FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 19106

FusionGeneSummary for KMT2A_PICALM

check button Fusion gene summary
Fusion gene informationFusion gene name: KMT2A_PICALM
Fusion gene ID: 19106
HgeneTgene
Gene symbol

KMT2A

PICALM

Gene ID

4297

8301

Gene namelysine methyltransferase 2Aphosphatidylinositol binding clathrin assembly protein
SynonymsALL-1|CXXC7|HRX|HTRX1|MLL|MLL1|MLL1A|TRX1|WDSTSCALM|CLTH|LAP
Cytomap

11q23.3

11q14.2

Type of geneprotein-codingprotein-coding
Descriptionhistone-lysine N-methyltransferase 2ACXXC-type zinc finger protein 7lysine (K)-specific methyltransferase 2Alysine N-methyltransferase 2Amixed lineage leukemia 1myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila)trithorax-likephosphatidylinositol-binding clathrin assembly proteinclathrin assembly lymphoid myeloid leukemia protein
Modification date2018051920180523
UniProtAcc

Q03164

Q13492

Ensembl transtripts involved in fusion geneENST00000534358, ENST00000389506, 
ENST00000354520, ENST00000420751, 
ENST00000532317, ENST00000526033, 
ENST00000393346, ENST00000528398, 
ENST00000356360, ENST00000528411, 
Fusion gene scores* DoF score31 X 72 X 6=133927 X 12 X 4=336
# samples 12914
** MAII scorelog2(129/13392*10)=-3.37592846223973
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(14/336*10)=-1.26303440583379
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: KMT2A [Title/Abstract] AND PICALM [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Transcription factor involved fusion gene, inframe and retained DNA-binding domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneKMT2A

GO:0045944

positive regulation of transcription by RNA polymerase II

20861184

HgeneKMT2A

GO:0051568

histone H3-K4 methylation

19556245

HgeneKMT2A

GO:0065003

protein-containing complex assembly

15199122

HgeneKMT2A

GO:0080182

histone H3-K4 trimethylation

20861184

TgenePICALM

GO:0006898

receptor-mediated endocytosis

10436022

TgenePICALM

GO:0032880

regulation of protein localization

10436022

TgenePICALM

GO:0045893

positive regulation of transcription, DNA-templated

11425879

TgenePICALM

GO:0048261

negative regulation of receptor-mediated endocytosis

10436022


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
ChiTaRS3.1AF477006KMT2Achr11

118355029

+PICALMchr11

85718628

-
ChiTaRS3.1AF477007KMT2Achr11

118355475

+PICALMchr11

85720153

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000534358ENST00000532317KMT2Achr11

