FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 19120

FusionGeneSummary for KMT2C_DNAH11

check button Fusion gene summary
Fusion gene informationFusion gene name: KMT2C_DNAH11
Fusion gene ID: 19120
HgeneTgene
Gene symbol

KMT2C

DNAH11

Gene ID

58508

8701

Gene namelysine methyltransferase 2Cdynein axonemal heavy chain 11
SynonymsHALR|KLEFS2|MLL3CILD7|DNAHBL|DNAHC11|DNHBL|DPL11
Cytomap

7q36.1

7p15.3

Type of geneprotein-codingprotein-coding
Descriptionhistone-lysine N-methyltransferase 2CALR-like proteinhistone-lysine N-methyltransferase MLL3histone-lysine N-methyltransferase, H3 lysine-4 specifichomologous to ALR proteinlysine (K)-specific methyltransferase 2Cmyeloid/lymphoid or mixed-lineage ledynein heavy chain 11, axonemalaxonemal beta dynein heavy chain 11axonemal dynein heavy chain 11ciliary dynein heavy chain 11dynein, axonemal, heavy polypeptide 11dynein, ciliary, heavy chain 11
Modification date2018052320180523
UniProtAcc

Q8NEZ4

Q96DT5

Ensembl transtripts involved in fusion geneENST00000262189, ENST00000355193, 
ENST00000485655, ENST00000485241, 
ENST00000409508, ENST00000328843, 
ENST00000465593, 
Fusion gene scores* DoF score18 X 16 X 10=28804 X 4 X 4=64
# samples 224
** MAII scorelog2(22/2880*10)=-3.71049338280502
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(4/64*10)=-0.678071905112638
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: KMT2C [Title/Abstract] AND DNAH11 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Transcription factor involved fusion gene, inframe and retained DNA-binding domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDCESCTCGA-DS-A1OC-01AKMT2Cchr7

152007051

-DNAH11chr7

21856085

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000262189ENST00000409508KMT2Cchr7

152007051

-DNAH11chr7

21856085

+
In-frameENST00000262189ENST00000328843KMT2Cchr7

152007051

-DNAH11chr7

21856085

+
5CDS-intronENST00000262189ENST00000465593KMT2Cchr7

152007051

-DNAH11chr7

21856085

+
In-frameENST00000355193ENST00000409508KMT2Cchr7

152007051

-DNAH11chr7

21856085

+
In-frameENST00000355193ENST00000328843KMT2Cchr7

152007051

-DNAH11chr7

21856085

+
5CDS-intronENST00000355193ENST00000465593KMT2Cchr7

152007051

-DNAH11chr7

21856085

+
intron-3CDSENST00000485655ENST00000409508KMT2Cchr7

152007051

-DNAH11chr7

21856085

+
intron-3CDSENST00000485655ENST00000328843KMT2Cchr7

152007051

-DNAH11chr7

21856085

+
intron-intronENST00000485655ENST00000465593KMT2Cchr7

152007051

-DNAH11chr7

21856085

+
intron-3CDSENST00000485241ENST00000409508KMT2Cchr7

152007051

-DNAH11chr7

21856085

+
intron-3CDSENST00000485241ENST00000328843KMT2Cchr7

152007051

-DNAH11chr7

21856085

+
intron-intronENST00000485241ENST00000465593KMT2Cchr7

152007051

-DNAH11chr7

21856085

+

Top

FusionProtFeatures for KMT2C_DNAH11


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
KMT2C

Q8NEZ4

DNAH11

Q96DT5

Histone methyltransferase. Methylates 'Lys-4' of histoneH3. H3 'Lys-4' methylation represents a specific tag forepigenetic transcriptional activation. Central component of theMLL2/3 complex, a coactivator complex of nuclear receptors,involved in transcriptional coactivation. KMT2C/MLL3 may be acatalytic subunit of this complex. May be involved inleukemogenesis and developmental disorder.{ECO:0000269|PubMed:17500065}. Force generating protein of respiratory cilia. Producesforce towards the minus ends of microtubules. Dynein has ATPaseactivity; the force-producing power stroke is thought to occur onrelease of ADP.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneKMT2Cchr7:152007051chr7:21856085ENST00000262189-65992_1122834912Coiled coilOntology_term=ECO:0000255
HgeneKMT2Cchr7:152007051chr7:21856085ENST00000355193-66092_1122834969Coiled coilOntology_term=ECO:0000255
HgeneKMT2Cchr7:152007051chr7:21856085ENST00000262189-65934_462834912DNA bindingNote=A.T hook
HgeneKMT2Cchr7:152007051chr7:21856085ENST00000355193-66034_462834969DNA bindingNote=A.T hook
HgeneKMT2Cchr7:152007051chr7:21856085ENST00000262189-659227_2622834912Zinc fingerC2HC pre-PHD-type 1%3B degenerate
HgeneKMT2Cchr7:152007051chr7:21856085ENST00000355193-660227_2622834969Zinc fingerC2HC pre-PHD-type 1%3B degenerate
TgeneDNAH11chr7:152007051chr7:21856085ENST00000328843+63833668_370334514524Coiled coilOntology_term=ECO:0000255
TgeneDNAH11chr7:152007051chr7:21856085ENST00000328843+63833459_368634514524RegionAAA 5
TgeneDNAH11chr7:152007051chr7:21856085ENST00000328843+63833896_412234514524RegionAAA 6

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneKMT2Cchr7:152007051chr7:21856085ENST00000262189-6591338_13662834912Coiled coilOntology_term=ECO:0000255
HgeneKMT2Cchr7:152007051chr7:21856085ENST00000262189-6591754_17872834912Coiled coilOntology_term=ECO:0000255
HgeneKMT2Cchr7:152007051chr7:21856085ENST00000262189-6593054_30812834912Coiled coilOntology_term=ECO:0000255
HgeneKMT2Cchr7:152007051chr7:21856085ENST00000262189-6593173_32722834912Coiled coilOntology_term=ECO:0000255
HgeneKMT2Cchr7:152007051chr7:21856085ENST00000262189-6593391_34332834912Coiled coilOntology_term=ECO:0000255
HgeneKMT2Cchr7:152007051chr7:21856085ENST00000262189-659644_6722834912Coiled coilOntology_term=ECO:0000255
HgeneKMT2Cchr7:152007051chr7:21856085ENST00000355193-6601338_13662834969Coiled coilOntology_term=ECO:0000255
HgeneKMT2Cchr7:152007051chr7:21856085ENST00000355193-6601754_17872834969Coiled coilOntology_term=ECO:0000255
HgeneKMT2Cchr7:152007051chr7:21856085ENST00000355193-6603054_30812834969Coiled coilOntology_term=ECO:0000255
HgeneKMT2Cchr7:152007051chr7:21856085ENST00000355193-6603173_32722834969Coiled coilOntology_term=ECO:0000255
HgeneKMT2Cchr7:152007051chr7:21856085ENST00000355193-6603391_34332834969Coiled coilOntology_term=ECO:0000255
HgeneKMT2Cchr7:152007051chr7:21856085ENST00000355193-660644_6722834969Coiled coilOntology_term=ECO:0000255
HgeneKMT2Cchr7:152007051chr7:21856085ENST00000262189-6591719_17962834912Compositional biasNote=Gln-rich
HgeneKMT2Cchr7:152007051chr7:21856085ENST00000262189-6591834_22812834912Compositional biasNote=Pro-rich
HgeneKMT2Cchr7:152007051chr7:21856085ENST00000262189-6592412_26302834912Compositional biasNote=Pro-rich
HgeneKMT2Cchr7:152007051chr7:21856085ENST00000262189-6592690_27862834912Compositional biasNote=Asp-rich
HgeneKMT2Cchr7:152007051chr7:21856085ENST00000262189-6593012_35092834912Compositional biasNote=Gln-rich
HgeneKMT2Cchr7:152007051chr7:21856085ENST00000262189-6593277_33812834912Compositional biasNote=Pro-rich
HgeneKMT2Cchr7:152007051chr7:21856085ENST00000355193-6601719_17962834969Compositional biasNote=Gln-rich
HgeneKMT2Cchr7:152007051chr7:21856085ENST00000355193-6601834_22812834969Compositional biasNote=Pro-rich
HgeneKMT2Cchr7:152007051chr7:21856085ENST00000355193-6602412_26302834969Compositional biasNote=Pro-rich
HgeneKMT2Cchr7:152007051chr7:21856085ENST00000355193-6602690_27862834969Compositional biasNote=Asp-rich
HgeneKMT2Cchr7:152007051chr7:21856085ENST00000355193-6603012_35092834969Compositional biasNote=Gln-rich
HgeneKMT2Cchr7:152007051chr7:21856085ENST00000355193-6603277_33812834969Compositional biasNote=Pro-rich
HgeneKMT2Cchr7:152007051chr7:21856085ENST00000262189-659436_4892834912DomainDHHC
HgeneKMT2Cchr7:152007051chr7:21856085ENST00000262189-6594545_46052834912DomainFYR N-terminal
HgeneKMT2Cchr7:152007051chr7:21856085ENST00000262189-6594606_46912834912DomainFYR C-terminal
HgeneKMT2Cchr7:152007051chr7:21856085ENST00000262189-6594771_48872834912DomainSET
HgeneKMT2Cchr7:152007051chr7:21856085ENST00000262189-6594895_49112834912DomainPost-SET
HgeneKMT2Cchr7:152007051chr7:21856085ENST00000355193-660436_4892834969DomainDHHC
HgeneKMT2Cchr7:152007051chr7:21856085ENST00000355193-6604545_46052834969DomainFYR N-terminal
HgeneKMT2Cchr7:152007051chr7:21856085ENST00000355193-6604606_46912834969DomainFYR C-terminal
HgeneKMT2Cchr7:152007051chr7:21856085ENST00000355193-6604771_48872834969DomainSET
HgeneKMT2Cchr7:152007051chr7:21856085ENST00000355193-6604895_49112834969DomainPost-SET
HgeneKMT2Cchr7:152007051chr7:21856085ENST00000262189-6594848_48492834912RegionS-adenosyl-L-methionine binding
HgeneKMT2Cchr7:152007051chr7:21856085ENST00000355193-6604848_48492834969RegionS-adenosyl-L-methionine binding
HgeneKMT2Cchr7:152007051chr7:21856085ENST00000262189-6591007_10572834912Zinc fingerPHD-type 6
HgeneKMT2Cchr7:152007051chr7:21856085ENST00000262189-6591084_11392834912Zinc fingerPHD-type 7
HgeneKMT2Cchr7:152007051chr7:21856085ENST00000262189-659283_3312834912Zinc fingerPHD-type 1
HgeneKMT2Cchr7:152007051chr7:21856085ENST00000262189-659341_3912834912Zinc fingerPHD-type 2
HgeneKMT2Cchr7:152007051chr7:21856085ENST00000262189-659344_3892834912Zinc fingerRING-type
HgeneKMT2Cchr7:152007051chr7:21856085ENST00000262189-659388_4382834912Zinc fingerPHD-type 3
HgeneKMT2Cchr7:152007051chr7:21856085ENST00000262189-6594399_44392834912Zinc fingerC2HC pre-PHD-type 2
HgeneKMT2Cchr7:152007051chr7:21856085ENST00000262189-6594460_45072834912Zinc fingerPHD-type 8
HgeneKMT2Cchr7:152007051chr7:21856085ENST00000262189-659464_5202834912Zinc fingerPHD-type 4
HgeneKMT2Cchr7:152007051chr7:21856085ENST00000262189-659957_10102834912Zinc fingerPHD-type 5
HgeneKMT2Cchr7:152007051chr7:21856085ENST00000355193-6601007_10572834969Zinc fingerPHD-type 6
HgeneKMT2Cchr7:152007051chr7:21856085ENST00000355193-6601084_11392834969Zinc fingerPHD-type 7
HgeneKMT2Cchr7:152007051chr7:21856085ENST00000355193-660283_3312834969Zinc fingerPHD-type 1
HgeneKMT2Cchr7:152007051chr7:21856085ENST00000355193-660341_3912834969Zinc fingerPHD-type 2
HgeneKMT2Cchr7:152007051chr7:21856085ENST00000355193-660344_3892834969Zinc fingerRING-type
HgeneKMT2Cchr7:152007051chr7:21856085ENST00000355193-660388_4382834969Zinc fingerPHD-type 3
HgeneKMT2Cchr7:152007051chr7:21856085ENST00000355193-6604399_44392834969Zinc fingerC2HC pre-PHD-type 2
HgeneKMT2Cchr7:152007051chr7:21856085ENST00000355193-6604460_45072834969Zinc fingerPHD-type 8
HgeneKMT2Cchr7:152007051chr7:21856085ENST00000355193-660464_5202834969Zinc fingerPHD-type 4
HgeneKMT2Cchr7:152007051chr7:21856085ENST00000355193-660957_10102834969Zinc fingerPHD-type 5
TgeneDNAH11chr7:152007051chr7:21856085ENST00000328843+63831274_132734514524Coiled coilOntology_term=ECO:0000255
TgeneDNAH11chr7:152007051chr7:21856085ENST00000328843+63833072_313634514524Coiled coilOntology_term=ECO:0000255
TgeneDNAH11chr7:152007051chr7:21856085ENST00000328843+63833312_340334514524Coiled coilOntology_term=ECO:0000255
TgeneDNAH11chr7:152007051chr7:21856085ENST00000328843+63831893_190034514524Nucleotide bindingATP
TgeneDNAH11chr7:152007051chr7:21856085ENST00000328843+63832174_218134514524Nucleotide bindingATP
TgeneDNAH11chr7:152007051chr7:21856085ENST00000328843+63832510_251734514524Nucleotide bindingATP
TgeneDNAH11chr7:152007051chr7:21856085ENST00000328843+63832855_286234514524Nucleotide bindingATP
TgeneDNAH11chr7:152007051chr7:21856085ENST00000328843+63831855_207634514524RegionAAA 1
TgeneDNAH11chr7:152007051chr7:21856085ENST00000328843+63831_185434514524RegionStem
TgeneDNAH11chr7:152007051chr7:21856085ENST00000328843+63832136_236634514524RegionAAA 2
TgeneDNAH11chr7:152007051chr7:21856085ENST00000328843+63832472_271934514524RegionAAA 3
TgeneDNAH11chr7:152007051chr7:21856085ENST00000328843+63832817_306634514524RegionAAA 4
TgeneDNAH11chr7:152007051chr7:21856085ENST00000328843+63833072_340334514524RegionStalk


