGCGGCCAGCCGGCAGACACACAAACTCGGGCCACT
TCTAAGAGTCTCTTACCTGTTAGGTCCAAAGAAGTCGATGTTTCCAAACAGCTTCATTCAGGAGGTCCAGAGAATGATGTTACAAAAATC
ACCAAACTGAGACGAGAGAATGGGCAAATGAAAGCTACTGACACTGCCACCAGAAGGAATGTCAGAAAAGGCTACAAACCACTGAGTAAG
CAAAAATCAGAGGAAGAGCTCAAGGACAAGAACCAGCTGTTAGAAGCCGTCAACAAGCAGTTGCACCAGAAGTTGACTGAAACTCAGGGA
GAGCTGAAGGACCTGACCCAGAAGGTAGAGCTGCTGGAGAAGTTTCGGGACAACTGTTTGGCAATTTTGGAGAGCAAGGGCCTTGATCCA
GCTTTAGGCAGTGAGACCCTGGCATCACGACAAGAATCCACTACTGATCACATGGACTCTATGTTGCTGTTAGAAACTTTGCAAGAGGAG
CTGAAGCTTTTTAACGAAACAGCCAAAAAGCAGATGGAGGAGTTACAGGATGAATTTACAGGAATTGAACCCTTGAGCGAGGATGCCATT
ATCACAGGCTTCAGAAATGTAACAATTTGTCCTAACCCAGAAGACACTTGTGACTTTGCCAGAGCAGCTCGTTTTGTATCCACTCCTTTT
CATGAGATAATGTCCTTGAAGGATCTCCCTTCTGATCCTGAGAGACTGTTACCGGAAGAAGATCTAGATGTAAAGACCTCTGAGGACCAG
CAGACAGCTTGTGGCACTATCTACAGTCAGACTCTCAGCATCAAGAAGCTGAGCCCAATTATTGAAGACAGTCGTGAAGCCACACACTCC
TCTGGCTTCTCTGGTTCTTCTGCCTCGGTTGCAAGCACCTCCTCCATCAAATGTCTTCAAATTCCTGAGAAACTAGAACTTACTAATGAG
ACTTCAGAAAACCCTACTCAGTCACCATGGTGTTCACAGTATCGCAGACAGCTACTGAAGTCCCTACCAGAGTTAAGTGCCTCTGCAGAG
TTGTGTATAGAAGACAGACCAATGCCTAAGTTGGAAATTGAGAAGGAAATTGAATTAGGTAATGAGGATTACTGCATTAAACGAGAATAC
CTAATATGTGAAGATTACAAGTTATTCTGGGTGGCGCCAAGAAACTCTGCAGAATTAACAGTAATAAAGGTATCTTCTCAACCTGTCCCA
TGGGACTTTTATATCAACCTCAAGTTAAAGGAACGTTTAAATGAAGATTTTGATCATTTTTGCAGCTGTTATCAATATCAAGATGGCTGT
ATTGTTTGGCACCAATATATAAACTGCTTCACCCTTCAGGATCTTCTCCAACACAGTGAATATATTACCCATGAAATAACAGTGTTGATT
ATTTATAACCTTTTGACAATAGTGGAGATGCTACACAAAGCAGAAATAGTCCATGGTGACTTGAGTCCAAGGTGTCTGATTCTCAGAAAC
AGAATCCACGATCCCTATGATTGTAACAAGAACAATCAAGCTTTGAAGATAGTGGACTTTTCCTACAGTGTTGACCTTAGGGTGCAGCTG
GATGTTTTTACCCTCAGCGGCTTTCGGACTGTACAGATCCTGGAAGGACAAAAGATCCTGGCTAACTGTTCTTCTCCCTACCAGGTAGAC
CTGTTTGGTATAGCAGATTTAGCACATTTACTATTGTTCAAGGAACACCTACAGGTCTTCTGGGATGGGTCCTTCTGGAAACTTAGCCAA
AATATTTCTGAGCTAAAAGATGGTGAATTGTGGAATAAATTCTTTGTGCGGATTCTGAATGCCAATGATGAGGCCACAGTGTCTGTTCTT
GGGGAGCTTGCAGCAGAAATGAATGGGGTTTTTGACACTACATTCCAAAGTCACCTGAACAAAGCCTTATGGAAGGTAGGGAAGTTAACT


* Fusion transcript sequences (Full-length transcript).