118355029

+PICALMchr11

85718628

-
In-frameENST00000534358ENST00000526033KMT2Achr11

118355029

+PICALMchr11

85718628

-
In-frameENST00000534358ENST00000393346KMT2Achr11

118355029

+PICALMchr11

85718628

-
In-frameENST00000534358ENST00000528398KMT2Achr11

118355029

+PICALMchr11

85718628

-
In-frameENST00000534358ENST00000356360KMT2Achr11

118355029

+PICALMchr11

85718628

-
5CDS-intronENST00000534358ENST00000528411KMT2Achr11

118355029

+PICALMchr11

85718628

-
In-frameENST00000389506ENST00000532317KMT2Achr11

118355029

+PICALMchr11

85718628

-
In-frameENST00000389506ENST00000526033KMT2Achr11

118355029

+PICALMchr11

85718628

-
In-frameENST00000389506ENST00000393346KMT2Achr11

118355029

+PICALMchr11

85718628

-
In-frameENST00000389506ENST00000528398KMT2Achr11

118355029

+PICALMchr11

85718628

-
In-frameENST00000389506ENST00000356360KMT2Achr11

118355029

+PICALMchr11

85718628

-
5CDS-intronENST00000389506ENST00000528411KMT2Achr11

118355029

+PICALMchr11

85718628

-
In-frameENST00000354520ENST00000532317KMT2Achr11

118355029

+PICALMchr11

85718628

-
In-frameENST00000354520ENST00000526033KMT2Achr11

118355029

+PICALMchr11

85718628

-
In-frameENST00000354520ENST00000393346KMT2Achr11

118355029

+PICALMchr11

85718628

-
In-frameENST00000354520ENST00000528398KMT2Achr11

118355029

+PICALMchr11

85718628

-
In-frameENST00000354520ENST00000356360KMT2Achr11

118355029

+PICALMchr11

85718628

-
5CDS-intronENST00000354520ENST00000528411KMT2Achr11

118355029

+PICALMchr11

85718628

-
3UTR-3CDSENST00000420751ENST00000532317KMT2Achr11

118355029

+PICALMchr11

85718628

-
3UTR-3CDSENST00000420751ENST00000526033KMT2Achr11

118355029

+PICALMchr11

85718628

-
3UTR-3CDSENST00000420751ENST00000393346KMT2Achr11

118355029

+PICALMchr11

85718628

-
3UTR-3CDSENST00000420751ENST00000528398KMT2Achr11

118355029

+PICALMchr11

85718628

-
3UTR-3CDSENST00000420751ENST00000356360KMT2Achr11

118355029

+PICALMchr11

85718628

-
3UTR-intronENST00000420751ENST00000528411KMT2Achr11

118355029

+PICALMchr11

85718628

-
intron-intronENST00000534358ENST00000532317KMT2Achr11

118355475

+PICALMchr11

85720153

-
intron-intronENST00000534358ENST00000526033KMT2Achr11

118355475

+PICALMchr11

85720153

-
intron-intronENST00000534358ENST00000393346KMT2Achr11

118355475

+PICALMchr11

85720153

-
intron-intronENST00000534358ENST00000528398KMT2Achr11

118355475

+PICALMchr11

85720153

-
intron-intronENST00000534358ENST00000356360KMT2Achr11

118355475

+PICALMchr11

85720153

-
intron-intronENST00000534358ENST00000528411KMT2Achr11

118355475

+PICALMchr11

85720153

-
intron-intronENST00000389506ENST00000532317KMT2Achr11

118355475

+PICALMchr11

85720153

-
intron-intronENST00000389506ENST00000526033KMT2Achr11

118355475

+PICALMchr11

85720153

-
intron-intronENST00000389506ENST00000393346KMT2Achr11

118355475

+PICALMchr11

85720153

-
intron-intronENST00000389506ENST00000528398KMT2Achr11

118355475

+PICALMchr11

85720153

-
intron-intronENST00000389506ENST00000356360KMT2Achr11

118355475

+PICALMchr11

85720153

-
intron-intronENST00000389506ENST00000528411KMT2Achr11

118355475

+PICALMchr11

85720153

-
intron-intronENST00000354520ENST00000532317KMT2Achr11

118355475

+PICALMchr11

85720153

-
intron-intronENST00000354520ENST00000526033KMT2Achr11

118355475

+PICALMchr11

85720153

-
intron-intronENST00000354520ENST00000393346KMT2Achr11

118355475

+PICALMchr11

85720153

-
intron-intronENST00000354520ENST00000528398KMT2Achr11

118355475

+PICALMchr11

85720153

-
intron-intronENST00000354520ENST00000356360KMT2Achr11

118355475

+PICALMchr11

85720153

-
intron-intronENST00000354520ENST00000528411KMT2Achr11