Top

FusionGeneSequence for KMT2C_DNAH11


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_KMT2C_ENST00000262189_chr7_152007051_-_DNAH11_ENST00000409508_chr7_21856085_+_1356aa
MSSEEDKSVEQPQPPPPPPEEPGAPAPSPAAADKRPRGRPRKDGASPFQRARKKPRSRGKTAVEDEDSMDGLETTETETIVETEIKEQSA
EEDAEAEVDNSKQLIPTLQRSVSEESANSLVSVGVEAKISEQLCAFCYCGEKSSLGQGDLKQFRITPGFILPWRNQPSNKKDIDDNSNGT
TEKMQNSAPRKQRGQRKERSPQQNIVSCVSVSTQTASDDQAGKLWDELSLVGLPDAIDIQALFDSTGTCWAHHRCVEWSLGVCQMEEPLL
VNVDKAVVSGSTEVSIPLTEGLDLISMLTDDATIAAWNNEGLPSDRMSTENAAILTHCERWPLVIDPQQQGIKWIKNKTGMDLKVTHLGQ
KGFLNAIETALAFGDVILIENLEETIDPVLDPLLGRNTIKKGKTIRIGDKECEFNKNFRLILHTKLANPHTKPELQAQTTLLNFTVTEDG
LEAQLLAEVVSIERPDLEKLKLVLTKHQNDFKIELKTLEDDLLLRLSAAEGSFLDDTKLVERLEATKTTVAEIEHKVIEAKENERKINEA
RECYRPVAARASLLTFVINDLQKINPLYQFSLKAFNVLFHRAIEQADKVEDMQGRISILMESITHAVFLYTSQALFEKDKLTFLSQMAFQ
ILLRKKEIDPLELDFLLRFTVEHTHLSPVDFLTSQSWSAIKAIAVMEEFRGIDRDVEGSAKQWRKWVESECPEKEKLPQEWKKKSLIQKL
ILLRAMRPDRMTTALRNFVEEKLGAKTVERTRLDLVKAFEESSPATPIFFILSPGVDALKDLEILGKRLGFTIDSGKFHNVSLGQGQETV
AEVALEKASKGGHWVILQNVHLVAKWLGTLEKLLERFSQGSHRDYRVFMSAESAPTPDEHIIPQGLLENSIKITNEPPTGMLANLHAALY
NFDQDTLEICSKEQEFKSILFSLCYFHACVAGRLRFGPQGWSRSTPFNPGDLTICASVLYNYLEANSKVPWEDLRTLFGEIMTGGHITDD
WDRKLCRVTLEEFMNPSLTEDELMLAPGFAAPPYLDTAGYHQYIEEMLPPESPALTGLHPNAEIEFLTVTSNTLFRTLLEMQPRNALSGD
ELGQSTEEKVKNVLDDILEKLPEEFNMAEIMQKNSNRSPTVLVCFQECERMNILIREIRISLEQLDLSLKGELALSPAVEAQQFALSTDT
VPDTWSKLATPSTTGLAQWFNDLLLRCRELDTWTQDLTLPAVVWLSGFFNPQSFLTAIMQTMARKNEWPLDKTRLTADVTKKTKEDTGHP
PREGAYLHGLFMEGARWDTQAGTIVEARLKELACPMPVIFAKATPVDRQETKQTYECPVTRTKLRGPSYIWTFRLKSEEKTAKWVLAGVA

>In-frame_KMT2C_ENST00000262189_chr7_152007051_-_DNAH11_ENST00000328843_chr7_21856085_+_1356aa
MSSEEDKSVEQPQPPPPPPEEPGAPAPSPAAADKRPRGRPRKDGASPFQRARKKPRSRGKTAVEDEDSMDGLETTETETIVETEIKEQSA
EEDAEAEVDNSKQLIPTLQRSVSEESANSLVSVGVEAKISEQLCAFCYCGEKSSLGQGDLKQFRITPGFILPWRNQPSNKKDIDDNSNGT
TEKMQNSAPRKQRGQRKERSPQQNIVSCVSVSTQTASDDQAGKLWDELSLVGLPDAIDIQALFDSTGTCWAHHRCVEWSLGVCQMEEPLL
VNVDKAVVSGSTEVSIPLTEGLDLISMLTDDATIAAWNNEGLPSDRMSTENAAILTHCERWPLVIDPQQQGIKWIKNKTGMDLKVTHLGQ
KGFLNAIETALAFGDVILIENLEETIDPVLDPLLGRNTIKKGKTIRIGDKECEFNKNFRLILHTKLANPHTKPELQAQTTLLNFTVTEDG
LEAQLLAEVVSIERPDLEKLKLVLTKHQNDFKIELKTLEDDLLLRLSAAEGSFLDDTKLVERLEATKTTVAEIEHKVIEAKENERKINEA
RECYRPVAARASLLTFVINDLQKINPLYQFSLKAFNVLFHRAIEQADKVEDMQGRISILMESITHAVFLYTSQALFEKDKLTFLSQMAFQ
ILLRKKEIDPLELDFLLRFTVEHTHLSPVDFLTSQSWSAIKAIAVMEEFRGIDRDVEGSAKQWRKWVESECPEKEKLPQEWKKKSLIQKL
ILLRAMRPDRMTTALRNFVEEKLGAKTVERTRLDLVKAFEESSPATPIFFILSPGVDALKDLEILGKRLGFTIDSGKFHNVSLGQGQETV
AEVALEKASKGGHWVILQNVHLVAKWLGTLEKLLERFSQGSHRDYRVFMSAESAPTPDEHIIPQGLLENSIKITNEPPTGMLANLHAALY
NFDQDTLEICSKEQEFKSILFSLCYFHACVAGRLRFGPQGWSRSTPFNPGDLTICASVLYNYLEANSKVPWEDLRTLFGEIMTGGHITDD
WDRKLCRVTLEEFMNPSLTEDELMLAPGFAAPPYLDTAGYHQYIEEMLPPESPALTGLHPNAEIEFLTVTSNTLFRTLLEMQPRNALSGD
ELGQSTEEKVKNVLDDILEKLPEEFNMAEIMQKNSNRSPTVLVCFQECERMNILIREIRISLEQLDLSLKGELALSPAVEAQQFALSTDT
VPDTWSKLATPSTTGLAQWFNDLLLRCRELDTWTQDLTLPAVVWLSGFFNPQSFLTAIMQTMARKNEWPLDKTRLTADVTKKTKEDTGHP
PREGAYLHGLFMEGARWDTQAGTIVEARLKELACPMPVIFAKATPVDRQETKQTYECPVTRTKLRGPSYIWTFRLKSEEKTAKWVLAGVA

>In-frame_KMT2C_ENST00000355193_chr7_152007051_-_DNAH11_ENST00000409508_chr7_21856085_+_1356aa
MSSEEDKSVEQPQPPPPPPEEPGAPAPSPAAADKRPRGRPRKDGASPFQRARKKPRSRGKTAVEDEDSMDGLETTETETIVETEIKEQSA
EEDAEAEVDNSKQLIPTLQRSVSEESANSLVSVGVEAKISEQLCAFCYCGEKSSLGQGDLKQFRITPGFILPWRNQPSNKKDIDDNSNGT
TEKMQNSAPRKQRGQRKERSPQQNIVSCVSVSTQTASDDQAGKLWDELSLVGLPDAIDIQALFDSTGTCWAHHRCVEWSLGVCQMEEPLL
VNVDKAVVSGSTEVSIPLTEGLDLISMLTDDATIAAWNNEGLPSDRMSTENAAILTHCERWPLVIDPQQQGIKWIKNKTGMDLKVTHLGQ
KGFLNAIETALAFGDVILIENLEETIDPVLDPLLGRNTIKKGKTIRIGDKECEFNKNFRLILHTKLANPHTKPELQAQTTLLNFTVTEDG
LEAQLLAEVVSIERPDLEKLKLVLTKHQNDFKIELKTLEDDLLLRLSAAEGSFLDDTKLVERLEATKTTVAEIEHKVIEAKENERKINEA
RECYRPVAARASLLTFVINDLQKINPLYQFSLKAFNVLFHRAIEQADKVEDMQGRISILMESITHAVFLYTSQALFEKDKLTFLSQMAFQ
ILLRKKEIDPLELDFLLRFTVEHTHLSPVDFLTSQSWSAIKAIAVMEEFRGIDRDVEGSAKQWRKWVESECPEKEKLPQEWKKKSLIQKL
ILLRAMRPDRMTTALRNFVEEKLGAKTVERTRLDLVKAFEESSPATPIFFILSPGVDALKDLEILGKRLGFTIDSGKFHNVSLGQGQETV
AEVALEKASKGGHWVILQNVHLVAKWLGTLEKLLERFSQGSHRDYRVFMSAESAPTPDEHIIPQGLLENSIKITNEPPTGMLANLHAALY
NFDQDTLEICSKEQEFKSILFSLCYFHACVAGRLRFGPQGWSRSTPFNPGDLTICASVLYNYLEANSKVPWEDLRTLFGEIMTGGHITDD
WDRKLCRVTLEEFMNPSLTEDELMLAPGFAAPPYLDTAGYHQYIEEMLPPESPALTGLHPNAEIEFLTVTSNTLFRTLLEMQPRNALSGD
ELGQSTEEKVKNVLDDILEKLPEEFNMAEIMQKNSNRSPTVLVCFQECERMNILIREIRISLEQLDLSLKGELALSPAVEAQQFALSTDT
VPDTWSKLATPSTTGLAQWFNDLLLRCRELDTWTQDLTLPAVVWLSGFFNPQSFLTAIMQTMARKNEWPLDKTRLTADVTKKTKEDTGHP
PREGAYLHGLFMEGARWDTQAGTIVEARLKELACPMPVIFAKATPVDRQETKQTYECPVTRTKLRGPSYIWTFRLKSEEKTAKWVLAGVA

>In-frame_KMT2C_ENST00000355193_chr7_152007051_-_DNAH11_ENST00000328843_chr7_21856085_+_1356aa
MSSEEDKSVEQPQPPPPPPEEPGAPAPSPAAADKRPRGRPRKDGASPFQRARKKPRSRGKTAVEDEDSMDGLETTETETIVETEIKEQSA
EEDAEAEVDNSKQLIPTLQRSVSEESANSLVSVGVEAKISEQLCAFCYCGEKSSLGQGDLKQFRITPGFILPWRNQPSNKKDIDDNSNGT
TEKMQNSAPRKQRGQRKERSPQQNIVSCVSVSTQTASDDQAGKLWDELSLVGLPDAIDIQALFDSTGTCWAHHRCVEWSLGVCQMEEPLL
VNVDKAVVSGSTEVSIPLTEGLDLISMLTDDATIAAWNNEGLPSDRMSTENAAILTHCERWPLVIDPQQQGIKWIKNKTGMDLKVTHLGQ
KGFLNAIETALAFGDVILIENLEETIDPVLDPLLGRNTIKKGKTIRIGDKECEFNKNFRLILHTKLANPHTKPELQAQTTLLNFTVTEDG
LEAQLLAEVVSIERPDLEKLKLVLTKHQNDFKIELKTLEDDLLLRLSAAEGSFLDDTKLVERLEATKTTVAEIEHKVIEAKENERKINEA
RECYRPVAARASLLTFVINDLQKINPLYQFSLKAFNVLFHRAIEQADKVEDMQGRISILMESITHAVFLYTSQALFEKDKLTFLSQMAFQ
ILLRKKEIDPLELDFLLRFTVEHTHLSPVDFLTSQSWSAIKAIAVMEEFRGIDRDVEGSAKQWRKWVESECPEKEKLPQEWKKKSLIQKL
ILLRAMRPDRMTTALRNFVEEKLGAKTVERTRLDLVKAFEESSPATPIFFILSPGVDALKDLEILGKRLGFTIDSGKFHNVSLGQGQETV
AEVALEKASKGGHWVILQNVHLVAKWLGTLEKLLERFSQGSHRDYRVFMSAESAPTPDEHIIPQGLLENSIKITNEPPTGMLANLHAALY
NFDQDTLEICSKEQEFKSILFSLCYFHACVAGRLRFGPQGWSRSTPFNPGDLTICASVLYNYLEANSKVPWEDLRTLFGEIMTGGHITDD
WDRKLCRVTLEEFMNPSLTEDELMLAPGFAAPPYLDTAGYHQYIEEMLPPESPALTGLHPNAEIEFLTVTSNTLFRTLLEMQPRNALSGD
ELGQSTEEKVKNVLDDILEKLPEEFNMAEIMQKNSNRSPTVLVCFQECERMNILIREIRISLEQLDLSLKGELALSPAVEAQQFALSTDT
VPDTWSKLATPSTTGLAQWFNDLLLRCRELDTWTQDLTLPAVVWLSGFFNPQSFLTAIMQTMARKNEWPLDKTRLTADVTKKTKEDTGHP
PREGAYLHGLFMEGARWDTQAGTIVEARLKELACPMPVIFAKATPVDRQETKQTYECPVTRTKLRGPSYIWTFRLKSEEKTAKWVLAGVA