>In-frame_KNSTRN_ENST00000416151_chr15_40684224_+_BUB1B_ENST00000287598_chr15_40498385_+_2733nt
ATTAGCTCCATTCAAGCCTACAAATTGCATCACCCTCCTCCTCTGCCCAGACCTGGGGGCTCCAACACCTTTCGCTAGGTCTGGCTCTGG
CCTCTGAGCGAACCTTCCGTACAGTATGGCGGCTCCCGAAGCCCCGCCCCTGGACAGAGTTTTCCGTACAACATGGCTGTCTACAGAGTG
CGATTCCCACCCACTTCCGCCTAGCTACCGGAAGTTTCTATTTGAAACCCAGGCGGCCGACTTAGCCGGTGGCACGACAGTTGCTGCAGG
GAATCTTTTAAACGAGAGCGAGAAGGACTGCGGGCAGGACCGGCGGGCTCCTGGGGTTCAGCCGTGCCGCCTCGTTACGATGACCAGTGT
GGTTAAGACAGTGTATAGCCTGCAGCCCCCCTCTGCGCTGAGCGGCGGCCAGCCGGCAGACACACAAACTCGGGCCACTTCTAAGAGTCT
CTTACCTGTTAGGTCCAAAGAAGTCGATGTTTCCAAACAGCTTCATTCAGGAGGTCCAGAGAATGATGTTACAAAAATCACCAAACTGAG
ACGAGAGAATGGGCAAATGAAAGCTACTGACACTGCCACCAGAAGGAATGTCAGAAAAGGCTACAAACCACTGAGTAAGCAAAAATCAGA
GGAAGAGCTCAAGGACAAGAACCAGCTGTTAGAAGCCGTCAACAAGCAGTTGCACCAGAAGTTGACTGAAACTCAGGGAGAGCTGAAGGA
CCTGACCCAGAAGGTAGAGCTGCTGGAGAAGTTTCGGGACAACTGTTTGGCAATTTTGGAGAGCAAGGGCCTTGATCCAGCTTTAGGCAG
TGAGACCCTGGCATCACGACAAGAATCCACTACTGATCACATGGACTCTATGTTGCTGTTAGAAACTTTGCAAGAGGAGCTGAAGCTTTT
TAACGAAACAGCCAAAAAGCAGATGGAGGAGTTACAGGATGAATTTACAGGAATTGAACCCTTGAGCGAGGATGCCATTATCACAGGCTT
CAGAAATGTAACAATTTGTCCTAACCCAGAAGACACTTGTGACTTTGCCAGAGCAGCTCGTTTTGTATCCACTCCTTTTCATGAGATAAT
GTCCTTGAAGGATCTCCCTTCTGATCCTGAGAGACTGTTACCGGAAGAAGATCTAGATGTAAAGACCTCTGAGGACCAGCAGACAGCTTG
TGGCACTATCTACAGTCAGACTCTCAGCATCAAGAAGCTGAGCCCAATTATTGAAGACAGTCGTGAAGCCACACACTCCTCTGGCTTCTC
TGGTTCTTCTGCCTCGGTTGCAAGCACCTCCTCCATCAAATGTCTTCAAATTCCTGAGAAACTAGAACTTACTAATGAGACTTCAGAAAA
CCCTACTCAGTCACCATGGTGTTCACAGTATCGCAGACAGCTACTGAAGTCCCTACCAGAGTTAAGTGCCTCTGCAGAGTTGTGTATAGA
AGACAGACCAATGCCTAAGTTGGAAATTGAGAAGGAAATTGAATTAGGTAATGAGGATTACTGCATTAAACGAGAATACCTAATATGTGA
AGATTACAAGTTATTCTGGGTGGCGCCAAGAAACTCTGCAGAATTAACAGTAATAAAGGTATCTTCTCAACCTGTCCCATGGGACTTTTA
TATCAACCTCAAGTTAAAGGAACGTTTAAATGAAGATTTTGATCATTTTTGCAGCTGTTATCAATATCAAGATGGCTGTATTGTTTGGCA
CCAATATATAAACTGCTTCACCCTTCAGGATCTTCTCCAACACAGTGAATATATTACCCATGAAATAACAGTGTTGATTATTTATAACCT
TTTGACAATAGTGGAGATGCTACACAAAGCAGAAATAGTCCATGGTGACTTGAGTCCAAGGTGTCTGATTCTCAGAAACAGAATCCACGA
TCCCTATGATTGTAACAAGAACAATCAAGCTTTGAAGATAGTGGACTTTTCCTACAGTGTTGACCTTAGGGTGCAGCTGGATGTTTTTAC
CCTCAGCGGCTTTCGGACTGTACAGATCCTGGAAGGACAAAAGATCCTGGCTAACTGTTCTTCTCCCTACCAGGTAGACCTGTTTGGTAT
AGCAGATTTAGCACATTTACTATTGTTCAAGGAACACCTACAGGTCTTCTGGGATGGGTCCTTCTGGAAACTTAGCCAAAATATTTCTGA
GCTAAAAGATGGTGAATTGTGGAATAAATTCTTTGTGCGGATTCTGAATGCCAATGATGAGGCCACAGTGTCTGTTCTTGGGGAGCTTGC
AGCAGAAATGAATGGGGTTTTTGACACTACATTCCAAAGTCACCTGAACAAAGCCTTATGGAAGGTAGGGAAGTTAACTAGTCCTGGGGC
TTTGCTCTTTCAGTGAGCTAGGCAATCAAGTCTCACAGATTGCTGCCTCAGAGCAATGGTTGTATTGTGGAACACTGAAACTGTATGTGC