118355475

+PICALMchr11

85720153

-
intron-intronENST00000420751ENST00000532317KMT2Achr11

118355475

+PICALMchr11

85720153

-
intron-intronENST00000420751ENST00000526033KMT2Achr11

118355475

+PICALMchr11

85720153

-
intron-intronENST00000420751ENST00000393346KMT2Achr11

118355475

+PICALMchr11

85720153

-
intron-intronENST00000420751ENST00000528398KMT2Achr11

118355475

+PICALMchr11

85720153

-
intron-intronENST00000420751ENST00000356360KMT2Achr11

118355475

+PICALMchr11

85720153

-
intron-intronENST00000420751ENST00000528411KMT2Achr11

118355475

+PICALMchr11

85720153

-

Top

FusionProtFeatures for KMT2A_PICALM


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
KMT2A

Q03164

PICALM

Q13492

Assembly protein recruiting clathrin and adapter proteincomplex 2 (AP2) to cell membranes at sites of coated-pit formationand clathrin-vesicle assembly. May be required to determine theamount of membrane to be recycled, possibly by regulating the sizeof the clathrin cage. Involved in AP2-dependent clathrin-mediatedendocytosis at the neuromuscular junction.{ECO:0000269|PubMed:10436022}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneKMT2Achr11:118355029chr11:85718628ENST00000354520+935137_14314063932Compositional biasNote=Poly-Gly
HgeneKMT2Achr11:118355029chr11:85718628ENST00000354520+93517_10214063932Compositional biasNote=Ala/Gly/Ser-rich
HgeneKMT2Achr11:118355029chr11:85718628ENST00000354520+935561_56414063932Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118355029chr11:85718628ENST00000354520+935568_57114063932Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118355029chr11:85718628ENST00000389506+936137_14314063970Compositional biasNote=Poly-Gly
HgeneKMT2Achr11:118355029chr11:85718628ENST00000389506+93617_10214063970Compositional biasNote=Ala/Gly/Ser-rich
HgeneKMT2Achr11:118355029chr11:85718628ENST00000389506+936561_56414063970Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118355029chr11:85718628ENST00000389506+936568_57114063970Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118355029chr11:85718628ENST00000534358+936137_14314063973Compositional biasNote=Poly-Gly
HgeneKMT2Achr11:118355029chr11:85718628ENST00000534358+93617_10214063973Compositional biasNote=Ala/Gly/Ser-rich
HgeneKMT2Achr11:118355029chr11:85718628ENST00000534358+936561_56414063973Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118355029chr11:85718628ENST00000534358+936568_57114063973Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118355029chr11:85718628ENST00000354520+935169_18014063932DNA bindingNote=A.T hook 1
HgeneKMT2Achr11:118355029chr11:85718628ENST00000354520+935217_22714063932DNA bindingNote=A.T hook 2
HgeneKMT2Achr11:118355029chr11:85718628ENST00000354520+935301_30914063932DNA bindingNote=A.T hook 3
HgeneKMT2Achr11:118355029chr11:85718628ENST00000389506+936169_18014063970DNA bindingNote=A.T hook 1
HgeneKMT2Achr11:118355029chr11:85718628ENST00000389506+936217_22714063970DNA bindingNote=A.T hook 2
HgeneKMT2Achr11:118355029chr11:85718628ENST00000389506+936301_30914063970DNA bindingNote=A.T hook 3
HgeneKMT2Achr11:118355029chr11:85718628ENST00000534358+936169_18014063973DNA bindingNote=A.T hook 1
HgeneKMT2Achr11:118355029chr11:85718628ENST00000534358+936217_22714063973DNA bindingNote=A.T hook 2
HgeneKMT2Achr11:118355029chr11:85718628ENST00000534358+936301_30914063973DNA bindingNote=A.T hook 3
HgeneKMT2Achr11:118355029chr11:85718628ENST00000354520+9351147_119514063932Zinc fingerCXXC-type
HgeneKMT2Achr11:118355029chr11:85718628ENST00000389506+9361147_119514063970Zinc fingerCXXC-type
HgeneKMT2Achr11:118355029chr11:85718628ENST00000534358+9361147_119514063973Zinc fingerCXXC-type