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_KMT2C_ENST00000262189_chr7_152007051_-_DNAH11_ENST00000409508_chr7_21856085_+_4068nt
ATGTCGTCGGAGGAGGACAAGAGCGTGGAGCAGCCGCAGCCGCCGCCACCACCCCCCGAGGAGCCTGGAGCCCCGGCCCCGAGCCCCGCA
GCCGCAGACAAAAGACCTCGGGGCCGGCCTCGCAAAGATGGCGCTTCCCCTTTCCAGAGAGCCAGAAAGAAACCTCGAAGTAGGGGGAAA
ACTGCAGTGGAAGATGAGGACAGCATGGATGGGCTGGAGACAACAGAAACAGAAACGATTGTGGAAACAGAAATCAAAGAACAATCTGCA
GAAGAGGATGCTGAAGCAGAAGTGGATAACAGCAAACAGCTAATTCCAACTCTTCAGCGATCTGTGTCTGAGGAATCGGCAAACTCCCTG
GTCTCTGTTGGTGTAGAAGCCAAAATCAGTGAACAGCTCTGCGCTTTTTGTTACTGTGGGGAAAAAAGTTCCTTAGGACAAGGAGACTTA
AAACAATTCAGAATAACGCCTGGATTTATCTTGCCATGGAGAAACCAACCTTCTAACAAGAAGGACATTGATGACAACAGCAATGGAACC
TATGAGAAAATGCAAAACTCAGCACCACGAAAACAAAGAGGACAGAGAAAAGAACGATCTCCTCAGCAGAATATAGTATCTTGTGTAAGT
GTAAGCACCCAGACAGCTTCAGATGATCAAGCTGGTAAACTGTGGGATGAACTCAGTCTGGTTGGGCTTCCAGATGCCATTGATATCCAA
GCCTTATTTGATTCTACAGGCACTTGTTGGGCTCATCACCGTTGTGTGGAGTGGTCACTAGGAGTATGCCAGATGGAAGAACCATTGTTA
GTGAACGTGGACAAAGCTGTTGTCTCAGGGAGCACAGAAGTTTCCATTCCACTAACCGAAGGCCTGGACTTGATATCCATGTTGACGGAT
GATGCTACAATTGCCGCCTGGAATAACGAAGGACTGCCCAGTGACAGAATGTCCACCGAAAATGCCGCTATCCTAACACACTGTGAGCGC
TGGCCTCTGGTGATAGATCCCCAGCAACAGGGAATTAAGTGGATCAAGAATAAGTATGGAATGGACCTGAAAGTCACACATTTGGGCCAG
AAAGGGTTTTTGAATGCCATTGAAACTGCTTTGGCCTTTGGTGATGTCATCTTAATTGAAAATCTCGAGGAAACGATAGATCCAGTCCTG
GATCCACTACTTGGCAGGAACACAATTAAAAAAGGAAAGTATATCAGGATTGGAGATAAAGAATGTGAATTTAACAAGAACTTTCGCCTT
ATCCTTCACACAAAATTGGCAAATCCTCACTATAAGCCGGAATTACAAGCTCAGACAACTCTCCTCAATTTCACAGTCACAGAAGATGGT
CTAGAAGCCCAGCTGCTGGCAGAGGTTGTCAGTATTGAAAGGCCAGATTTGGAGAAACTTAAGTTGGTATTGACAAAGCACCAAAATGAT
TTTAAAATTGAGCTCAAGTATCTGGAAGACGATCTCCTTTTGCGCCTTTCTGCGGCAGAGGGAAGCTTTCTGGATGACACCAAACTGGTA
GAGAGATTGGAGGCAACAAAGACCACCGTGGCAGAGATAGAGCACAAGGTGATTGAAGCCAAAGAAAATGAAAGAAAAATCAACGAGGCC
CGAGAATGTTACAGACCAGTGGCAGCAAGAGCATCTCTTCTTTATTTTGTTATTAATGACCTCCAAAAAATCAACCCCCTCTACCAATTC
TCTTTGAAGGCTTTTAACGTGCTGTTCCACAGAGCGATCGAGCAGGCTGACAAGGTGGAAGACATGCAGGGACGCATCTCTATCCTGATG
GAGAGCATCACCCATGCTGTCTTCCTCTACACCAGCCAGGCGCTGTTTGAGAAGGACAAGCTCACCTTCCTGTCCCAGATGGCTTTTCAG
ATTTTGTTGAGAAAGAAAGAGATAGACCCTCTTGAATTGGATTTCCTGCTTCGATTCACAGTTGAACACACTCATCTGAGTCCCGTTGAC
TTCCTAACTTCTCAGTCATGGAGTGCTATCAAGGCAATTGCCGTCATGGAAGAATTTCGAGGCATAGACCGAGATGTGGAAGGATCTGCC
AAGCAGTGGAGGAAGTGGGTAGAATCCGAGTGTCCAGAAAAAGAAAAATTACCTCAAGAATGGAAGAAGAAAAGTTTAATACAGAAGCTG
ATTCTTCTGAGAGCAATGCGCCCTGACAGAATGACGTATGCTCTCAGAAATTTTGTAGAGGAAAAACTGGGTGCGAAGTATGTGGAGAGG
ACCAGATTGGACTTAGTTAAAGCATTCGAAGAAAGCAGCCCAGCCACCCCCATATTCTTCATCCTGTCTCCGGGGGTAGATGCCCTTAAA
GACCTGGAGATTCTTGGCAAAAGACTTGGCTTTACAATTGACTCTGGAAAATTCCACAATGTGTCTTTAGGACAAGGTCAGGAGACGGTG
GCAGAAGTGGCCCTGGAGAAAGCTTCCAAAGGAGGACACTGGGTCATCCTCCAAAATGTTCATTTGGTAGCCAAGTGGCTAGGAACCTTG
GAGAAGCTCCTTGAAAGATTCAGCCAAGGAAGCCACAGAGATTACAGGGTTTTCATGAGTGCTGAGTCTGCACCTACACCAGATGAGCAT
ATCATCCCTCAAGGACTCCTGGAAAATTCCATTAAGATCACTAATGAACCCCCAACAGGGATGCTGGCCAATTTGCATGCCGCCCTGTAC
AACTTTGATCAGGATACACTTGAAATATGCTCCAAGGAGCAGGAGTTTAAAAGCATCCTTTTTTCTCTCTGCTACTTCCACGCCTGTGTT
GCTGGGAGACTGAGGTTTGGCCCCCAGGGCTGGAGCCGAAGCTATCCTTTTAATCCTGGAGACCTCACCATTTGTGCCAGTGTCCTCTAC
AACTACTTAGAGGCAAACTCTAAAGTCCCATGGGAAGATCTCCGTTATCTCTTTGGTGAGATCATGTATGGAGGCCACATCACAGATGAC
TGGGATCGCAAACTGTGTCGGGTGTATTTAGAAGAATTCATGAATCCATCTCTGACTGAAGATGAACTGATGCTGGCACCAGGTTTTGCT
GCCCCACCCTACCTAGATTATGCAGGCTACCACCAGTACATAGAGGAGATGCTTCCTCCAGAAAGCCCGGCACTGTATGGCCTCCACCCA
AATGCTGAAATAGAATTCCTGACAGTGACATCCAACACTCTCTTCAGAACTTTGCTGGAGATGCAGCCCAGGAATGCACTCAGTGGTGAT
GAACTGGGGCAGTCTACAGAAGAAAAGGTTAAGAATGTCTTGGATGACATTTTGGAGAAACTTCCAGAAGAGTTCAACATGGCAGAGATA
ATGCAAAAAAATTCAAATAGAAGCCCATATGTTCTTGTTTGCTTCCAAGAATGTGAGAGGATGAATATTCTCATTCGGGAAATACGTATA
TCACTTGAACAACTGGACCTTAGTTTGAAGGGGGAATTGGCATTATCTCCTGCTGTGGAAGCCCAGCAGTTTGCATTGAGTTATGACACG
GTACCAGACACTTGGAGCAAACTGGCTTATCCTTCTACTTATGGCCTAGCCCAGTGGTTCAATGACCTCCTCCTGCGATGCCGAGAACTC
GATACTTGGACACAAGACCTTACCCTTCCGGCTGTCGTGTGGCTCTCCGGCTTCTTCAACCCTCAGTCCTTCTTAACTGCAATCATGCAG
ACGATGGCTCGAAAAAATGAGTGGCCCCTGGATAAAACGCGCTTGACTGCTGATGTTACCAAAAAAACAAAGGAAGATTATGGACACCCG
CCAAGGGAAGGTGCATACCTCCACGGACTCTTCATGGAGGGCGCCCGCTGGGACACCCAAGCAGGAACCATTGTTGAAGCCCGTCTCAAG
GAGCTGGCATGCCCTATGCCGGTCATCTTTGCAAAAGCCACCCCCGTGGACAGACAAGAAACCAAACAGACCTACGAGTGCCCTGTGTAT
AGAACCAAACTGAGAGGCCCCAGCTACATCTGGACCTTCAGGCTGAAGAGCGAAGAGAAGACTGCAAAATGGGTTCTGGCTGGAGTGGCT