TGTAATTTAATTTAGGACACATTTAGATGCACTACCATTGCTGTTCTACTTTTTGGTACAGGTATATTTTGACGTCACTGATATTTTTTA
TACAGTGATATACTTACTCATGGCCTTGTCTAACTTTTGTGAAGAACTATTTTATTCTAAACAGACTCATTACAAATGGTTACCTTGTTA
TTTAACCCATTTGTCTCTACTTTTCCCTGTACTTTTCCCATTTGTAATTTGTAAAATGTTCTCTTATGATCACCATGTATTTTGTAAATA

>In-frame_KNSTRN_ENST00000416151_chr15_40684224_+_BUB1B_ENST00000412359_chr15_40498385_+_2635nt
ATTAGCTCCATTCAAGCCTACAAATTGCATCACCCTCCTCCTCTGCCCAGACCTGGGGGCTCCAACACCTTTCGCTAGGTCTGGCTCTGG
CCTCTGAGCGAACCTTCCGTACAGTATGGCGGCTCCCGAAGCCCCGCCCCTGGACAGAGTTTTCCGTACAACATGGCTGTCTACAGAGTG
CGATTCCCACCCACTTCCGCCTAGCTACCGGAAGTTTCTATTTGAAACCCAGGCGGCCGACTTAGCCGGTGGCACGACAGTTGCTGCAGG
GAATCTTTTAAACGAGAGCGAGAAGGACTGCGGGCAGGACCGGCGGGCTCCTGGGGTTCAGCCGTGCCGCCTCGTTACGATGACCAGTGT
GGTTAAGACAGTGTATAGCCTGCAGCCCCCCTCTGCGCTGAGCGGCGGCCAGCCGGCAGACACACAAACTCGGGCCACTTCTAAGAGTCT
CTTACCTGTTAGGTCCAAAGAAGTCGATGTTTCCAAACAGCTTCATTCAGGAGGTCCAGAGAATGATGTTACAAAAATCACCAAACTGAG
ACGAGAGAATGGGCAAATGAAAGCTACTGACACTGCCACCAGAAGGAATGTCAGAAAAGGCTACAAACCACTGAGTAAGCAAAAATCAGA
GGAAGAGCTCAAGGACAAGAACCAGCTGTTAGAAGCCGTCAACAAGCAGTTGCACCAGAAGTTGACTGAAACTCAGGGAGAGCTGAAGGA
CCTGACCCAGAAGGTAGAGCTGCTGGAGAAGTTTCGGGACAACTGTTTGGCAATTTTGGAGAGCAAGGGCCTTGATCCAGCTTTAGGCAG
TGAGACCCTGGCATCACGACAAGAATCCACTACTGATCACATGGACTCTATGTTGCTGTTAGAAACTTTGCAAGAGGAGCTGAAGCTTTT
TAACGAAACAGCCAAAAAGCAGATGGAGGAGTTACAGGATGAATTTACAGGAATTGAACCCTTGAGCGAGGATGCCATTATCACAGGCTT
CAGAAATGTAACAATTTGTCCTAACCCAGAAGACACTTGTGACTTTGCCAGAGCAGCTCGTTTTGTATCCACTCCTTTTCATGAGATAAT
GTCCTTGAAGGATCTCCCTTCTGATCCTGAGAGACTGTTACCGGAAGAAGATCTAGATGTAAAGACCTCTGAGGACCAGCAGACAGCTTG
TGGCACTATCTACAGTCAGACTCTCAGCATCAAGAAGCTGAGCCCAATTATTGAAGACAGTCGTGAAGCCACACACTCCTCTGGCTTCTC
TGGTTCTTCTGCCTCGGTTGCAAGCACCTCCTCCATCAAATGTCTTCAAATTCCTGAGAAACTAGAACTTACTAATGAGACTTCAGAAAA
CCCTACTCAGTCACCATGGTGTTCACAGTATCGCAGACAGCTACTGAAGTCCCTACCAGAGTTAAGTGCCTCTGCAGAGTTGTGTATAGA
AGACAGACCAATGCCTAAGTTGGAAATTGAGAAGGAAATTGAATTAGGTAATGAGGATTACTGCATTAAACGAGAATACCTAATATGTGA
AGATTACAAGTTATTCTGGGTGGCGCCAAGAAACTCTGCAGAATTAACAGTAATAAAGGTATCTTCTCAACCTGTCCCATGGGACTTTTA
TATCAACCTCAAGTTAAAGGAACGTTTAAATGAAGATTTTGATCATTTTTGCAGCTGTTATCAATATCAAGATGGCTGTATTGTTTGGCA
CCAATATATAAACTGCTTCACCCTTCAGGATCTTCTCCAACACAGTGAATATATTACCCATGAAATAACAGTGTTGATTATTTATAACCT
TTTGACAATAGTGGAGATGCTACACAAAGCAGAAATAGTCCATGGTGACTTGAGTCCAAGGTGTCTGATTCTCAGAAACAGAATCCACGA
TCCCTATGATTGTAACAAGAACAATCAAGCTTTGAAGATAGTGGACTTTTCCTACAGTGTTGACCTTAGGGTGCAGCTGGATGTTTTTAC
CCTCAGCGGCTTTCGGACTGTACAGATCCTGGAAGGACAAAAGATCCTGGCTAACTGTTCTTCTCCCTACCAGGTAGACCTGTTTGGTAT
AGCAGATTTAGCACATTTACTATTGTTCAAGGAACACCTACAGGTCTTCTGGGATGGGTCCTTCTGGAAACTTAGCCAAAATATTTCTGA