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneKMT2Achr11:118355029chr11:85718628ENST00000354520+9351703_174814063932DomainBromo%3B divergent
HgeneKMT2Achr11:118355029chr11:85718628ENST00000354520+9352018_207414063932DomainFYR N-terminal
HgeneKMT2Achr11:118355029chr11:85718628ENST00000354520+9353666_374714063932DomainFYR C-terminal
HgeneKMT2Achr11:118355029chr11:85718628ENST00000354520+9353829_394514063932DomainSET
HgeneKMT2Achr11:118355029chr11:85718628ENST00000354520+9353953_396914063932DomainPost-SET
HgeneKMT2Achr11:118355029chr11:85718628ENST00000389506+9361703_174814063970DomainBromo%3B divergent
HgeneKMT2Achr11:118355029chr11:85718628ENST00000389506+9362018_207414063970DomainFYR N-terminal
HgeneKMT2Achr11:118355029chr11:85718628ENST00000389506+9363666_374714063970DomainFYR C-terminal
HgeneKMT2Achr11:118355029chr11:85718628ENST00000389506+9363829_394514063970DomainSET
HgeneKMT2Achr11:118355029chr11:85718628ENST00000389506+9363953_396914063970DomainPost-SET
HgeneKMT2Achr11:118355029chr11:85718628ENST00000534358+9361703_174814063973DomainBromo%3B divergent
HgeneKMT2Achr11:118355029chr11:85718628ENST00000534358+9362018_207414063973DomainFYR N-terminal
HgeneKMT2Achr11:118355029chr11:85718628ENST00000534358+9363666_374714063973DomainFYR C-terminal
HgeneKMT2Achr11:118355029chr11:85718628ENST00000534358+9363829_394514063973DomainSET
HgeneKMT2Achr11:118355029chr11:85718628ENST00000534358+9363953_396914063973DomainPost-SET
HgeneKMT2Achr11:118355029chr11:85718628ENST00000354520+9353906_390714063932RegionS-adenosyl-L-methionine binding
HgeneKMT2Achr11:118355029chr11:85718628ENST00000389506+9363906_390714063970RegionS-adenosyl-L-methionine binding
HgeneKMT2Achr11:118355029chr11:85718628ENST00000534358+9363906_390714063973RegionS-adenosyl-L-methionine binding
HgeneKMT2Achr11:118355029chr11:85718628ENST00000354520+9351431_148214063932Zinc fingerPHD-type 1
HgeneKMT2Achr11:118355029chr11:85718628ENST00000354520+9351479_153314063932Zinc fingerPHD-type 2
HgeneKMT2Achr11:118355029chr11:85718628ENST00000354520+9351566_162714063932Zinc fingerPHD-type 3
HgeneKMT2Achr11:118355029chr11:85718628ENST00000354520+9351870_191014063932Zinc fingerC2HC pre-PHD-type
HgeneKMT2Achr11:118355029chr11:85718628ENST00000354520+9351931_197814063932Zinc fingerPHD-type 4
HgeneKMT2Achr11:118355029chr11:85718628ENST00000389506+9361431_148214063970Zinc fingerPHD-type 1
HgeneKMT2Achr11:118355029chr11:85718628ENST00000389506+9361479_153314063970Zinc fingerPHD-type 2
HgeneKMT2Achr11:118355029chr11:85718628ENST00000389506+9361566_162714063970Zinc fingerPHD-type 3
HgeneKMT2Achr11:118355029chr11:85718628ENST00000389506+9361870_191014063970Zinc fingerC2HC pre-PHD-type
HgeneKMT2Achr11:118355029chr11:85718628ENST00000389506+9361931_197814063970Zinc fingerPHD-type 4
HgeneKMT2Achr11:118355029chr11:85718628ENST00000534358+9361431_148214063973Zinc fingerPHD-type 1
HgeneKMT2Achr11:118355029chr11:85718628ENST00000534358+9361479_153314063973Zinc fingerPHD-type 2
HgeneKMT2Achr11:118355029chr11:85718628ENST00000534358+9361566_162714063973Zinc fingerPHD-type 3
HgeneKMT2Achr11:118355029chr11:85718628ENST00000534358+9361870_191014063973Zinc fingerC2HC pre-PHD-type
HgeneKMT2Achr11:118355029chr11:85718628ENST00000534358+9361931_197814063973Zinc fingerPHD-type 4
TgenePICALMchr11:118355029chr11:85718628ENST00000356360-61914_145255633DomainENTH
TgenePICALMchr11:118355029chr11:85718628ENST00000393346-62014_145255653DomainENTH
TgenePICALMchr11:118355029chr11:85718628ENST00000526033-62014_145255646DomainENTH
TgenePICALMchr11:118355029chr11:85718628ENST00000528398-61914_145204552DomainENTH
TgenePICALMchr11:118355029chr11:85718628ENST00000532317-62014_145255611DomainENTH


Top

FusionGeneSequence for KMT2A_PICALM


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_KMT2A_ENST00000534358_chr11_118355029_+_PICALM_ENST00000532317_chr11_85718628_-_1762aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDTDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRTSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKTAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALTPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKQVGIDRGDIPDLSQAPSSLLDALEQHLASLEGKK
IKDSTAASRATTLSNAVSSLASTGLSLTKVDEREKQAALEEEQARLKALKEQRLKELAKKPHTSLTTAASPVSTSAGGIMTAPAIDIFST
PSSSNSTSKLPNDLLDLQQPTFHPSVHPMSTASQVASTWGGFTPSPVAQPHPSAGLNVDFESVFGNKSTNVIVDSGGFDELGGLLKPTVA
SQNQNLPVAKLPPSKLVSDDLDSSLANLVGNLGIGNGTTKNDVNWSQPGEKKLTGGSNWQPKVAPTTAWNAATMNGMHFPQYAPPVMATP

>In-frame_KMT2A_ENST00000534358_chr11_118355029_+_PICALM_ENST00000526033_chr11_85718628_-_1797aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDTDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRTSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKTAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALTPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKQVGIDRGDIPDLSQAPSSLLDALEQHLASLEGKK
IKDSTAASRATTLSNAVSSLASTGLSLTKVDEREKQAALEEEQARLKALKEQRLKELAKKPHTSLTTAASPVSTSAGGIMTAPAIDIFST
PSSSNSTSKLPNDLLDLQQPTFHPSVHPMSTASQVASTWGDAVDDAIPSLNPFLTKSSGDVHLSISSDVSTFTTRTPTHEMFVGFTPSPV
AQPHPSAGLNVDFESVFGNKSTNVIVDSGGFDELGGLLKPTVASQNQNLPVAKLPPSKLVSDDLDSSLANLVGNLGIGNGTTKNDVNWSQ