>In-frame_KMT2C_ENST00000262189_chr7_152007051_-_DNAH11_ENST00000328843_chr7_21856085_+_4068nt
ATGTCGTCGGAGGAGGACAAGAGCGTGGAGCAGCCGCAGCCGCCGCCACCACCCCCCGAGGAGCCTGGAGCCCCGGCCCCGAGCCCCGCA
GCCGCAGACAAAAGACCTCGGGGCCGGCCTCGCAAAGATGGCGCTTCCCCTTTCCAGAGAGCCAGAAAGAAACCTCGAAGTAGGGGGAAA
ACTGCAGTGGAAGATGAGGACAGCATGGATGGGCTGGAGACAACAGAAACAGAAACGATTGTGGAAACAGAAATCAAAGAACAATCTGCA
GAAGAGGATGCTGAAGCAGAAGTGGATAACAGCAAACAGCTAATTCCAACTCTTCAGCGATCTGTGTCTGAGGAATCGGCAAACTCCCTG
GTCTCTGTTGGTGTAGAAGCCAAAATCAGTGAACAGCTCTGCGCTTTTTGTTACTGTGGGGAAAAAAGTTCCTTAGGACAAGGAGACTTA
AAACAATTCAGAATAACGCCTGGATTTATCTTGCCATGGAGAAACCAACCTTCTAACAAGAAGGACATTGATGACAACAGCAATGGAACC
TATGAGAAAATGCAAAACTCAGCACCACGAAAACAAAGAGGACAGAGAAAAGAACGATCTCCTCAGCAGAATATAGTATCTTGTGTAAGT
GTAAGCACCCAGACAGCTTCAGATGATCAAGCTGGTAAACTGTGGGATGAACTCAGTCTGGTTGGGCTTCCAGATGCCATTGATATCCAA
GCCTTATTTGATTCTACAGGCACTTGTTGGGCTCATCACCGTTGTGTGGAGTGGTCACTAGGAGTATGCCAGATGGAAGAACCATTGTTA
GTGAACGTGGACAAAGCTGTTGTCTCAGGGAGCACAGAAGTTTCCATTCCACTAACCGAAGGCCTGGACTTGATATCCATGTTGACGGAT
GATGCTACAATTGCCGCCTGGAATAACGAAGGACTGCCCAGTGACAGAATGTCCACCGAAAATGCCGCTATCCTAACACACTGTGAGCGC
TGGCCTCTGGTGATAGATCCCCAGCAACAGGGAATTAAGTGGATCAAGAATAAGTATGGAATGGACCTGAAAGTCACACATTTGGGCCAG
AAAGGGTTTTTGAATGCCATTGAAACTGCTTTGGCCTTTGGTGATGTCATCTTAATTGAAAATCTCGAGGAAACGATAGATCCAGTCCTG
GATCCACTACTTGGCAGGAACACAATTAAAAAAGGAAAGTATATCAGGATTGGAGATAAAGAATGTGAATTTAACAAGAACTTTCGCCTT
ATCCTTCACACAAAATTGGCAAATCCTCACTATAAGCCGGAATTACAAGCTCAGACAACTCTCCTCAATTTCACAGTCACAGAAGATGGT
CTAGAAGCCCAGCTGCTGGCAGAGGTTGTCAGTATTGAAAGGCCAGATTTGGAGAAACTTAAGTTGGTATTGACAAAGCACCAAAATGAT
TTTAAAATTGAGCTCAAGTATCTGGAAGACGATCTCCTTTTGCGCCTTTCTGCGGCAGAGGGAAGCTTTCTGGATGACACCAAACTGGTA
GAGAGATTGGAGGCAACAAAGACCACCGTGGCAGAGATAGAGCACAAGGTGATTGAAGCCAAAGAAAATGAAAGAAAAATCAACGAGGCC
CGAGAATGTTACAGACCAGTGGCAGCAAGAGCATCTCTTCTTTATTTTGTTATTAATGACCTCCAAAAAATCAACCCCCTCTACCAATTC
TCTTTGAAGGCTTTTAACGTGCTGTTCCACAGAGCGATCGAGCAGGCTGACAAGGTGGAAGACATGCAGGGACGCATCTCTATCCTGATG
GAGAGCATCACCCATGCTGTCTTCCTCTACACCAGCCAGGCGCTGTTTGAGAAGGACAAGCTCACCTTCCTGTCCCAGATGGCTTTTCAG
ATTTTGTTGAGAAAGAAAGAGATAGACCCTCTTGAATTGGATTTCCTGCTTCGATTCACAGTTGAACACACTCATCTGAGTCCCGTTGAC
TTCCTAACTTCTCAGTCATGGAGTGCTATCAAGGCAATTGCCGTCATGGAAGAATTTCGAGGCATAGACCGAGATGTGGAAGGATCTGCC
AAGCAGTGGAGGAAGTGGGTAGAATCCGAGTGTCCAGAAAAAGAAAAATTACCTCAAGAATGGAAGAAGAAAAGTTTAATACAGAAGCTG
ATTCTTCTGAGAGCAATGCGCCCTGACAGAATGACGTATGCTCTCAGAAATTTTGTAGAGGAAAAACTGGGTGCGAAGTATGTGGAGAGG
ACCAGATTGGACTTAGTTAAAGCATTCGAAGAAAGCAGCCCAGCCACCCCCATATTCTTCATCCTGTCTCCGGGGGTAGATGCCCTTAAA
GACCTGGAGATTCTTGGCAAAAGACTTGGCTTTACAATTGACTCTGGAAAATTCCACAATGTGTCTTTAGGACAAGGTCAGGAGACGGTG
GCAGAAGTGGCCCTGGAGAAAGCTTCCAAAGGAGGACACTGGGTCATCCTCCAAAATGTTCATTTGGTAGCCAAGTGGCTAGGAACCTTG
GAGAAGCTCCTTGAAAGATTCAGCCAAGGAAGCCACAGAGATTACAGGGTTTTCATGAGTGCTGAGTCTGCACCTACACCAGATGAGCAT
ATCATCCCTCAAGGACTCCTGGAAAATTCCATTAAGATCACTAATGAACCCCCAACAGGGATGCTGGCCAATTTGCATGCCGCCCTGTAC
AACTTTGATCAGGATACACTTGAAATATGCTCCAAGGAGCAGGAGTTTAAAAGCATCCTTTTTTCTCTCTGCTACTTCCACGCCTGTGTT
GCTGGGAGACTGAGGTTTGGCCCCCAGGGCTGGAGCCGAAGCTATCCTTTTAATCCTGGAGACCTCACCATTTGTGCCAGTGTCCTCTAC
AACTACTTAGAGGCAAACTCTAAAGTCCCATGGGAAGATCTCCGTTATCTCTTTGGTGAGATCATGTATGGAGGCCACATCACAGATGAC
TGGGATCGCAAACTGTGTCGGGTGTATTTAGAAGAATTCATGAATCCATCTCTGACTGAAGATGAACTGATGCTGGCACCAGGTTTTGCT
GCCCCACCCTACCTAGATTATGCAGGCTACCACCAGTACATAGAGGAGATGCTTCCTCCAGAAAGCCCGGCACTGTATGGCCTCCACCCA
AATGCTGAAATAGAATTCCTGACAGTGACATCCAACACTCTCTTCAGAACTTTGCTGGAGATGCAGCCCAGGAATGCACTCAGTGGTGAT
GAACTGGGGCAGTCTACAGAAGAAAAGGTTAAGAATGTCTTGGATGACATTTTGGAGAAACTTCCAGAAGAGTTCAACATGGCAGAGATA
ATGCAAAAAAATTCAAATAGAAGCCCATATGTTCTTGTTTGCTTCCAAGAATGTGAGAGGATGAATATTCTCATTCGGGAAATACGTATA
TCACTTGAACAACTGGACCTTAGTTTGAAGGGGGAATTGGCATTATCTCCTGCTGTGGAAGCCCAGCAGTTTGCATTGAGTTATGACACG
GTACCAGACACTTGGAGCAAACTGGCTTATCCTTCTACTTATGGCCTAGCCCAGTGGTTCAATGACCTCCTCCTGCGATGCCGAGAACTC
GATACTTGGACACAAGACCTTACCCTTCCGGCTGTCGTGTGGCTCTCCGGCTTCTTCAACCCTCAGTCCTTCTTAACTGCAATCATGCAG
ACGATGGCTCGAAAAAATGAGTGGCCCCTGGATAAAACGCGCTTGACTGCTGATGTTACCAAAAAAACAAAGGAAGATTATGGACACCCG
CCAAGGGAAGGTGCATACCTCCACGGACTCTTCATGGAGGGCGCCCGCTGGGACACCCAAGCAGGAACCATTGTTGAAGCCCGTCTCAAG
GAGCTGGCATGCCCTATGCCGGTCATCTTTGCAAAAGCCACCCCCGTGGACAGACAAGAAACCAAACAGACCTACGAGTGCCCTGTGTAT
AGAACCAAACTGAGAGGCCCCAGCTACATCTGGACCTTCAGGCTGAAGAGCGAAGAGAAGACTGCAAAATGGGTTCTGGCTGGAGTGGCT

>In-frame_KMT2C_ENST00000355193_chr7_152007051_-_DNAH11_ENST00000409508_chr7_21856085_+_4068nt
ATGTCGTCGGAGGAGGACAAGAGCGTGGAGCAGCCGCAGCCGCCGCCACCACCCCCCGAGGAGCCTGGAGCCCCGGCCCCGAGCCCCGCA
GCCGCAGACAAAAGACCTCGGGGCCGGCCTCGCAAAGATGGCGCTTCCCCTTTCCAGAGAGCCAGAAAGAAACCTCGAAGTAGGGGGAAA
ACTGCAGTGGAAGATGAGGACAGCATGGATGGGCTGGAGACAACAGAAACAGAAACGATTGTGGAAACAGAAATCAAAGAACAATCTGCA
GAAGAGGATGCTGAAGCAGAAGTGGATAACAGCAAACAGCTAATTCCAACTCTTCAGCGATCTGTGTCTGAGGAATCGGCAAACTCCCTG
GTCTCTGTTGGTGTAGAAGCCAAAATCAGTGAACAGCTCTGCGCTTTTTGTTACTGTGGGGAAAAAAGTTCCTTAGGACAAGGAGACTTA
AAACAATTCAGAATAACGCCTGGATTTATCTTGCCATGGAGAAACCAACCTTCTAACAAGAAGGACATTGATGACAACAGCAATGGAACC
TATGAGAAAATGCAAAACTCAGCACCACGAAAACAAAGAGGACAGAGAAAAGAACGATCTCCTCAGCAGAATATAGTATCTTGTGTAAGT
GTAAGCACCCAGACAGCTTCAGATGATCAAGCTGGTAAACTGTGGGATGAACTCAGTCTGGTTGGGCTTCCAGATGCCATTGATATCCAA
GCCTTATTTGATTCTACAGGCACTTGTTGGGCTCATCACCGTTGTGTGGAGTGGTCACTAGGAGTATGCCAGATGGAAGAACCATTGTTA
GTGAACGTGGACAAAGCTGTTGTCTCAGGGAGCACAGAAGTTTCCATTCCACTAACCGAAGGCCTGGACTTGATATCCATGTTGACGGAT
GATGCTACAATTGCCGCCTGGAATAACGAAGGACTGCCCAGTGACAGAATGTCCACCGAAAATGCCGCTATCCTAACACACTGTGAGCGC
TGGCCTCTGGTGATAGATCCCCAGCAACAGGGAATTAAGTGGATCAAGAATAAGTATGGAATGGACCTGAAAGTCACACATTTGGGCCAG
AAAGGGTTTTTGAATGCCATTGAAACTGCTTTGGCCTTTGGTGATGTCATCTTAATTGAAAATCTCGAGGAAACGATAGATCCAGTCCTG
GATCCACTACTTGGCAGGAACACAATTAAAAAAGGAAAGTATATCAGGATTGGAGATAAAGAATGTGAATTTAACAAGAACTTTCGCCTT
ATCCTTCACACAAAATTGGCAAATCCTCACTATAAGCCGGAATTACAAGCTCAGACAACTCTCCTCAATTTCACAGTCACAGAAGATGGT
CTAGAAGCCCAGCTGCTGGCAGAGGTTGTCAGTATTGAAAGGCCAGATTTGGAGAAACTTAAGTTGGTATTGACAAAGCACCAAAATGAT
TTTAAAATTGAGCTCAAGTATCTGGAAGACGATCTCCTTTTGCGCCTTTCTGCGGCAGAGGGAAGCTTTCTGGATGACACCAAACTGGTA
GAGAGATTGGAGGCAACAAAGACCACCGTGGCAGAGATAGAGCACAAGGTGATTGAAGCCAAAGAAAATGAAAGAAAAATCAACGAGGCC
CGAGAATGTTACAGACCAGTGGCAGCAAGAGCATCTCTTCTTTATTTTGTTATTAATGACCTCCAAAAAATCAACCCCCTCTACCAATTC
TCTTTGAAGGCTTTTAACGTGCTGTTCCACAGAGCGATCGAGCAGGCTGACAAGGTGGAAGACATGCAGGGACGCATCTCTATCCTGATG
GAGAGCATCACCCATGCTGTCTTCCTCTACACCAGCCAGGCGCTGTTTGAGAAGGACAAGCTCACCTTCCTGTCCCAGATGGCTTTTCAG
ATTTTGTTGAGAAAGAAAGAGATAGACCCTCTTGAATTGGATTTCCTGCTTCGATTCACAGTTGAACACACTCATCTGAGTCCCGTTGAC
TTCCTAACTTCTCAGTCATGGAGTGCTATCAAGGCAATTGCCGTCATGGAAGAATTTCGAGGCATAGACCGAGATGTGGAAGGATCTGCC
AAGCAGTGGAGGAAGTGGGTAGAATCCGAGTGTCCAGAAAAAGAAAAATTACCTCAAGAATGGAAGAAGAAAAGTTTAATACAGAAGCTG
ATTCTTCTGAGAGCAATGCGCCCTGACAGAATGACGTATGCTCTCAGAAATTTTGTAGAGGAAAAACTGGGTGCGAAGTATGTGGAGAGG
ACCAGATTGGACTTAGTTAAAGCATTCGAAGAAAGCAGCCCAGCCACCCCCATATTCTTCATCCTGTCTCCGGGGGTAGATGCCCTTAAA
GACCTGGAGATTCTTGGCAAAAGACTTGGCTTTACAATTGACTCTGGAAAATTCCACAATGTGTCTTTAGGACAAGGTCAGGAGACGGTG
GCAGAAGTGGCCCTGGAGAAAGCTTCCAAAGGAGGACACTGGGTCATCCTCCAAAATGTTCATTTGGTAGCCAAGTGGCTAGGAACCTTG
GAGAAGCTCCTTGAAAGATTCAGCCAAGGAAGCCACAGAGATTACAGGGTTTTCATGAGTGCTGAGTCTGCACCTACACCAGATGAGCAT
ATCATCCCTCAAGGACTCCTGGAAAATTCCATTAAGATCACTAATGAACCCCCAACAGGGATGCTGGCCAATTTGCATGCCGCCCTGTAC
AACTTTGATCAGGATACACTTGAAATATGCTCCAAGGAGCAGGAGTTTAAAAGCATCCTTTTTTCTCTCTGCTACTTCCACGCCTGTGTT
GCTGGGAGACTGAGGTTTGGCCCCCAGGGCTGGAGCCGAAGCTATCCTTTTAATCCTGGAGACCTCACCATTTGTGCCAGTGTCCTCTAC
AACTACTTAGAGGCAAACTCTAAAGTCCCATGGGAAGATCTCCGTTATCTCTTTGGTGAGATCATGTATGGAGGCCACATCACAGATGAC
TGGGATCGCAAACTGTGTCGGGTGTATTTAGAAGAATTCATGAATCCATCTCTGACTGAAGATGAACTGATGCTGGCACCAGGTTTTGCT
GCCCCACCCTACCTAGATTATGCAGGCTACCACCAGTACATAGAGGAGATGCTTCCTCCAGAAAGCCCGGCACTGTATGGCCTCCACCCA
AATGCTGAAATAGAATTCCTGACAGTGACATCCAACACTCTCTTCAGAACTTTGCTGGAGATGCAGCCCAGGAATGCACTCAGTGGTGAT
GAACTGGGGCAGTCTACAGAAGAAAAGGTTAAGAATGTCTTGGATGACATTTTGGAGAAACTTCCAGAAGAGTTCAACATGGCAGAGATA
ATGCAAAAAAATTCAAATAGAAGCCCATATGTTCTTGTTTGCTTCCAAGAATGTGAGAGGATGAATATTCTCATTCGGGAAATACGTATA
TCACTTGAACAACTGGACCTTAGTTTGAAGGGGGAATTGGCATTATCTCCTGCTGTGGAAGCCCAGCAGTTTGCATTGAGTTATGACACG
GTACCAGACACTTGGAGCAAACTGGCTTATCCTTCTACTTATGGCCTAGCCCAGTGGTTCAATGACCTCCTCCTGCGATGCCGAGAACTC
GATACTTGGACACAAGACCTTACCCTTCCGGCTGTCGTGTGGCTCTCCGGCTTCTTCAACCCTCAGTCCTTCTTAACTGCAATCATGCAG
ACGATGGCTCGAAAAAATGAGTGGCCCCTGGATAAAACGCGCTTGACTGCTGATGTTACCAAAAAAACAAAGGAAGATTATGGACACCCG
CCAAGGGAAGGTGCATACCTCCACGGACTCTTCATGGAGGGCGCCCGCTGGGACACCCAAGCAGGAACCATTGTTGAAGCCCGTCTCAAG
GAGCTGGCATGCCCTATGCCGGTCATCTTTGCAAAAGCCACCCCCGTGGACAGACAAGAAACCAAACAGACCTACGAGTGCCCTGTGTAT
AGAACCAAACTGAGAGGCCCCAGCTACATCTGGACCTTCAGGCTGAAGAGCGAAGAGAAGACTGCAAAATGGGTTCTGGCTGGAGTGGCT