GCTAAAAGATGGTGAATTGTGGAATAAATTCTTTGTGCGGATTCTGAATGCCAATGATGAGGCCACAGTGTCTGTTCTTGGGGAGCTTGC
AGCAGAAATGAATGGGGTTTTTGACACTACATTCCAAAGTCACCTGAACAAAGCCTTATGGAAGGTAGGGAAGTTAACTAGTCCTGGGGC
TTTGCTCTTTCAGTGAGCTAGGCAATCAAGTCTCACAGATTGCTGCCTCAGAGCAATGGTTGTATTGTGGAACACTGAAACTGTATGTGC
TGTAATTTAATTTAGGACACATTTAGATGCACTACCATTGCTGTTCTACTTTTTGGTACAGGTATATTTTGACGTCACTGATATTTTTTA
TACAGTGATATACTTACTCATGGCCTTGTCTAACTTTTGTGAAGAACTATTTTATTCTAAACAGACTCATTACAAATGGTTACCTTGTTA

>In-frame_KNSTRN_ENST00000249776_chr15_40684224_+_BUB1B_ENST00000287598_chr15_40498385_+_2733nt
ATTAGCTCCATTCAAGCCTACAAATTGCATCACCCTCCTCCTCTGCCCAGACCTGGGGGCTCCAACACCTTTCGCTAGGTCTGGCTCTGG
CCTCTGAGCGAACCTTCCGTACAGTATGGCGGCTCCCGAAGCCCCGCCCCTGGACAGAGTTTTCCGTACAACATGGCTGTCTACAGAGTG
CGATTCCCACCCACTTCCGCCTAGCTACCGGAAGTTTCTATTTGAAACCCAGGCGGCCGACTTAGCCGGTGGCACGACAGTTGCTGCAGG
GAATCTTTTAAACGAGAGCGAGAAGGACTGCGGGCAGGACCGGCGGGCTCCTGGGGTTCAGCCGTGCCGCCTCGTTACGATGACCAGTGT
GGTTAAGACAGTGTATAGCCTGCAGCCCCCCTCTGCGCTGAGCGGCGGCCAGCCGGCAGACACACAAACTCGGGCCACTTCTAAGAGTCT
CTTACCTGTTAGGTCCAAAGAAGTCGATGTTTCCAAACAGCTTCATTCAGGAGGTCCAGAGAATGATGTTACAAAAATCACCAAACTGAG
ACGAGAGAATGGGCAAATGAAAGCTACTGACACTGCCACCAGAAGGAATGTCAGAAAAGGCTACAAACCACTGAGTAAGCAAAAATCAGA
GGAAGAGCTCAAGGACAAGAACCAGCTGTTAGAAGCCGTCAACAAGCAGTTGCACCAGAAGTTGACTGAAACTCAGGGAGAGCTGAAGGA
CCTGACCCAGAAGGTAGAGCTGCTGGAGAAGTTTCGGGACAACTGTTTGGCAATTTTGGAGAGCAAGGGCCTTGATCCAGCTTTAGGCAG
TGAGACCCTGGCATCACGACAAGAATCCACTACTGATCACATGGACTCTATGTTGCTGTTAGAAACTTTGCAAGAGGAGCTGAAGCTTTT
TAACGAAACAGCCAAAAAGCAGATGGAGGAGTTACAGGATGAATTTACAGGAATTGAACCCTTGAGCGAGGATGCCATTATCACAGGCTT
CAGAAATGTAACAATTTGTCCTAACCCAGAAGACACTTGTGACTTTGCCAGAGCAGCTCGTTTTGTATCCACTCCTTTTCATGAGATAAT
GTCCTTGAAGGATCTCCCTTCTGATCCTGAGAGACTGTTACCGGAAGAAGATCTAGATGTAAAGACCTCTGAGGACCAGCAGACAGCTTG
TGGCACTATCTACAGTCAGACTCTCAGCATCAAGAAGCTGAGCCCAATTATTGAAGACAGTCGTGAAGCCACACACTCCTCTGGCTTCTC
TGGTTCTTCTGCCTCGGTTGCAAGCACCTCCTCCATCAAATGTCTTCAAATTCCTGAGAAACTAGAACTTACTAATGAGACTTCAGAAAA
CCCTACTCAGTCACCATGGTGTTCACAGTATCGCAGACAGCTACTGAAGTCCCTACCAGAGTTAAGTGCCTCTGCAGAGTTGTGTATAGA
AGACAGACCAATGCCTAAGTTGGAAATTGAGAAGGAAATTGAATTAGGTAATGAGGATTACTGCATTAAACGAGAATACCTAATATGTGA
AGATTACAAGTTATTCTGGGTGGCGCCAAGAAACTCTGCAGAATTAACAGTAATAAAGGTATCTTCTCAACCTGTCCCATGGGACTTTTA
TATCAACCTCAAGTTAAAGGAACGTTTAAATGAAGATTTTGATCATTTTTGCAGCTGTTATCAATATCAAGATGGCTGTATTGTTTGGCA
CCAATATATAAACTGCTTCACCCTTCAGGATCTTCTCCAACACAGTGAATATATTACCCATGAAATAACAGTGTTGATTATTTATAACCT
TTTGACAATAGTGGAGATGCTACACAAAGCAGAAATAGTCCATGGTGACTTGAGTCCAAGGTGTCTGATTCTCAGAAACAGAATCCACGA
TCCCTATGATTGTAACAAGAACAATCAAGCTTTGAAGATAGTGGACTTTTCCTACAGTGTTGACCTTAGGGTGCAGCTGGATGTTTTTAC