>In-frame_KMT2A_ENST00000534358_chr11_118355029_+_PICALM_ENST00000393346_chr11_85718628_-_1804aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDTDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRTSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKTAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALTPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKQVGIDRGDIPDLSQAPSSLLDALEQHLASLEGKK
IKDSTAASRATTLSNAVSSLASTGLSLTKVDEREKQAALEEEQARLKALKEQRLKELAKKPHTSLTTAASPVSTSAGGIMTAPAIDIFST
PSSSNSTSKLPNDLLDLQQPTFHPSVHPMSTASQVASTWGDPFSATVDAVDDAIPSLNPFLTKSSGDVHLSISSDVSTFTTRTPTHEMFV
GFTPSPVAQPHPSAGLNVDFESVFGNKSTNVIVDSGGFDELGGLLKPTVASQNQNLPVAKLPPSKLVSDDLDSSLANLVGNLGIGNGTTK
NDVNWSQPGEKKLTGGSNWQPKVAPTTAWNAATMAPPVMATPATTPTGMIGTGIPPQMGSVPVMTQPTLIYSQPVMRPPNPFGPVSGAQI

>In-frame_KMT2A_ENST00000534358_chr11_118355029_+_PICALM_ENST00000528398_chr11_85718628_-_1754aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDTDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRTSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKTAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALTPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKQVGIDRGDIPDLSQAPSSLLDALEQHLASLEGKK
IKDSTAASRATTLSNAVSSLASTGLSLTKVDEREKQAALEEEQARLKALKEQRLKELAKKPHTSLTTAASPVSTSAGGIMTAPAIDIFST
PSSSNSTSKLPNDLLDLQQPTFHPSVHPMSTASQVASTWGGFTPSPVAQPHPSAGLNVDFESVFGNKSTNVIVDSGGFDELGGLLKPTVA
SQNQNLPVAKLPPSKLVSDDLDSSLANLVGNLGIGNGTTKNDVNWSQPGEKKLTGGSNWQPKVAPTTAWNAATMAPPVMATPATTPTGMI

>In-frame_KMT2A_ENST00000534358_chr11_118355029_+_PICALM_ENST00000356360_chr11_85718628_-_1784aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDTDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRTSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKTAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALTPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKQVGIDRGDIPDLSQAPSSLLDALEQHLASLEGKK
IKDSTAASRATTLSNAVSSLASTGLSLTKVDEREKQAALEEEQARLKALKEQRLKELAKKPHTSLTTAASPVSTSAGGIMTAPAIDIFST
PSSSNSTSKLPNDLLDLQQPTFHPSVHPMSTASQVASTWGDPFSATVDAVDDAIPSLNPFLTKSSGDVHLSISSDVSTFTTRTPTHEMFV
GFTPSPVAQPHPSAGLNVDFESVFGNKSTNVIVDSGGFDELGGLLKPTVASQNQNLPVAKLPPSKLVSDDLDSSLANLVGNLGIGNGTTK

>In-frame_KMT2A_ENST00000389506_chr11_118355029_+_PICALM_ENST00000532317_chr11_85718628_-_1762aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDTDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRTSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKTAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALTPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKQVGIDRGDIPDLSQAPSSLLDALEQHLASLEGKK
IKDSTAASRATTLSNAVSSLASTGLSLTKVDEREKQAALEEEQARLKALKEQRLKELAKKPHTSLTTAASPVSTSAGGIMTAPAIDIFST
PSSSNSTSKLPNDLLDLQQPTFHPSVHPMSTASQVASTWGGFTPSPVAQPHPSAGLNVDFESVFGNKSTNVIVDSGGFDELGGLLKPTVA
SQNQNLPVAKLPPSKLVSDDLDSSLANLVGNLGIGNGTTKNDVNWSQPGEKKLTGGSNWQPKVAPTTAWNAATMNGMHFPQYAPPVMATP

>In-frame_KMT2A_ENST00000389506_chr11_118355029_+_PICALM_ENST00000526033_chr11_85718628_-_1797aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDTDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRTSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKTAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALTPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKQVGIDRGDIPDLSQAPSSLLDALEQHLASLEGKK
IKDSTAASRATTLSNAVSSLASTGLSLTKVDEREKQAALEEEQARLKALKEQRLKELAKKPHTSLTTAASPVSTSAGGIMTAPAIDIFST
PSSSNSTSKLPNDLLDLQQPTFHPSVHPMSTASQVASTWGDAVDDAIPSLNPFLTKSSGDVHLSISSDVSTFTTRTPTHEMFVGFTPSPV
AQPHPSAGLNVDFESVFGNKSTNVIVDSGGFDELGGLLKPTVASQNQNLPVAKLPPSKLVSDDLDSSLANLVGNLGIGNGTTKNDVNWSQ