>In-frame_KMT2C_ENST00000355193_chr7_152007051_-_DNAH11_ENST00000328843_chr7_21856085_+_4068nt
ATGTCGTCGGAGGAGGACAAGAGCGTGGAGCAGCCGCAGCCGCCGCCACCACCCCCCGAGGAGCCTGGAGCCCCGGCCCCGAGCCCCGCA
GCCGCAGACAAAAGACCTCGGGGCCGGCCTCGCAAAGATGGCGCTTCCCCTTTCCAGAGAGCCAGAAAGAAACCTCGAAGTAGGGGGAAA
ACTGCAGTGGAAGATGAGGACAGCATGGATGGGCTGGAGACAACAGAAACAGAAACGATTGTGGAAACAGAAATCAAAGAACAATCTGCA
GAAGAGGATGCTGAAGCAGAAGTGGATAACAGCAAACAGCTAATTCCAACTCTTCAGCGATCTGTGTCTGAGGAATCGGCAAACTCCCTG
GTCTCTGTTGGTGTAGAAGCCAAAATCAGTGAACAGCTCTGCGCTTTTTGTTACTGTGGGGAAAAAAGTTCCTTAGGACAAGGAGACTTA
AAACAATTCAGAATAACGCCTGGATTTATCTTGCCATGGAGAAACCAACCTTCTAACAAGAAGGACATTGATGACAACAGCAATGGAACC
TATGAGAAAATGCAAAACTCAGCACCACGAAAACAAAGAGGACAGAGAAAAGAACGATCTCCTCAGCAGAATATAGTATCTTGTGTAAGT
GTAAGCACCCAGACAGCTTCAGATGATCAAGCTGGTAAACTGTGGGATGAACTCAGTCTGGTTGGGCTTCCAGATGCCATTGATATCCAA
GCCTTATTTGATTCTACAGGCACTTGTTGGGCTCATCACCGTTGTGTGGAGTGGTCACTAGGAGTATGCCAGATGGAAGAACCATTGTTA
GTGAACGTGGACAAAGCTGTTGTCTCAGGGAGCACAGAAGTTTCCATTCCACTAACCGAAGGCCTGGACTTGATATCCATGTTGACGGAT
GATGCTACAATTGCCGCCTGGAATAACGAAGGACTGCCCAGTGACAGAATGTCCACCGAAAATGCCGCTATCCTAACACACTGTGAGCGC
TGGCCTCTGGTGATAGATCCCCAGCAACAGGGAATTAAGTGGATCAAGAATAAGTATGGAATGGACCTGAAAGTCACACATTTGGGCCAG
AAAGGGTTTTTGAATGCCATTGAAACTGCTTTGGCCTTTGGTGATGTCATCTTAATTGAAAATCTCGAGGAAACGATAGATCCAGTCCTG
GATCCACTACTTGGCAGGAACACAATTAAAAAAGGAAAGTATATCAGGATTGGAGATAAAGAATGTGAATTTAACAAGAACTTTCGCCTT
ATCCTTCACACAAAATTGGCAAATCCTCACTATAAGCCGGAATTACAAGCTCAGACAACTCTCCTCAATTTCACAGTCACAGAAGATGGT
CTAGAAGCCCAGCTGCTGGCAGAGGTTGTCAGTATTGAAAGGCCAGATTTGGAGAAACTTAAGTTGGTATTGACAAAGCACCAAAATGAT
TTTAAAATTGAGCTCAAGTATCTGGAAGACGATCTCCTTTTGCGCCTTTCTGCGGCAGAGGGAAGCTTTCTGGATGACACCAAACTGGTA
GAGAGATTGGAGGCAACAAAGACCACCGTGGCAGAGATAGAGCACAAGGTGATTGAAGCCAAAGAAAATGAAAGAAAAATCAACGAGGCC
CGAGAATGTTACAGACCAGTGGCAGCAAGAGCATCTCTTCTTTATTTTGTTATTAATGACCTCCAAAAAATCAACCCCCTCTACCAATTC
TCTTTGAAGGCTTTTAACGTGCTGTTCCACAGAGCGATCGAGCAGGCTGACAAGGTGGAAGACATGCAGGGACGCATCTCTATCCTGATG
GAGAGCATCACCCATGCTGTCTTCCTCTACACCAGCCAGGCGCTGTTTGAGAAGGACAAGCTCACCTTCCTGTCCCAGATGGCTTTTCAG
ATTTTGTTGAGAAAGAAAGAGATAGACCCTCTTGAATTGGATTTCCTGCTTCGATTCACAGTTGAACACACTCATCTGAGTCCCGTTGAC
TTCCTAACTTCTCAGTCATGGAGTGCTATCAAGGCAATTGCCGTCATGGAAGAATTTCGAGGCATAGACCGAGATGTGGAAGGATCTGCC
AAGCAGTGGAGGAAGTGGGTAGAATCCGAGTGTCCAGAAAAAGAAAAATTACCTCAAGAATGGAAGAAGAAAAGTTTAATACAGAAGCTG
ATTCTTCTGAGAGCAATGCGCCCTGACAGAATGACGTATGCTCTCAGAAATTTTGTAGAGGAAAAACTGGGTGCGAAGTATGTGGAGAGG
ACCAGATTGGACTTAGTTAAAGCATTCGAAGAAAGCAGCCCAGCCACCCCCATATTCTTCATCCTGTCTCCGGGGGTAGATGCCCTTAAA
GACCTGGAGATTCTTGGCAAAAGACTTGGCTTTACAATTGACTCTGGAAAATTCCACAATGTGTCTTTAGGACAAGGTCAGGAGACGGTG
GCAGAAGTGGCCCTGGAGAAAGCTTCCAAAGGAGGACACTGGGTCATCCTCCAAAATGTTCATTTGGTAGCCAAGTGGCTAGGAACCTTG
GAGAAGCTCCTTGAAAGATTCAGCCAAGGAAGCCACAGAGATTACAGGGTTTTCATGAGTGCTGAGTCTGCACCTACACCAGATGAGCAT
ATCATCCCTCAAGGACTCCTGGAAAATTCCATTAAGATCACTAATGAACCCCCAACAGGGATGCTGGCCAATTTGCATGCCGCCCTGTAC
AACTTTGATCAGGATACACTTGAAATATGCTCCAAGGAGCAGGAGTTTAAAAGCATCCTTTTTTCTCTCTGCTACTTCCACGCCTGTGTT
GCTGGGAGACTGAGGTTTGGCCCCCAGGGCTGGAGCCGAAGCTATCCTTTTAATCCTGGAGACCTCACCATTTGTGCCAGTGTCCTCTAC
AACTACTTAGAGGCAAACTCTAAAGTCCCATGGGAAGATCTCCGTTATCTCTTTGGTGAGATCATGTATGGAGGCCACATCACAGATGAC
TGGGATCGCAAACTGTGTCGGGTGTATTTAGAAGAATTCATGAATCCATCTCTGACTGAAGATGAACTGATGCTGGCACCAGGTTTTGCT
GCCCCACCCTACCTAGATTATGCAGGCTACCACCAGTACATAGAGGAGATGCTTCCTCCAGAAAGCCCGGCACTGTATGGCCTCCACCCA
AATGCTGAAATAGAATTCCTGACAGTGACATCCAACACTCTCTTCAGAACTTTGCTGGAGATGCAGCCCAGGAATGCACTCAGTGGTGAT
GAACTGGGGCAGTCTACAGAAGAAAAGGTTAAGAATGTCTTGGATGACATTTTGGAGAAACTTCCAGAAGAGTTCAACATGGCAGAGATA
ATGCAAAAAAATTCAAATAGAAGCCCATATGTTCTTGTTTGCTTCCAAGAATGTGAGAGGATGAATATTCTCATTCGGGAAATACGTATA
TCACTTGAACAACTGGACCTTAGTTTGAAGGGGGAATTGGCATTATCTCCTGCTGTGGAAGCCCAGCAGTTTGCATTGAGTTATGACACG
GTACCAGACACTTGGAGCAAACTGGCTTATCCTTCTACTTATGGCCTAGCCCAGTGGTTCAATGACCTCCTCCTGCGATGCCGAGAACTC
GATACTTGGACACAAGACCTTACCCTTCCGGCTGTCGTGTGGCTCTCCGGCTTCTTCAACCCTCAGTCCTTCTTAACTGCAATCATGCAG
ACGATGGCTCGAAAAAATGAGTGGCCCCTGGATAAAACGCGCTTGACTGCTGATGTTACCAAAAAAACAAAGGAAGATTATGGACACCCG
CCAAGGGAAGGTGCATACCTCCACGGACTCTTCATGGAGGGCGCCCGCTGGGACACCCAAGCAGGAACCATTGTTGAAGCCCGTCTCAAG
GAGCTGGCATGCCCTATGCCGGTCATCTTTGCAAAAGCCACCCCCGTGGACAGACAAGAAACCAAACAGACCTACGAGTGCCCTGTGTAT
AGAACCAAACTGAGAGGCCCCAGCTACATCTGGACCTTCAGGCTGAAGAGCGAAGAGAAGACTGCAAAATGGGTTCTGGCTGGAGTGGCT