CCTCAGCGGCTTTCGGACTGTACAGATCCTGGAAGGACAAAAGATCCTGGCTAACTGTTCTTCTCCCTACCAGGTAGACCTGTTTGGTAT
AGCAGATTTAGCACATTTACTATTGTTCAAGGAACACCTACAGGTCTTCTGGGATGGGTCCTTCTGGAAACTTAGCCAAAATATTTCTGA
GCTAAAAGATGGTGAATTGTGGAATAAATTCTTTGTGCGGATTCTGAATGCCAATGATGAGGCCACAGTGTCTGTTCTTGGGGAGCTTGC
AGCAGAAATGAATGGGGTTTTTGACACTACATTCCAAAGTCACCTGAACAAAGCCTTATGGAAGGTAGGGAAGTTAACTAGTCCTGGGGC
TTTGCTCTTTCAGTGAGCTAGGCAATCAAGTCTCACAGATTGCTGCCTCAGAGCAATGGTTGTATTGTGGAACACTGAAACTGTATGTGC
TGTAATTTAATTTAGGACACATTTAGATGCACTACCATTGCTGTTCTACTTTTTGGTACAGGTATATTTTGACGTCACTGATATTTTTTA
TACAGTGATATACTTACTCATGGCCTTGTCTAACTTTTGTGAAGAACTATTTTATTCTAAACAGACTCATTACAAATGGTTACCTTGTTA
TTTAACCCATTTGTCTCTACTTTTCCCTGTACTTTTCCCATTTGTAATTTGTAAAATGTTCTCTTATGATCACCATGTATTTTGTAAATA

>In-frame_KNSTRN_ENST00000249776_chr15_40684224_+_BUB1B_ENST00000412359_chr15_40498385_+_2635nt
ATTAGCTCCATTCAAGCCTACAAATTGCATCACCCTCCTCCTCTGCCCAGACCTGGGGGCTCCAACACCTTTCGCTAGGTCTGGCTCTGG
CCTCTGAGCGAACCTTCCGTACAGTATGGCGGCTCCCGAAGCCCCGCCCCTGGACAGAGTTTTCCGTACAACATGGCTGTCTACAGAGTG
CGATTCCCACCCACTTCCGCCTAGCTACCGGAAGTTTCTATTTGAAACCCAGGCGGCCGACTTAGCCGGTGGCACGACAGTTGCTGCAGG
GAATCTTTTAAACGAGAGCGAGAAGGACTGCGGGCAGGACCGGCGGGCTCCTGGGGTTCAGCCGTGCCGCCTCGTTACGATGACCAGTGT
GGTTAAGACAGTGTATAGCCTGCAGCCCCCCTCTGCGCTGAGCGGCGGCCAGCCGGCAGACACACAAACTCGGGCCACTTCTAAGAGTCT
CTTACCTGTTAGGTCCAAAGAAGTCGATGTTTCCAAACAGCTTCATTCAGGAGGTCCAGAGAATGATGTTACAAAAATCACCAAACTGAG
ACGAGAGAATGGGCAAATGAAAGCTACTGACACTGCCACCAGAAGGAATGTCAGAAAAGGCTACAAACCACTGAGTAAGCAAAAATCAGA
GGAAGAGCTCAAGGACAAGAACCAGCTGTTAGAAGCCGTCAACAAGCAGTTGCACCAGAAGTTGACTGAAACTCAGGGAGAGCTGAAGGA
CCTGACCCAGAAGGTAGAGCTGCTGGAGAAGTTTCGGGACAACTGTTTGGCAATTTTGGAGAGCAAGGGCCTTGATCCAGCTTTAGGCAG
TGAGACCCTGGCATCACGACAAGAATCCACTACTGATCACATGGACTCTATGTTGCTGTTAGAAACTTTGCAAGAGGAGCTGAAGCTTTT
TAACGAAACAGCCAAAAAGCAGATGGAGGAGTTACAGGATGAATTTACAGGAATTGAACCCTTGAGCGAGGATGCCATTATCACAGGCTT
CAGAAATGTAACAATTTGTCCTAACCCAGAAGACACTTGTGACTTTGCCAGAGCAGCTCGTTTTGTATCCACTCCTTTTCATGAGATAAT
GTCCTTGAAGGATCTCCCTTCTGATCCTGAGAGACTGTTACCGGAAGAAGATCTAGATGTAAAGACCTCTGAGGACCAGCAGACAGCTTG
TGGCACTATCTACAGTCAGACTCTCAGCATCAAGAAGCTGAGCCCAATTATTGAAGACAGTCGTGAAGCCACACACTCCTCTGGCTTCTC
TGGTTCTTCTGCCTCGGTTGCAAGCACCTCCTCCATCAAATGTCTTCAAATTCCTGAGAAACTAGAACTTACTAATGAGACTTCAGAAAA
CCCTACTCAGTCACCATGGTGTTCACAGTATCGCAGACAGCTACTGAAGTCCCTACCAGAGTTAAGTGCCTCTGCAGAGTTGTGTATAGA
AGACAGACCAATGCCTAAGTTGGAAATTGAGAAGGAAATTGAATTAGGTAATGAGGATTACTGCATTAAACGAGAATACCTAATATGTGA
AGATTACAAGTTATTCTGGGTGGCGCCAAGAAACTCTGCAGAATTAACAGTAATAAAGGTATCTTCTCAACCTGTCCCATGGGACTTTTA
TATCAACCTCAAGTTAAAGGAACGTTTAAATGAAGATTTTGATCATTTTTGCAGCTGTTATCAATATCAAGATGGCTGTATTGTTTGGCA
CCAATATATAAACTGCTTCACCCTTCAGGATCTTCTCCAACACAGTGAATATATTACCCATGAAATAACAGTGTTGATTATTTATAACCT