>In-frame_KMT2A_ENST00000389506_chr11_118355029_+_PICALM_ENST00000393346_chr11_85718628_-_1804aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDTDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRTSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKTAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALTPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKQVGIDRGDIPDLSQAPSSLLDALEQHLASLEGKK
IKDSTAASRATTLSNAVSSLASTGLSLTKVDEREKQAALEEEQARLKALKEQRLKELAKKPHTSLTTAASPVSTSAGGIMTAPAIDIFST
PSSSNSTSKLPNDLLDLQQPTFHPSVHPMSTASQVASTWGDPFSATVDAVDDAIPSLNPFLTKSSGDVHLSISSDVSTFTTRTPTHEMFV
GFTPSPVAQPHPSAGLNVDFESVFGNKSTNVIVDSGGFDELGGLLKPTVASQNQNLPVAKLPPSKLVSDDLDSSLANLVGNLGIGNGTTK
NDVNWSQPGEKKLTGGSNWQPKVAPTTAWNAATMAPPVMATPATTPTGMIGTGIPPQMGSVPVMTQPTLIYSQPVMRPPNPFGPVSGAQI

>In-frame_KMT2A_ENST00000389506_chr11_118355029_+_PICALM_ENST00000528398_chr11_85718628_-_1754aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDTDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRTSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKTAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALTPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKQVGIDRGDIPDLSQAPSSLLDALEQHLASLEGKK
IKDSTAASRATTLSNAVSSLASTGLSLTKVDEREKQAALEEEQARLKALKEQRLKELAKKPHTSLTTAASPVSTSAGGIMTAPAIDIFST
PSSSNSTSKLPNDLLDLQQPTFHPSVHPMSTASQVASTWGGFTPSPVAQPHPSAGLNVDFESVFGNKSTNVIVDSGGFDELGGLLKPTVA
SQNQNLPVAKLPPSKLVSDDLDSSLANLVGNLGIGNGTTKNDVNWSQPGEKKLTGGSNWQPKVAPTTAWNAATMAPPVMATPATTPTGMI

>In-frame_KMT2A_ENST00000389506_chr11_118355029_+_PICALM_ENST00000356360_chr11_85718628_-_1784aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDTDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRTSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKTAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALTPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKQVGIDRGDIPDLSQAPSSLLDALEQHLASLEGKK
IKDSTAASRATTLSNAVSSLASTGLSLTKVDEREKQAALEEEQARLKALKEQRLKELAKKPHTSLTTAASPVSTSAGGIMTAPAIDIFST
PSSSNSTSKLPNDLLDLQQPTFHPSVHPMSTASQVASTWGDPFSATVDAVDDAIPSLNPFLTKSSGDVHLSISSDVSTFTTRTPTHEMFV
GFTPSPVAQPHPSAGLNVDFESVFGNKSTNVIVDSGGFDELGGLLKPTVASQNQNLPVAKLPPSKLVSDDLDSSLANLVGNLGIGNGTTK

>In-frame_KMT2A_ENST00000354520_chr11_118355029_+_PICALM_ENST00000532317_chr11_85718628_-_1762aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDTDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRTSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKTAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALTPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKQVGIDRGDIPDLSQAPSSLLDALEQHLASLEGKK
IKDSTAASRATTLSNAVSSLASTGLSLTKVDEREKQAALEEEQARLKALKEQRLKELAKKPHTSLTTAASPVSTSAGGIMTAPAIDIFST
PSSSNSTSKLPNDLLDLQQPTFHPSVHPMSTASQVASTWGGFTPSPVAQPHPSAGLNVDFESVFGNKSTNVIVDSGGFDELGGLLKPTVA
SQNQNLPVAKLPPSKLVSDDLDSSLANLVGNLGIGNGTTKNDVNWSQPGEKKLTGGSNWQPKVAPTTAWNAATMNGMHFPQYAPPVMATP

>In-frame_KMT2A_ENST00000354520_chr11_118355029_+_PICALM_ENST00000526033_chr11_85718628_-_1797aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDTDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRTSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKTAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALTPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKQVGIDRGDIPDLSQAPSSLLDALEQHLASLEGKK
IKDSTAASRATTLSNAVSSLASTGLSLTKVDEREKQAALEEEQARLKALKEQRLKELAKKPHTSLTTAASPVSTSAGGIMTAPAIDIFST
PSSSNSTSKLPNDLLDLQQPTFHPSVHPMSTASQVASTWGDAVDDAIPSLNPFLTKSSGDVHLSISSDVSTFTTRTPTHEMFVGFTPSPV
AQPHPSAGLNVDFESVFGNKSTNVIVDSGGFDELGGLLKPTVASQNQNLPVAKLPPSKLVSDDLDSSLANLVGNLGIGNGTTKNDVNWSQ