* Fusion transcript sequences (Full-length transcript).
>In-frame_KMT2C_ENST00000262189_chr7_152007051_-_DNAH11_ENST00000409508_chr7_21856085_+_4872nt
GAGGTGCGCGCGCCCGCGCCGATGTGTGTGAGTGCGTGTCCTGCTCGCTCCATGTTGCCGCCTCTCCCGGTACCTGCTGCTGCTCCCGGG
GCTGCGGGAAATGCGAGAGGCTGAGCCGGGGAGGAGGAACCCGAGCAGCAGCGGCGGCGGCGGCGGCCGCGGCGGCGGGAGCCCCCCAGG
AGGAGGACCGGGATCCATGTGTCTTTCCTGGTGACTAGGATGTCGTCGGAGGAGGACAAGAGCGTGGAGCAGCCGCAGCCGCCGCCACCA
CCCCCCGAGGAGCCTGGAGCCCCGGCCCCGAGCCCCGCAGCCGCAGACAAAAGACCTCGGGGCCGGCCTCGCAAAGATGGCGCTTCCCCT
TTCCAGAGAGCCAGAAAGAAACCTCGAAGTAGGGGGAAAACTGCAGTGGAAGATGAGGACAGCATGGATGGGCTGGAGACAACAGAAACA
GAAACGATTGTGGAAACAGAAATCAAAGAACAATCTGCAGAAGAGGATGCTGAAGCAGAAGTGGATAACAGCAAACAGCTAATTCCAACT
CTTCAGCGATCTGTGTCTGAGGAATCGGCAAACTCCCTGGTCTCTGTTGGTGTAGAAGCCAAAATCAGTGAACAGCTCTGCGCTTTTTGT
TACTGTGGGGAAAAAAGTTCCTTAGGACAAGGAGACTTAAAACAATTCAGAATAACGCCTGGATTTATCTTGCCATGGAGAAACCAACCT
TCTAACAAGAAGGACATTGATGACAACAGCAATGGAACCTATGAGAAAATGCAAAACTCAGCACCACGAAAACAAAGAGGACAGAGAAAA
GAACGATCTCCTCAGCAGAATATAGTATCTTGTGTAAGTGTAAGCACCCAGACAGCTTCAGATGATCAAGCTGGTAAACTGTGGGATGAA
CTCAGTCTGGTTGGGCTTCCAGATGCCATTGATATCCAAGCCTTATTTGATTCTACAGGCACTTGTTGGGCTCATCACCGTTGTGTGGAG
TGGTCACTAGGAGTATGCCAGATGGAAGAACCATTGTTAGTGAACGTGGACAAAGCTGTTGTCTCAGGGAGCACAGAAGTTTCCATTCCA
CTAACCGAAGGCCTGGACTTGATATCCATGTTGACGGATGATGCTACAATTGCCGCCTGGAATAACGAAGGACTGCCCAGTGACAGAATG
TCCACCGAAAATGCCGCTATCCTAACACACTGTGAGCGCTGGCCTCTGGTGATAGATCCCCAGCAACAGGGAATTAAGTGGATCAAGAAT
AAGTATGGAATGGACCTGAAAGTCACACATTTGGGCCAGAAAGGGTTTTTGAATGCCATTGAAACTGCTTTGGCCTTTGGTGATGTCATC
TTAATTGAAAATCTCGAGGAAACGATAGATCCAGTCCTGGATCCACTACTTGGCAGGAACACAATTAAAAAAGGAAAGTATATCAGGATT
GGAGATAAAGAATGTGAATTTAACAAGAACTTTCGCCTTATCCTTCACACAAAATTGGCAAATCCTCACTATAAGCCGGAATTACAAGCT
CAGACAACTCTCCTCAATTTCACAGTCACAGAAGATGGTCTAGAAGCCCAGCTGCTGGCAGAGGTTGTCAGTATTGAAAGGCCAGATTTG
GAGAAACTTAAGTTGGTATTGACAAAGCACCAAAATGATTTTAAAATTGAGCTCAAGTATCTGGAAGACGATCTCCTTTTGCGCCTTTCT
GCGGCAGAGGGAAGCTTTCTGGATGACACCAAACTGGTAGAGAGATTGGAGGCAACAAAGACCACCGTGGCAGAGATAGAGCACAAGGTG
ATTGAAGCCAAAGAAAATGAAAGAAAAATCAACGAGGCCCGAGAATGTTACAGACCAGTGGCAGCAAGAGCATCTCTTCTTTATTTTGTT
ATTAATGACCTCCAAAAAATCAACCCCCTCTACCAATTCTCTTTGAAGGCTTTTAACGTGCTGTTCCACAGAGCGATCGAGCAGGCTGAC
AAGGTGGAAGACATGCAGGGACGCATCTCTATCCTGATGGAGAGCATCACCCATGCTGTCTTCCTCTACACCAGCCAGGCGCTGTTTGAG
AAGGACAAGCTCACCTTCCTGTCCCAGATGGCTTTTCAGATTTTGTTGAGAAAGAAAGAGATAGACCCTCTTGAATTGGATTTCCTGCTT
CGATTCACAGTTGAACACACTCATCTGAGTCCCGTTGACTTCCTAACTTCTCAGTCATGGAGTGCTATCAAGGCAATTGCCGTCATGGAA
GAATTTCGAGGCATAGACCGAGATGTGGAAGGATCTGCCAAGCAGTGGAGGAAGTGGGTAGAATCCGAGTGTCCAGAAAAAGAAAAATTA
CCTCAAGAATGGAAGAAGAAAAGTTTAATACAGAAGCTGATTCTTCTGAGAGCAATGCGCCCTGACAGAATGACGTATGCTCTCAGAAAT
TTTGTAGAGGAAAAACTGGGTGCGAAGTATGTGGAGAGGACCAGATTGGACTTAGTTAAAGCATTCGAAGAAAGCAGCCCAGCCACCCCC
ATATTCTTCATCCTGTCTCCGGGGGTAGATGCCCTTAAAGACCTGGAGATTCTTGGCAAAAGACTTGGCTTTACAATTGACTCTGGAAAA
TTCCACAATGTGTCTTTAGGACAAGGTCAGGAGACGGTGGCAGAAGTGGCCCTGGAGAAAGCTTCCAAAGGAGGACACTGGGTCATCCTC
CAAAATGTTCATTTGGTAGCCAAGTGGCTAGGAACCTTGGAGAAGCTCCTTGAAAGATTCAGCCAAGGAAGCCACAGAGATTACAGGGTT
TTCATGAGTGCTGAGTCTGCACCTACACCAGATGAGCATATCATCCCTCAAGGACTCCTGGAAAATTCCATTAAGATCACTAATGAACCC
CCAACAGGGATGCTGGCCAATTTGCATGCCGCCCTGTACAACTTTGATCAGGATACACTTGAAATATGCTCCAAGGAGCAGGAGTTTAAA
AGCATCCTTTTTTCTCTCTGCTACTTCCACGCCTGTGTTGCTGGGAGACTGAGGTTTGGCCCCCAGGGCTGGAGCCGAAGCTATCCTTTT
AATCCTGGAGACCTCACCATTTGTGCCAGTGTCCTCTACAACTACTTAGAGGCAAACTCTAAAGTCCCATGGGAAGATCTCCGTTATCTC
TTTGGTGAGATCATGTATGGAGGCCACATCACAGATGACTGGGATCGCAAACTGTGTCGGGTGTATTTAGAAGAATTCATGAATCCATCT
CTGACTGAAGATGAACTGATGCTGGCACCAGGTTTTGCTGCCCCACCCTACCTAGATTATGCAGGCTACCACCAGTACATAGAGGAGATG
CTTCCTCCAGAAAGCCCGGCACTGTATGGCCTCCACCCAAATGCTGAAATAGAATTCCTGACAGTGACATCCAACACTCTCTTCAGAACT
TTGCTGGAGATGCAGCCCAGGAATGCACTCAGTGGTGATGAACTGGGGCAGTCTACAGAAGAAAAGGTTAAGAATGTCTTGGATGACATT
TTGGAGAAACTTCCAGAAGAGTTCAACATGGCAGAGATAATGCAAAAAAATTCAAATAGAAGCCCATATGTTCTTGTTTGCTTCCAAGAA
TGTGAGAGGATGAATATTCTCATTCGGGAAATACGTATATCACTTGAACAACTGGACCTTAGTTTGAAGGGGGAATTGGCATTATCTCCT
GCTGTGGAAGCCCAGCAGTTTGCATTGAGTTATGACACGGTACCAGACACTTGGAGCAAACTGGCTTATCCTTCTACTTATGGCCTAGCC
CAGTGGTTCAATGACCTCCTCCTGCGATGCCGAGAACTCGATACTTGGACACAAGACCTTACCCTTCCGGCTGTCGTGTGGCTCTCCGGC
TTCTTCAACCCTCAGTCCTTCTTAACTGCAATCATGCAGACGATGGCTCGAAAAAATGAGTGGCCCCTGGATAAAACGCGCTTGACTGCT
GATGTTACCAAAAAAACAAAGGAAGATTATGGACACCCGCCAAGGGAAGGTGCATACCTCCACGGACTCTTCATGGAGGGCGCCCGCTGG
GACACCCAAGCAGGAACCATTGTTGAAGCCCGTCTCAAGGAGCTGGCATGCCCTATGCCGGTCATCTTTGCAAAAGCCACCCCCGTGGAC
AGACAAGAAACCAAACAGACCTACGAGTGCCCTGTGTATAGAACCAAACTGAGAGGCCCCAGCTACATCTGGACCTTCAGGCTGAAGAGC
GAAGAGAAGACTGCAAAATGGGTTCTGGCTGGAGTGGCTCTGCTTCTAGAAGCGTAAGGTAACACTGGCATTCCTCTAGCCTCTGCTGGA
GTGCAGTGAGGATTTTCTAGCATGTTGCTGCACTGTTCCCATGCACATTATTCTAACTTTTTAGTAACTCACACGTGCATTCTTTTTTCA
ACGCTATCCTTAGAGTGAAAGTCAGAAAAAAATACTAGAAACTAACTCAGGGCTGAGCGTGGTGGCACACGACTGTAATCCCAGTTACTC
AGGAGGTAGGAGAATCACTTGAACCTAGGAGGCAAAGGTTGCAGTGAGCCGAGGTTGCACCACTGCACTCCCTCCTGGGCAACAGAACAA
GACTCCATCTCAAAAAAAAAAAAGTACATCATAAAAGTACATCATATGTGAACATGCAAAAGCAATGCAGCCGGAAAGAACGGAGATTTT
AATTTTTAACAAACAACAAATTAAATTATTAGCCCTTAAACTCTTTCAAAATATAAAAGCAGCAGGCCCCAGGTGAGTCCTGAAGGAAGA
GGCTAGCACTCTGTAAGGCCTCCAGTGTCCAGTGTCTACAATGTTGATGGTCCCCTTTTGTTCAGTCAAGTTTTAATAAAAATAAAACTG

>In-frame_KMT2C_ENST00000262189_chr7_152007051_-_DNAH11_ENST00000328843_chr7_21856085_+_4872nt
GAGGTGCGCGCGCCCGCGCCGATGTGTGTGAGTGCGTGTCCTGCTCGCTCCATGTTGCCGCCTCTCCCGGTACCTGCTGCTGCTCCCGGG
GCTGCGGGAAATGCGAGAGGCTGAGCCGGGGAGGAGGAACCCGAGCAGCAGCGGCGGCGGCGGCGGCCGCGGCGGCGGGAGCCCCCCAGG
AGGAGGACCGGGATCCATGTGTCTTTCCTGGTGACTAGGATGTCGTCGGAGGAGGACAAGAGCGTGGAGCAGCCGCAGCCGCCGCCACCA
CCCCCCGAGGAGCCTGGAGCCCCGGCCCCGAGCCCCGCAGCCGCAGACAAAAGACCTCGGGGCCGGCCTCGCAAAGATGGCGCTTCCCCT
TTCCAGAGAGCCAGAAAGAAACCTCGAAGTAGGGGGAAAACTGCAGTGGAAGATGAGGACAGCATGGATGGGCTGGAGACAACAGAAACA
GAAACGATTGTGGAAACAGAAATCAAAGAACAATCTGCAGAAGAGGATGCTGAAGCAGAAGTGGATAACAGCAAACAGCTAATTCCAACT
CTTCAGCGATCTGTGTCTGAGGAATCGGCAAACTCCCTGGTCTCTGTTGGTGTAGAAGCCAAAATCAGTGAACAGCTCTGCGCTTTTTGT
TACTGTGGGGAAAAAAGTTCCTTAGGACAAGGAGACTTAAAACAATTCAGAATAACGCCTGGATTTATCTTGCCATGGAGAAACCAACCT
TCTAACAAGAAGGACATTGATGACAACAGCAATGGAACCTATGAGAAAATGCAAAACTCAGCACCACGAAAACAAAGAGGACAGAGAAAA
GAACGATCTCCTCAGCAGAATATAGTATCTTGTGTAAGTGTAAGCACCCAGACAGCTTCAGATGATCAAGCTGGTAAACTGTGGGATGAA
CTCAGTCTGGTTGGGCTTCCAGATGCCATTGATATCCAAGCCTTATTTGATTCTACAGGCACTTGTTGGGCTCATCACCGTTGTGTGGAG
TGGTCACTAGGAGTATGCCAGATGGAAGAACCATTGTTAGTGAACGTGGACAAAGCTGTTGTCTCAGGGAGCACAGAAGTTTCCATTCCA
CTAACCGAAGGCCTGGACTTGATATCCATGTTGACGGATGATGCTACAATTGCCGCCTGGAATAACGAAGGACTGCCCAGTGACAGAATG
TCCACCGAAAATGCCGCTATCCTAACACACTGTGAGCGCTGGCCTCTGGTGATAGATCCCCAGCAACAGGGAATTAAGTGGATCAAGAAT
AAGTATGGAATGGACCTGAAAGTCACACATTTGGGCCAGAAAGGGTTTTTGAATGCCATTGAAACTGCTTTGGCCTTTGGTGATGTCATC
TTAATTGAAAATCTCGAGGAAACGATAGATCCAGTCCTGGATCCACTACTTGGCAGGAACACAATTAAAAAAGGAAAGTATATCAGGATT
GGAGATAAAGAATGTGAATTTAACAAGAACTTTCGCCTTATCCTTCACACAAAATTGGCAAATCCTCACTATAAGCCGGAATTACAAGCT
CAGACAACTCTCCTCAATTTCACAGTCACAGAAGATGGTCTAGAAGCCCAGCTGCTGGCAGAGGTTGTCAGTATTGAAAGGCCAGATTTG
GAGAAACTTAAGTTGGTATTGACAAAGCACCAAAATGATTTTAAAATTGAGCTCAAGTATCTGGAAGACGATCTCCTTTTGCGCCTTTCT
GCGGCAGAGGGAAGCTTTCTGGATGACACCAAACTGGTAGAGAGATTGGAGGCAACAAAGACCACCGTGGCAGAGATAGAGCACAAGGTG
ATTGAAGCCAAAGAAAATGAAAGAAAAATCAACGAGGCCCGAGAATGTTACAGACCAGTGGCAGCAAGAGCATCTCTTCTTTATTTTGTT
ATTAATGACCTCCAAAAAATCAACCCCCTCTACCAATTCTCTTTGAAGGCTTTTAACGTGCTGTTCCACAGAGCGATCGAGCAGGCTGAC
AAGGTGGAAGACATGCAGGGACGCATCTCTATCCTGATGGAGAGCATCACCCATGCTGTCTTCCTCTACACCAGCCAGGCGCTGTTTGAG
AAGGACAAGCTCACCTTCCTGTCCCAGATGGCTTTTCAGATTTTGTTGAGAAAGAAAGAGATAGACCCTCTTGAATTGGATTTCCTGCTT
CGATTCACAGTTGAACACACTCATCTGAGTCCCGTTGACTTCCTAACTTCTCAGTCATGGAGTGCTATCAAGGCAATTGCCGTCATGGAA
GAATTTCGAGGCATAGACCGAGATGTGGAAGGATCTGCCAAGCAGTGGAGGAAGTGGGTAGAATCCGAGTGTCCAGAAAAAGAAAAATTA
CCTCAAGAATGGAAGAAGAAAAGTTTAATACAGAAGCTGATTCTTCTGAGAGCAATGCGCCCTGACAGAATGACGTATGCTCTCAGAAAT
TTTGTAGAGGAAAAACTGGGTGCGAAGTATGTGGAGAGGACCAGATTGGACTTAGTTAAAGCATTCGAAGAAAGCAGCCCAGCCACCCCC
ATATTCTTCATCCTGTCTCCGGGGGTAGATGCCCTTAAAGACCTGGAGATTCTTGGCAAAAGACTTGGCTTTACAATTGACTCTGGAAAA
TTCCACAATGTGTCTTTAGGACAAGGTCAGGAGACGGTGGCAGAAGTGGCCCTGGAGAAAGCTTCCAAAGGAGGACACTGGGTCATCCTC
CAAAATGTTCATTTGGTAGCCAAGTGGCTAGGAACCTTGGAGAAGCTCCTTGAAAGATTCAGCCAAGGAAGCCACAGAGATTACAGGGTT
TTCATGAGTGCTGAGTCTGCACCTACACCAGATGAGCATATCATCCCTCAAGGACTCCTGGAAAATTCCATTAAGATCACTAATGAACCC
CCAACAGGGATGCTGGCCAATTTGCATGCCGCCCTGTACAACTTTGATCAGGATACACTTGAAATATGCTCCAAGGAGCAGGAGTTTAAA
AGCATCCTTTTTTCTCTCTGCTACTTCCACGCCTGTGTTGCTGGGAGACTGAGGTTTGGCCCCCAGGGCTGGAGCCGAAGCTATCCTTTT
AATCCTGGAGACCTCACCATTTGTGCCAGTGTCCTCTACAACTACTTAGAGGCAAACTCTAAAGTCCCATGGGAAGATCTCCGTTATCTC
TTTGGTGAGATCATGTATGGAGGCCACATCACAGATGACTGGGATCGCAAACTGTGTCGGGTGTATTTAGAAGAATTCATGAATCCATCT
CTGACTGAAGATGAACTGATGCTGGCACCAGGTTTTGCTGCCCCACCCTACCTAGATTATGCAGGCTACCACCAGTACATAGAGGAGATG
CTTCCTCCAGAAAGCCCGGCACTGTATGGCCTCCACCCAAATGCTGAAATAGAATTCCTGACAGTGACATCCAACACTCTCTTCAGAACT
TTGCTGGAGATGCAGCCCAGGAATGCACTCAGTGGTGATGAACTGGGGCAGTCTACAGAAGAAAAGGTTAAGAATGTCTTGGATGACATT
TTGGAGAAACTTCCAGAAGAGTTCAACATGGCAGAGATAATGCAAAAAAATTCAAATAGAAGCCCATATGTTCTTGTTTGCTTCCAAGAA
TGTGAGAGGATGAATATTCTCATTCGGGAAATACGTATATCACTTGAACAACTGGACCTTAGTTTGAAGGGGGAATTGGCATTATCTCCT
GCTGTGGAAGCCCAGCAGTTTGCATTGAGTTATGACACGGTACCAGACACTTGGAGCAAACTGGCTTATCCTTCTACTTATGGCCTAGCC
CAGTGGTTCAATGACCTCCTCCTGCGATGCCGAGAACTCGATACTTGGACACAAGACCTTACCCTTCCGGCTGTCGTGTGGCTCTCCGGC
TTCTTCAACCCTCAGTCCTTCTTAACTGCAATCATGCAGACGATGGCTCGAAAAAATGAGTGGCCCCTGGATAAAACGCGCTTGACTGCT
GATGTTACCAAAAAAACAAAGGAAGATTATGGACACCCGCCAAGGGAAGGTGCATACCTCCACGGACTCTTCATGGAGGGCGCCCGCTGG
GACACCCAAGCAGGAACCATTGTTGAAGCCCGTCTCAAGGAGCTGGCATGCCCTATGCCGGTCATCTTTGCAAAAGCCACCCCCGTGGAC
AGACAAGAAACCAAACAGACCTACGAGTGCCCTGTGTATAGAACCAAACTGAGAGGCCCCAGCTACATCTGGACCTTCAGGCTGAAGAGC
GAAGAGAAGACTGCAAAATGGGTTCTGGCTGGAGTGGCTCTGCTTCTAGAAGCGTAAGGTAACACTGGCATTCCTCTAGCCTCTGCTGGA
GTGCAGTGAGGATTTTCTAGCATGTTGCTGCACTGTTCCCATGCACATTATTCTAACTTTTTAGTAACTCACACGTGCATTCTTTTTTCA
ACGCTATCCTTAGAGTGAAAGTCAGAAAAAAATACTAGAAACTAACTCAGGGCTGAGCGTGGTGGCACACGACTGTAATCCCAGTTACTC
AGGAGGTAGGAGAATCACTTGAACCTAGGAGGCAAAGGTTGCAGTGAGCCGAGGTTGCACCACTGCACTCCCTCCTGGGCAACAGAACAA
GACTCCATCTCAAAAAAAAAAAAGTACATCATAAAAGTACATCATATGTGAACATGCAAAAGCAATGCAGCCGGAAAGAACGGAGATTTT
AATTTTTAACAAACAACAAATTAAATTATTAGCCCTTAAACTCTTTCAAAATATAAAAGCAGCAGGCCCCAGGTGAGTCCTGAAGGAAGA
GGCTAGCACTCTGTAAGGCCTCCAGTGTCCAGTGTCTACAATGTTGATGGTCCCCTTTTGTTCAGTCAAGTTTTAATAAAAATAAAACTG