TTTGACAATAGTGGAGATGCTACACAAAGCAGAAATAGTCCATGGTGACTTGAGTCCAAGGTGTCTGATTCTCAGAAACAGAATCCACGA
TCCCTATGATTGTAACAAGAACAATCAAGCTTTGAAGATAGTGGACTTTTCCTACAGTGTTGACCTTAGGGTGCAGCTGGATGTTTTTAC
CCTCAGCGGCTTTCGGACTGTACAGATCCTGGAAGGACAAAAGATCCTGGCTAACTGTTCTTCTCCCTACCAGGTAGACCTGTTTGGTAT
AGCAGATTTAGCACATTTACTATTGTTCAAGGAACACCTACAGGTCTTCTGGGATGGGTCCTTCTGGAAACTTAGCCAAAATATTTCTGA
GCTAAAAGATGGTGAATTGTGGAATAAATTCTTTGTGCGGATTCTGAATGCCAATGATGAGGCCACAGTGTCTGTTCTTGGGGAGCTTGC
AGCAGAAATGAATGGGGTTTTTGACACTACATTCCAAAGTCACCTGAACAAAGCCTTATGGAAGGTAGGGAAGTTAACTAGTCCTGGGGC
TTTGCTCTTTCAGTGAGCTAGGCAATCAAGTCTCACAGATTGCTGCCTCAGAGCAATGGTTGTATTGTGGAACACTGAAACTGTATGTGC
TGTAATTTAATTTAGGACACATTTAGATGCACTACCATTGCTGTTCTACTTTTTGGTACAGGTATATTTTGACGTCACTGATATTTTTTA
TACAGTGATATACTTACTCATGGCCTTGTCTAACTTTTGTGAAGAACTATTTTATTCTAAACAGACTCATTACAAATGGTTACCTTGTTA

>In-frame_KNSTRN_ENST00000608100_chr15_40684224_+_BUB1B_ENST00000287598_chr15_40498385_+_2513nt
TTTGAAACCCAGGCGGCCGACTTAGCCGGTGGCACGACAGTTGCTGCAGGGAATCTTTTAAACGAGAGCGAGAAGGACTGCGGGCAGGAC
CGGCGGGCTCCTGGGGTTCAGCCGTGCCGCCTCGTTACGATGACCAGTGTGGTTAAGACAGTGTATAGCCTGCAGCCCCCCTCTGCGCTG
AGCGGCGGCCAGCCGGCAGACACACAAACTCGGGCCACTTCTAAGAGTCTCTTACCTGTTAGGTCCAAAGAAGTCGATGTTTCCAAACAG
CTTCATTCAGGAGGTCCAGAGAATGATGTTACAAAAATCACCAAACTGAGACGAGAGAATGGGCAAATGAAAGCTACTGACACTGCCACC
AGAAGGAATGTCAGAAAAGGCTACAAACCACTGAGTAAGCAAAAATCAGAGGAAGAGCTCAAGGACAAGAACCAGCTGTTAGAAGCCGTC
AACAAGCAGTTGCACCAGAAGTTGACTGAAACTCAGGGAGAGCTGAAGGACCTGACCCAGAAGGTAGAGCTGCTGGAGAAGTTTCGGGAC
AACTGTTTGGCAATTTTGGAGAGCAAGGGCCTTGATCCAGCTTTAGGCAGTGAGACCCTGGCATCACGACAAGAATCCACTACTGATCAC
ATGGACTCTATGTTGCTGTTAGAAACTTTGCAAGAGGAGCTGAAGCTTTTTAACGAAACAGCCAAAAAGCAGATGGAGGAGTTACAGGAT
GAATTTACAGGAATTGAACCCTTGAGCGAGGATGCCATTATCACAGGCTTCAGAAATGTAACAATTTGTCCTAACCCAGAAGACACTTGT
GACTTTGCCAGAGCAGCTCGTTTTGTATCCACTCCTTTTCATGAGATAATGTCCTTGAAGGATCTCCCTTCTGATCCTGAGAGACTGTTA
CCGGAAGAAGATCTAGATGTAAAGACCTCTGAGGACCAGCAGACAGCTTGTGGCACTATCTACAGTCAGACTCTCAGCATCAAGAAGCTG
AGCCCAATTATTGAAGACAGTCGTGAAGCCACACACTCCTCTGGCTTCTCTGGTTCTTCTGCCTCGGTTGCAAGCACCTCCTCCATCAAA
TGTCTTCAAATTCCTGAGAAACTAGAACTTACTAATGAGACTTCAGAAAACCCTACTCAGTCACCATGGTGTTCACAGTATCGCAGACAG
CTACTGAAGTCCCTACCAGAGTTAAGTGCCTCTGCAGAGTTGTGTATAGAAGACAGACCAATGCCTAAGTTGGAAATTGAGAAGGAAATT
GAATTAGGTAATGAGGATTACTGCATTAAACGAGAATACCTAATATGTGAAGATTACAAGTTATTCTGGGTGGCGCCAAGAAACTCTGCA
GAATTAACAGTAATAAAGGTATCTTCTCAACCTGTCCCATGGGACTTTTATATCAACCTCAAGTTAAAGGAACGTTTAAATGAAGATTTT
GATCATTTTTGCAGCTGTTATCAATATCAAGATGGCTGTATTGTTTGGCACCAATATATAAACTGCTTCACCCTTCAGGATCTTCTCCAA
CACAGTGAATATATTACCCATGAAATAACAGTGTTGATTATTTATAACCTTTTGACAATAGTGGAGATGCTACACAAAGCAGAAATAGTC