>In-frame_KMT2C_ENST00000355193_chr7_152007051_-_DNAH11_ENST00000409508_chr7_21856085_+_4872nt
GAGGTGCGCGCGCCCGCGCCGATGTGTGTGAGTGCGTGTCCTGCTCGCTCCATGTTGCCGCCTCTCCCGGTACCTGCTGCTGCTCCCGGG
GCTGCGGGAAATGCGAGAGGCTGAGCCGGGGAGGAGGAACCCGAGCAGCAGCGGCGGCGGCGGCGGCCGCGGCGGCGGGAGCCCCCCAGG
AGGAGGACCGGGATCCATGTGTCTTTCCTGGTGACTAGGATGTCGTCGGAGGAGGACAAGAGCGTGGAGCAGCCGCAGCCGCCGCCACCA
CCCCCCGAGGAGCCTGGAGCCCCGGCCCCGAGCCCCGCAGCCGCAGACAAAAGACCTCGGGGCCGGCCTCGCAAAGATGGCGCTTCCCCT
TTCCAGAGAGCCAGAAAGAAACCTCGAAGTAGGGGGAAAACTGCAGTGGAAGATGAGGACAGCATGGATGGGCTGGAGACAACAGAAACA
GAAACGATTGTGGAAACAGAAATCAAAGAACAATCTGCAGAAGAGGATGCTGAAGCAGAAGTGGATAACAGCAAACAGCTAATTCCAACT
CTTCAGCGATCTGTGTCTGAGGAATCGGCAAACTCCCTGGTCTCTGTTGGTGTAGAAGCCAAAATCAGTGAACAGCTCTGCGCTTTTTGT
TACTGTGGGGAAAAAAGTTCCTTAGGACAAGGAGACTTAAAACAATTCAGAATAACGCCTGGATTTATCTTGCCATGGAGAAACCAACCT
TCTAACAAGAAGGACATTGATGACAACAGCAATGGAACCTATGAGAAAATGCAAAACTCAGCACCACGAAAACAAAGAGGACAGAGAAAA
GAACGATCTCCTCAGCAGAATATAGTATCTTGTGTAAGTGTAAGCACCCAGACAGCTTCAGATGATCAAGCTGGTAAACTGTGGGATGAA
CTCAGTCTGGTTGGGCTTCCAGATGCCATTGATATCCAAGCCTTATTTGATTCTACAGGCACTTGTTGGGCTCATCACCGTTGTGTGGAG
TGGTCACTAGGAGTATGCCAGATGGAAGAACCATTGTTAGTGAACGTGGACAAAGCTGTTGTCTCAGGGAGCACAGAAGTTTCCATTCCA
CTAACCGAAGGCCTGGACTTGATATCCATGTTGACGGATGATGCTACAATTGCCGCCTGGAATAACGAAGGACTGCCCAGTGACAGAATG
TCCACCGAAAATGCCGCTATCCTAACACACTGTGAGCGCTGGCCTCTGGTGATAGATCCCCAGCAACAGGGAATTAAGTGGATCAAGAAT
AAGTATGGAATGGACCTGAAAGTCACACATTTGGGCCAGAAAGGGTTTTTGAATGCCATTGAAACTGCTTTGGCCTTTGGTGATGTCATC
TTAATTGAAAATCTCGAGGAAACGATAGATCCAGTCCTGGATCCACTACTTGGCAGGAACACAATTAAAAAAGGAAAGTATATCAGGATT
GGAGATAAAGAATGTGAATTTAACAAGAACTTTCGCCTTATCCTTCACACAAAATTGGCAAATCCTCACTATAAGCCGGAATTACAAGCT
CAGACAACTCTCCTCAATTTCACAGTCACAGAAGATGGTCTAGAAGCCCAGCTGCTGGCAGAGGTTGTCAGTATTGAAAGGCCAGATTTG
GAGAAACTTAAGTTGGTATTGACAAAGCACCAAAATGATTTTAAAATTGAGCTCAAGTATCTGGAAGACGATCTCCTTTTGCGCCTTTCT
GCGGCAGAGGGAAGCTTTCTGGATGACACCAAACTGGTAGAGAGATTGGAGGCAACAAAGACCACCGTGGCAGAGATAGAGCACAAGGTG
ATTGAAGCCAAAGAAAATGAAAGAAAAATCAACGAGGCCCGAGAATGTTACAGACCAGTGGCAGCAAGAGCATCTCTTCTTTATTTTGTT
ATTAATGACCTCCAAAAAATCAACCCCCTCTACCAATTCTCTTTGAAGGCTTTTAACGTGCTGTTCCACAGAGCGATCGAGCAGGCTGAC
AAGGTGGAAGACATGCAGGGACGCATCTCTATCCTGATGGAGAGCATCACCCATGCTGTCTTCCTCTACACCAGCCAGGCGCTGTTTGAG
AAGGACAAGCTCACCTTCCTGTCCCAGATGGCTTTTCAGATTTTGTTGAGAAAGAAAGAGATAGACCCTCTTGAATTGGATTTCCTGCTT
CGATTCACAGTTGAACACACTCATCTGAGTCCCGTTGACTTCCTAACTTCTCAGTCATGGAGTGCTATCAAGGCAATTGCCGTCATGGAA
GAATTTCGAGGCATAGACCGAGATGTGGAAGGATCTGCCAAGCAGTGGAGGAAGTGGGTAGAATCCGAGTGTCCAGAAAAAGAAAAATTA
CCTCAAGAATGGAAGAAGAAAAGTTTAATACAGAAGCTGATTCTTCTGAGAGCAATGCGCCCTGACAGAATGACGTATGCTCTCAGAAAT
TTTGTAGAGGAAAAACTGGGTGCGAAGTATGTGGAGAGGACCAGATTGGACTTAGTTAAAGCATTCGAAGAAAGCAGCCCAGCCACCCCC
ATATTCTTCATCCTGTCTCCGGGGGTAGATGCCCTTAAAGACCTGGAGATTCTTGGCAAAAGACTTGGCTTTACAATTGACTCTGGAAAA
TTCCACAATGTGTCTTTAGGACAAGGTCAGGAGACGGTGGCAGAAGTGGCCCTGGAGAAAGCTTCCAAAGGAGGACACTGGGTCATCCTC
CAAAATGTTCATTTGGTAGCCAAGTGGCTAGGAACCTTGGAGAAGCTCCTTGAAAGATTCAGCCAAGGAAGCCACAGAGATTACAGGGTT
TTCATGAGTGCTGAGTCTGCACCTACACCAGATGAGCATATCATCCCTCAAGGACTCCTGGAAAATTCCATTAAGATCACTAATGAACCC
CCAACAGGGATGCTGGCCAATTTGCATGCCGCCCTGTACAACTTTGATCAGGATACACTTGAAATATGCTCCAAGGAGCAGGAGTTTAAA
AGCATCCTTTTTTCTCTCTGCTACTTCCACGCCTGTGTTGCTGGGAGACTGAGGTTTGGCCCCCAGGGCTGGAGCCGAAGCTATCCTTTT
AATCCTGGAGACCTCACCATTTGTGCCAGTGTCCTCTACAACTACTTAGAGGCAAACTCTAAAGTCCCATGGGAAGATCTCCGTTATCTC
TTTGGTGAGATCATGTATGGAGGCCACATCACAGATGACTGGGATCGCAAACTGTGTCGGGTGTATTTAGAAGAATTCATGAATCCATCT
CTGACTGAAGATGAACTGATGCTGGCACCAGGTTTTGCTGCCCCACCCTACCTAGATTATGCAGGCTACCACCAGTACATAGAGGAGATG
CTTCCTCCAGAAAGCCCGGCACTGTATGGCCTCCACCCAAATGCTGAAATAGAATTCCTGACAGTGACATCCAACACTCTCTTCAGAACT
TTGCTGGAGATGCAGCCCAGGAATGCACTCAGTGGTGATGAACTGGGGCAGTCTACAGAAGAAAAGGTTAAGAATGTCTTGGATGACATT
TTGGAGAAACTTCCAGAAGAGTTCAACATGGCAGAGATAATGCAAAAAAATTCAAATAGAAGCCCATATGTTCTTGTTTGCTTCCAAGAA
TGTGAGAGGATGAATATTCTCATTCGGGAAATACGTATATCACTTGAACAACTGGACCTTAGTTTGAAGGGGGAATTGGCATTATCTCCT
GCTGTGGAAGCCCAGCAGTTTGCATTGAGTTATGACACGGTACCAGACACTTGGAGCAAACTGGCTTATCCTTCTACTTATGGCCTAGCC
CAGTGGTTCAATGACCTCCTCCTGCGATGCCGAGAACTCGATACTTGGACACAAGACCTTACCCTTCCGGCTGTCGTGTGGCTCTCCGGC
TTCTTCAACCCTCAGTCCTTCTTAACTGCAATCATGCAGACGATGGCTCGAAAAAATGAGTGGCCCCTGGATAAAACGCGCTTGACTGCT
GATGTTACCAAAAAAACAAAGGAAGATTATGGACACCCGCCAAGGGAAGGTGCATACCTCCACGGACTCTTCATGGAGGGCGCCCGCTGG
GACACCCAAGCAGGAACCATTGTTGAAGCCCGTCTCAAGGAGCTGGCATGCCCTATGCCGGTCATCTTTGCAAAAGCCACCCCCGTGGAC
AGACAAGAAACCAAACAGACCTACGAGTGCCCTGTGTATAGAACCAAACTGAGAGGCCCCAGCTACATCTGGACCTTCAGGCTGAAGAGC
GAAGAGAAGACTGCAAAATGGGTTCTGGCTGGAGTGGCTCTGCTTCTAGAAGCGTAAGGTAACACTGGCATTCCTCTAGCCTCTGCTGGA
GTGCAGTGAGGATTTTCTAGCATGTTGCTGCACTGTTCCCATGCACATTATTCTAACTTTTTAGTAACTCACACGTGCATTCTTTTTTCA
ACGCTATCCTTAGAGTGAAAGTCAGAAAAAAATACTAGAAACTAACTCAGGGCTGAGCGTGGTGGCACACGACTGTAATCCCAGTTACTC
AGGAGGTAGGAGAATCACTTGAACCTAGGAGGCAAAGGTTGCAGTGAGCCGAGGTTGCACCACTGCACTCCCTCCTGGGCAACAGAACAA
GACTCCATCTCAAAAAAAAAAAAGTACATCATAAAAGTACATCATATGTGAACATGCAAAAGCAATGCAGCCGGAAAGAACGGAGATTTT
AATTTTTAACAAACAACAAATTAAATTATTAGCCCTTAAACTCTTTCAAAATATAAAAGCAGCAGGCCCCAGGTGAGTCCTGAAGGAAGA
GGCTAGCACTCTGTAAGGCCTCCAGTGTCCAGTGTCTACAATGTTGATGGTCCCCTTTTGTTCAGTCAAGTTTTAATAAAAATAAAACTG