CATGGTGACTTGAGTCCAAGGTGTCTGATTCTCAGAAACAGAATCCACGATCCCTATGATTGTAACAAGAACAATCAAGCTTTGAAGATA
GTGGACTTTTCCTACAGTGTTGACCTTAGGGTGCAGCTGGATGTTTTTACCCTCAGCGGCTTTCGGACTGTACAGATCCTGGAAGGACAA
AAGATCCTGGCTAACTGTTCTTCTCCCTACCAGGTAGACCTGTTTGGTATAGCAGATTTAGCACATTTACTATTGTTCAAGGAACACCTA
CAGGTCTTCTGGGATGGGTCCTTCTGGAAACTTAGCCAAAATATTTCTGAGCTAAAAGATGGTGAATTGTGGAATAAATTCTTTGTGCGG
ATTCTGAATGCCAATGATGAGGCCACAGTGTCTGTTCTTGGGGAGCTTGCAGCAGAAATGAATGGGGTTTTTGACACTACATTCCAAAGT
CACCTGAACAAAGCCTTATGGAAGGTAGGGAAGTTAACTAGTCCTGGGGCTTTGCTCTTTCAGTGAGCTAGGCAATCAAGTCTCACAGAT
TGCTGCCTCAGAGCAATGGTTGTATTGTGGAACACTGAAACTGTATGTGCTGTAATTTAATTTAGGACACATTTAGATGCACTACCATTG
CTGTTCTACTTTTTGGTACAGGTATATTTTGACGTCACTGATATTTTTTATACAGTGATATACTTACTCATGGCCTTGTCTAACTTTTGT
GAAGAACTATTTTATTCTAAACAGACTCATTACAAATGGTTACCTTGTTATTTAACCCATTTGTCTCTACTTTTCCCTGTACTTTTCCCA

>In-frame_KNSTRN_ENST00000608100_chr15_40684224_+_BUB1B_ENST00000412359_chr15_40498385_+_2415nt
TTTGAAACCCAGGCGGCCGACTTAGCCGGTGGCACGACAGTTGCTGCAGGGAATCTTTTAAACGAGAGCGAGAAGGACTGCGGGCAGGAC
CGGCGGGCTCCTGGGGTTCAGCCGTGCCGCCTCGTTACGATGACCAGTGTGGTTAAGACAGTGTATAGCCTGCAGCCCCCCTCTGCGCTG
AGCGGCGGCCAGCCGGCAGACACACAAACTCGGGCCACTTCTAAGAGTCTCTTACCTGTTAGGTCCAAAGAAGTCGATGTTTCCAAACAG
CTTCATTCAGGAGGTCCAGAGAATGATGTTACAAAAATCACCAAACTGAGACGAGAGAATGGGCAAATGAAAGCTACTGACACTGCCACC
AGAAGGAATGTCAGAAAAGGCTACAAACCACTGAGTAAGCAAAAATCAGAGGAAGAGCTCAAGGACAAGAACCAGCTGTTAGAAGCCGTC
AACAAGCAGTTGCACCAGAAGTTGACTGAAACTCAGGGAGAGCTGAAGGACCTGACCCAGAAGGTAGAGCTGCTGGAGAAGTTTCGGGAC
AACTGTTTGGCAATTTTGGAGAGCAAGGGCCTTGATCCAGCTTTAGGCAGTGAGACCCTGGCATCACGACAAGAATCCACTACTGATCAC
ATGGACTCTATGTTGCTGTTAGAAACTTTGCAAGAGGAGCTGAAGCTTTTTAACGAAACAGCCAAAAAGCAGATGGAGGAGTTACAGGAT
GAATTTACAGGAATTGAACCCTTGAGCGAGGATGCCATTATCACAGGCTTCAGAAATGTAACAATTTGTCCTAACCCAGAAGACACTTGT
GACTTTGCCAGAGCAGCTCGTTTTGTATCCACTCCTTTTCATGAGATAATGTCCTTGAAGGATCTCCCTTCTGATCCTGAGAGACTGTTA
CCGGAAGAAGATCTAGATGTAAAGACCTCTGAGGACCAGCAGACAGCTTGTGGCACTATCTACAGTCAGACTCTCAGCATCAAGAAGCTG
AGCCCAATTATTGAAGACAGTCGTGAAGCCACACACTCCTCTGGCTTCTCTGGTTCTTCTGCCTCGGTTGCAAGCACCTCCTCCATCAAA
TGTCTTCAAATTCCTGAGAAACTAGAACTTACTAATGAGACTTCAGAAAACCCTACTCAGTCACCATGGTGTTCACAGTATCGCAGACAG
CTACTGAAGTCCCTACCAGAGTTAAGTGCCTCTGCAGAGTTGTGTATAGAAGACAGACCAATGCCTAAGTTGGAAATTGAGAAGGAAATT
GAATTAGGTAATGAGGATTACTGCATTAAACGAGAATACCTAATATGTGAAGATTACAAGTTATTCTGGGTGGCGCCAAGAAACTCTGCA
GAATTAACAGTAATAAAGGTATCTTCTCAACCTGTCCCATGGGACTTTTATATCAACCTCAAGTTAAAGGAACGTTTAAATGAAGATTTT
GATCATTTTTGCAGCTGTTATCAATATCAAGATGGCTGTATTGTTTGGCACCAATATATAAACTGCTTCACCCTTCAGGATCTTCTCCAA
CACAGTGAATATATTACCCATGAAATAACAGTGTTGATTATTTATAACCTTTTGACAATAGTGGAGATGCTACACAAAGCAGAAATAGTC