>In-frame_KMT2C_ENST00000355193_chr7_152007051_-_DNAH11_ENST00000328843_chr7_21856085_+_4872nt
GAGGTGCGCGCGCCCGCGCCGATGTGTGTGAGTGCGTGTCCTGCTCGCTCCATGTTGCCGCCTCTCCCGGTACCTGCTGCTGCTCCCGGG
GCTGCGGGAAATGCGAGAGGCTGAGCCGGGGAGGAGGAACCCGAGCAGCAGCGGCGGCGGCGGCGGCCGCGGCGGCGGGAGCCCCCCAGG
AGGAGGACCGGGATCCATGTGTCTTTCCTGGTGACTAGGATGTCGTCGGAGGAGGACAAGAGCGTGGAGCAGCCGCAGCCGCCGCCACCA
CCCCCCGAGGAGCCTGGAGCCCCGGCCCCGAGCCCCGCAGCCGCAGACAAAAGACCTCGGGGCCGGCCTCGCAAAGATGGCGCTTCCCCT
TTCCAGAGAGCCAGAAAGAAACCTCGAAGTAGGGGGAAAACTGCAGTGGAAGATGAGGACAGCATGGATGGGCTGGAGACAACAGAAACA
GAAACGATTGTGGAAACAGAAATCAAAGAACAATCTGCAGAAGAGGATGCTGAAGCAGAAGTGGATAACAGCAAACAGCTAATTCCAACT
CTTCAGCGATCTGTGTCTGAGGAATCGGCAAACTCCCTGGTCTCTGTTGGTGTAGAAGCCAAAATCAGTGAACAGCTCTGCGCTTTTTGT
TACTGTGGGGAAAAAAGTTCCTTAGGACAAGGAGACTTAAAACAATTCAGAATAACGCCTGGATTTATCTTGCCATGGAGAAACCAACCT
TCTAACAAGAAGGACATTGATGACAACAGCAATGGAACCTATGAGAAAATGCAAAACTCAGCACCACGAAAACAAAGAGGACAGAGAAAA
GAACGATCTCCTCAGCAGAATATAGTATCTTGTGTAAGTGTAAGCACCCAGACAGCTTCAGATGATCAAGCTGGTAAACTGTGGGATGAA
CTCAGTCTGGTTGGGCTTCCAGATGCCATTGATATCCAAGCCTTATTTGATTCTACAGGCACTTGTTGGGCTCATCACCGTTGTGTGGAG
TGGTCACTAGGAGTATGCCAGATGGAAGAACCATTGTTAGTGAACGTGGACAAAGCTGTTGTCTCAGGGAGCACAGAAGTTTCCATTCCA
CTAACCGAAGGCCTGGACTTGATATCCATGTTGACGGATGATGCTACAATTGCCGCCTGGAATAACGAAGGACTGCCCAGTGACAGAATG
TCCACCGAAAATGCCGCTATCCTAACACACTGTGAGCGCTGGCCTCTGGTGATAGATCCCCAGCAACAGGGAATTAAGTGGATCAAGAAT
AAGTATGGAATGGACCTGAAAGTCACACATTTGGGCCAGAAAGGGTTTTTGAATGCCATTGAAACTGCTTTGGCCTTTGGTGATGTCATC
TTAATTGAAAATCTCGAGGAAACGATAGATCCAGTCCTGGATCCACTACTTGGCAGGAACACAATTAAAAAAGGAAAGTATATCAGGATT
GGAGATAAAGAATGTGAATTTAACAAGAACTTTCGCCTTATCCTTCACACAAAATTGGCAAATCCTCACTATAAGCCGGAATTACAAGCT
CAGACAACTCTCCTCAATTTCACAGTCACAGAAGATGGTCTAGAAGCCCAGCTGCTGGCAGAGGTTGTCAGTATTGAAAGGCCAGATTTG
GAGAAACTTAAGTTGGTATTGACAAAGCACCAAAATGATTTTAAAATTGAGCTCAAGTATCTGGAAGACGATCTCCTTTTGCGCCTTTCT
GCGGCAGAGGGAAGCTTTCTGGATGACACCAAACTGGTAGAGAGATTGGAGGCAACAAAGACCACCGTGGCAGAGATAGAGCACAAGGTG
ATTGAAGCCAAAGAAAATGAAAGAAAAATCAACGAGGCCCGAGAATGTTACAGACCAGTGGCAGCAAGAGCATCTCTTCTTTATTTTGTT
ATTAATGACCTCCAAAAAATCAACCCCCTCTACCAATTCTCTTTGAAGGCTTTTAACGTGCTGTTCCACAGAGCGATCGAGCAGGCTGAC
AAGGTGGAAGACATGCAGGGACGCATCTCTATCCTGATGGAGAGCATCACCCATGCTGTCTTCCTCTACACCAGCCAGGCGCTGTTTGAG
AAGGACAAGCTCACCTTCCTGTCCCAGATGGCTTTTCAGATTTTGTTGAGAAAGAAAGAGATAGACCCTCTTGAATTGGATTTCCTGCTT
CGATTCACAGTTGAACACACTCATCTGAGTCCCGTTGACTTCCTAACTTCTCAGTCATGGAGTGCTATCAAGGCAATTGCCGTCATGGAA
GAATTTCGAGGCATAGACCGAGATGTGGAAGGATCTGCCAAGCAGTGGAGGAAGTGGGTAGAATCCGAGTGTCCAGAAAAAGAAAAATTA
CCTCAAGAATGGAAGAAGAAAAGTTTAATACAGAAGCTGATTCTTCTGAGAGCAATGCGCCCTGACAGAATGACGTATGCTCTCAGAAAT
TTTGTAGAGGAAAAACTGGGTGCGAAGTATGTGGAGAGGACCAGATTGGACTTAGTTAAAGCATTCGAAGAAAGCAGCCCAGCCACCCCC
ATATTCTTCATCCTGTCTCCGGGGGTAGATGCCCTTAAAGACCTGGAGATTCTTGGCAAAAGACTTGGCTTTACAATTGACTCTGGAAAA
TTCCACAATGTGTCTTTAGGACAAGGTCAGGAGACGGTGGCAGAAGTGGCCCTGGAGAAAGCTTCCAAAGGAGGACACTGGGTCATCCTC
CAAAATGTTCATTTGGTAGCCAAGTGGCTAGGAACCTTGGAGAAGCTCCTTGAAAGATTCAGCCAAGGAAGCCACAGAGATTACAGGGTT
TTCATGAGTGCTGAGTCTGCACCTACACCAGATGAGCATATCATCCCTCAAGGACTCCTGGAAAATTCCATTAAGATCACTAATGAACCC
CCAACAGGGATGCTGGCCAATTTGCATGCCGCCCTGTACAACTTTGATCAGGATACACTTGAAATATGCTCCAAGGAGCAGGAGTTTAAA
AGCATCCTTTTTTCTCTCTGCTACTTCCACGCCTGTGTTGCTGGGAGACTGAGGTTTGGCCCCCAGGGCTGGAGCCGAAGCTATCCTTTT
AATCCTGGAGACCTCACCATTTGTGCCAGTGTCCTCTACAACTACTTAGAGGCAAACTCTAAAGTCCCATGGGAAGATCTCCGTTATCTC
TTTGGTGAGATCATGTATGGAGGCCACATCACAGATGACTGGGATCGCAAACTGTGTCGGGTGTATTTAGAAGAATTCATGAATCCATCT
CTGACTGAAGATGAACTGATGCTGGCACCAGGTTTTGCTGCCCCACCCTACCTAGATTATGCAGGCTACCACCAGTACATAGAGGAGATG
CTTCCTCCAGAAAGCCCGGCACTGTATGGCCTCCACCCAAATGCTGAAATAGAATTCCTGACAGTGACATCCAACACTCTCTTCAGAACT
TTGCTGGAGATGCAGCCCAGGAATGCACTCAGTGGTGATGAACTGGGGCAGTCTACAGAAGAAAAGGTTAAGAATGTCTTGGATGACATT
TTGGAGAAACTTCCAGAAGAGTTCAACATGGCAGAGATAATGCAAAAAAATTCAAATAGAAGCCCATATGTTCTTGTTTGCTTCCAAGAA
TGTGAGAGGATGAATATTCTCATTCGGGAAATACGTATATCACTTGAACAACTGGACCTTAGTTTGAAGGGGGAATTGGCATTATCTCCT
GCTGTGGAAGCCCAGCAGTTTGCATTGAGTTATGACACGGTACCAGACACTTGGAGCAAACTGGCTTATCCTTCTACTTATGGCCTAGCC
CAGTGGTTCAATGACCTCCTCCTGCGATGCCGAGAACTCGATACTTGGACACAAGACCTTACCCTTCCGGCTGTCGTGTGGCTCTCCGGC
TTCTTCAACCCTCAGTCCTTCTTAACTGCAATCATGCAGACGATGGCTCGAAAAAATGAGTGGCCCCTGGATAAAACGCGCTTGACTGCT
GATGTTACCAAAAAAACAAAGGAAGATTATGGACACCCGCCAAGGGAAGGTGCATACCTCCACGGACTCTTCATGGAGGGCGCCCGCTGG
GACACCCAAGCAGGAACCATTGTTGAAGCCCGTCTCAAGGAGCTGGCATGCCCTATGCCGGTCATCTTTGCAAAAGCCACCCCCGTGGAC
AGACAAGAAACCAAACAGACCTACGAGTGCCCTGTGTATAGAACCAAACTGAGAGGCCCCAGCTACATCTGGACCTTCAGGCTGAAGAGC
GAAGAGAAGACTGCAAAATGGGTTCTGGCTGGAGTGGCTCTGCTTCTAGAAGCGTAAGGTAACACTGGCATTCCTCTAGCCTCTGCTGGA
GTGCAGTGAGGATTTTCTAGCATGTTGCTGCACTGTTCCCATGCACATTATTCTAACTTTTTAGTAACTCACACGTGCATTCTTTTTTCA
ACGCTATCCTTAGAGTGAAAGTCAGAAAAAAATACTAGAAACTAACTCAGGGCTGAGCGTGGTGGCACACGACTGTAATCCCAGTTACTC
AGGAGGTAGGAGAATCACTTGAACCTAGGAGGCAAAGGTTGCAGTGAGCCGAGGTTGCACCACTGCACTCCCTCCTGGGCAACAGAACAA
GACTCCATCTCAAAAAAAAAAAAGTACATCATAAAAGTACATCATATGTGAACATGCAAAAGCAATGCAGCCGGAAAGAACGGAGATTTT
AATTTTTAACAAACAACAAATTAAATTATTAGCCCTTAAACTCTTTCAAAATATAAAAGCAGCAGGCCCCAGGTGAGTCCTGAAGGAAGA
GGCTAGCACTCTGTAAGGCCTCCAGTGTCCAGTGTCTACAATGTTGATGGTCCCCTTTTGTTCAGTCAAGTTTTAATAAAAATAAAACTG


Top

FusionGenePPI for KMT2C_DNAH11


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
KMT2CAK1, NCOA6, ASH2L, RBBP5, HIST2H3C, ASCL2, KDM6A, SMARCB1, MAPK14, JUN, PAXIP1, H3F3A, PAGR1, WDR82, CDC73, TSC22D1, KDM4B, ELAVL1, WDR5, HIST1H3A, APPL2, ERP44, HIST3H3, DPY30, MTNR1B, FOXA1, TRIM25DNAH11ZDHHC17


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for KMT2C_DNAH11


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for KMT2C_DNAH11


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneKMT2CC0001418Adenocarcinoma1CTD_human
HgeneKMT2CC0005695Bladder Neoplasm1CTD_human
HgeneKMT2CC0007138Carcinoma, Transitional Cell1CTD_human
HgeneKMT2CC0010606Adenoid Cystic Carcinoma1CTD_human
HgeneKMT2CC0023467Leukemia, Myelocytic, Acute1CTD_human
HgeneKMT2CC0023897Liver Diseases, Parasitic1CTD_human
HgeneKMT2CC0036920Sezary Syndrome1CTD_human
HgeneKMT2CC0038356Stomach Neoplasms1CTD_human
HgeneKMT2CC0206698Cholangiocarcinoma1CTD_human
HgeneKMT2CC0279626Squamous cell carcinoma of esophagus1CTD_human
HgeneKMT2CC2239176Liver carcinoma1CTD_human
TgeneDNAH11C0010068Coronary heart disease1CTD_human
TgeneDNAH11C0043094Weight Gain1CTD_human
TgeneDNAH11C0242339Dyslipidemias1CTD_human
TgeneDNAH11C2678473CILIARY DYSKINESIA, PRIMARY, 7 (disorder)1CTD_human;UNIPROT