CATGGTGACTTGAGTCCAAGGTGTCTGATTCTCAGAAACAGAATCCACGATCCCTATGATTGTAACAAGAACAATCAAGCTTTGAAGATA
GTGGACTTTTCCTACAGTGTTGACCTTAGGGTGCAGCTGGATGTTTTTACCCTCAGCGGCTTTCGGACTGTACAGATCCTGGAAGGACAA
AAGATCCTGGCTAACTGTTCTTCTCCCTACCAGGTAGACCTGTTTGGTATAGCAGATTTAGCACATTTACTATTGTTCAAGGAACACCTA
CAGGTCTTCTGGGATGGGTCCTTCTGGAAACTTAGCCAAAATATTTCTGAGCTAAAAGATGGTGAATTGTGGAATAAATTCTTTGTGCGG
ATTCTGAATGCCAATGATGAGGCCACAGTGTCTGTTCTTGGGGAGCTTGCAGCAGAAATGAATGGGGTTTTTGACACTACATTCCAAAGT
CACCTGAACAAAGCCTTATGGAAGGTAGGGAAGTTAACTAGTCCTGGGGCTTTGCTCTTTCAGTGAGCTAGGCAATCAAGTCTCACAGAT
TGCTGCCTCAGAGCAATGGTTGTATTGTGGAACACTGAAACTGTATGTGCTGTAATTTAATTTAGGACACATTTAGATGCACTACCATTG
CTGTTCTACTTTTTGGTACAGGTATATTTTGACGTCACTGATATTTTTTATACAGTGATATACTTACTCATGGCCTTGTCTAACTTTTGT


Top

FusionGenePPI for KNSTRN_BUB1B


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
KNSTRNMPP6, MAPK6, CHMP1B, CLU, ENO1, SHMT2, MOV10, NXF1, NUPR1, ZDHHC17, USB1, CCDC101, CEP170, IFT57, C17orf59, CCDC67, PRPF19, HSPA8, HSPA1A, HSPA6, HSPB1, PCM1, SPICE1, CEP44, DCTN1, HSPA5, KIF22, DYNLL1, MAPRE1, SMEK1, SSSCA1, TACC1, CCDC89, SYCE3, IFT74, COPS7BBUB1BHDAC1, BRCA2, SNCG, CDC20, BUB3, MAD2L1, CENPE, AP2B1, APC, CDC27, CDC16, ANAPC7, UBE2C, PARP1, KAT2B, ANAPC4, BUB1, MIS12, ZWINT, BUB1B, NSL1, DNMBP, MXI1, MDM2, MAD2L1BP, PLK1, TUBB, CASC5, TP73, AJUBA, AURKB, PLK3, PTTG1, SGOL1, DAXX, FZR1, TRIM33, COMMD4, GANAB, PRKCSH, PNMA2, UGP2, TRIP13, SUMO1, ANAPC1, ANAPC2, BAG2, DSN1, ZFC3H1, CCT2, EEF2, HSPB1, HSPH1, NDC80, NUF2, PMF1, PSMA3, PSMA4, PSMA6, PSMB5, PSMD6, RPL39, SKIV2L2, RAE1, UBR5, CCNA2, FBXW7, BTRC, MED4, XPO1, CD14, CDC23, SMEK1, CERK, ANAPC10, NEK2, SNW1, CDC5L, PPP2R5A, TYW3, HDAC2, HDAC3


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneKNSTRNchr15:40684224chr15:40498385ENST00000249776+89159_316274317SPAG5
HgeneKNSTRNchr15:40684224chr15:40498385ENST00000416151+89159_316274287SPAG5
HgeneKNSTRNchr15:40684224chr15:40498385ENST00000448395+78159_316253407SPAG5


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for KNSTRN_BUB1B


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for KNSTRN_BUB1B


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneKNSTRNC0007137Squamous cell carcinoma1CTD_human
TgeneBUB1BC0018273Growth Disorders1CTD_human
TgeneBUB1BC0025958Microcephaly1CTD_human
TgeneBUB1BC0206656Rhabdomyosarcoma, Embryonal1CTD_human
TgeneBUB1BC0279626Squamous cell carcinoma of esophagus1CTD_human
TgeneBUB1BC1850343MOSAIC VARIEGATED ANEUPLOIDY SYNDROME1CTD_human;ORPHANET;UNIPROT
TgeneBUB1BC1864389PREMATURE CHROMATID SEPARATION TRAIT1CTD_human;UNIPROT