>In-frame_KMT2A_ENST00000354520_chr11_118355029_+_PICALM_ENST00000393346_chr11_85718628_-_1804aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDTDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRTSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKTAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALTPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKQVGIDRGDIPDLSQAPSSLLDALEQHLASLEGKK
IKDSTAASRATTLSNAVSSLASTGLSLTKVDEREKQAALEEEQARLKALKEQRLKELAKKPHTSLTTAASPVSTSAGGIMTAPAIDIFST
PSSSNSTSKLPNDLLDLQQPTFHPSVHPMSTASQVASTWGDPFSATVDAVDDAIPSLNPFLTKSSGDVHLSISSDVSTFTTRTPTHEMFV
GFTPSPVAQPHPSAGLNVDFESVFGNKSTNVIVDSGGFDELGGLLKPTVASQNQNLPVAKLPPSKLVSDDLDSSLANLVGNLGIGNGTTK
NDVNWSQPGEKKLTGGSNWQPKVAPTTAWNAATMAPPVMATPATTPTGMIGTGIPPQMGSVPVMTQPTLIYSQPVMRPPNPFGPVSGAQI

>In-frame_KMT2A_ENST00000354520_chr11_118355029_+_PICALM_ENST00000528398_chr11_85718628_-_1754aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDTDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRTSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKTAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALTPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKQVGIDRGDIPDLSQAPSSLLDALEQHLASLEGKK
IKDSTAASRATTLSNAVSSLASTGLSLTKVDEREKQAALEEEQARLKALKEQRLKELAKKPHTSLTTAASPVSTSAGGIMTAPAIDIFST
PSSSNSTSKLPNDLLDLQQPTFHPSVHPMSTASQVASTWGGFTPSPVAQPHPSAGLNVDFESVFGNKSTNVIVDSGGFDELGGLLKPTVA
SQNQNLPVAKLPPSKLVSDDLDSSLANLVGNLGIGNGTTKNDVNWSQPGEKKLTGGSNWQPKVAPTTAWNAATMAPPVMATPATTPTGMI

>In-frame_KMT2A_ENST00000354520_chr11_118355029_+_PICALM_ENST00000356360_chr11_85718628_-_1784aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDTDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRTSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKTAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALTPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKQVGIDRGDIPDLSQAPSSLLDALEQHLASLEGKK
IKDSTAASRATTLSNAVSSLASTGLSLTKVDEREKQAALEEEQARLKALKEQRLKELAKKPHTSLTTAASPVSTSAGGIMTAPAIDIFST
PSSSNSTSKLPNDLLDLQQPTFHPSVHPMSTASQVASTWGDPFSATVDAVDDAIPSLNPFLTKSSGDVHLSISSDVSTFTTRTPTHEMFV
GFTPSPVAQPHPSAGLNVDFESVFGNKSTNVIVDSGGFDELGGLLKPTVASQNQNLPVAKLPPSKLVSDDLDSSLANLVGNLGIGNGTTK


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_KMT2A_ENST00000534358_chr11_118355029_+_PICALM_ENST00000532317_chr11_85718628_-_5286nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGCAAGTTGGAATT
GACAGAGGTGATATACCAGACCTTTCACAGGCCCCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAA
ATCAAAGATTCTACAGCTGCAAGCAGGGCAACTACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTG
GATGAAAGGGAAAAGCAGGCAGCATTAGAGGAAGAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAA
CCTCATACCTCTTTAACAACTGCAGCCTCTCCTGTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACC
CCTAGTTCTTCTAACAGCACATCAAAGCTGCCCAATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCA
ACTGCTTCTCAGGTAGCAAGTACATGGGGAGGATTCACTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTT
GAATCTGTGTTTGGAAATAAATCTACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCC
TCTCAGAACCAGAACCTTCCTGTTGCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGC
AATCTTGGCATCGGAAATGGAACCACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAA
CCAAAGGTTGCACCAACAACCGCTTGGAATGCTGCAACAATGAATGGCATGCATTTTCCACAATACGCACCCCCTGTAATGGCCTATCCT
GCTACTACACCAACAGGCATGATAGGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGC

>In-frame_KMT2A_ENST00000534358_chr11_118355029_+_PICALM_ENST00000526033_chr11_85718628_-_5391nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGCAAGTTGGAATT
GACAGAGGTGATATACCAGACCTTTCACAGGCCCCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAA
ATCAAAGATTCTACAGCTGCAAGCAGGGCAACTACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTG
GATGAAAGGGAAAAGCAGGCAGCATTAGAGGAAGAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAA
CCTCATACCTCTTTAACAACTGCAGCCTCTCCTGTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACC
CCTAGTTCTTCTAACAGCACATCAAAGCTGCCCAATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCA
ACTGCTTCTCAGGTAGCAAGTACATGGGGAGATGCTGTTGATGATGCCATTCCAAGCTTAAATCCTTTCCTCACAAAAAGTAGTGGTGAT
GTTCACCTTTCCATTTCTTCAGATGTATCTACTTTTACTACTAGGACACCTACTCATGAAATGTTTGTTGGATTCACTCCTTCTCCAGTT
GCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCTACAAATGTTATTGTAGATTCTGGGGGC
TTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTTGCCAAACTCCCACCTAGCAAGTTAGTA
TCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACCACTAAGAATGATGTAAATTGGAGTCAA
CCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCTTGGAATGCTGCAACAATGGCACCCCCT
GTAATGGCCTATCCTGCTACTACACCAACAGGCATGATAGGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCA

>In-frame_KMT2A_ENST00000534358_chr11_118355029_+_PICALM_ENST00000393346_chr11_85718628_-_5412nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGCAAGTTGGAATT
GACAGAGGTGATATACCAGACCTTTCACAGGCCCCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAA
ATCAAAGATTCTACAGCTGCAAGCAGGGCAACTACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTG
GATGAAAGGGAAAAGCAGGCAGCATTAGAGGAAGAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAA
CCTCATACCTCTTTAACAACTGCAGCCTCTCCTGTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACC
CCTAGTTCTTCTAACAGCACATCAAAGCTGCCCAATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCA
ACTGCTTCTCAGGTAGCAAGTACATGGGGAGATCCTTTCTCTGCTACTGTAGATGCTGTTGATGATGCCATTCCAAGCTTAAATCCTTTC
CTCACAAAAAGTAGTGGTGATGTTCACCTTTCCATTTCTTCAGATGTATCTACTTTTACTACTAGGACACCTACTCATGAAATGTTTGTT
GGATTCACTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCTACAAAT
GTTATTGTAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTTGCCAAA
CTCCCACCTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACCACTAAG
AATGATGTAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCTTGGAAT
GCTGCAACAATGGCACCCCCTGTAATGGCCTATCCTGCTACTACACCAACAGGCATGATAGGATATGGAATTCCTCCACAAATGGGAAGT
GTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATA

>In-frame_KMT2A_ENST00000534358_chr11_118355029_+_PICALM_ENST00000528398_chr11_85718628_-_5262nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGCAAGTTGGAATT
GACAGAGGTGATATACCAGACCTTTCACAGGCCCCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAA
ATCAAAGATTCTACAGCTGCAAGCAGGGCAACTACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTG
GATGAAAGGGAAAAGCAGGCAGCATTAGAGGAAGAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAA
CCTCATACCTCTTTAACAACTGCAGCCTCTCCTGTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACC
CCTAGTTCTTCTAACAGCACATCAAAGCTGCCCAATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCA
ACTGCTTCTCAGGTAGCAAGTACATGGGGAGGATTCACTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTT
GAATCTGTGTTTGGAAATAAATCTACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCC
TCTCAGAACCAGAACCTTCCTGTTGCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGC
AATCTTGGCATCGGAAATGGAACCACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAA
CCAAAGGTTGCACCAACAACCGCTTGGAATGCTGCAACAATGGCACCCCCTGTAATGGCCTATCCTGCTACTACACCAACAGGCATGATA
GGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAAC

>In-frame_KMT2A_ENST00000534358_chr11_118355029_+_PICALM_ENST00000356360_chr11_85718628_-_5352nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGCAAGTTGGAATT
GACAGAGGTGATATACCAGACCTTTCACAGGCCCCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAA
ATCAAAGATTCTACAGCTGCAAGCAGGGCAACTACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTG
GATGAAAGGGAAAAGCAGGCAGCATTAGAGGAAGAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAA
CCTCATACCTCTTTAACAACTGCAGCCTCTCCTGTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACC
CCTAGTTCTTCTAACAGCACATCAAAGCTGCCCAATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCA
ACTGCTTCTCAGGTAGCAAGTACATGGGGAGATCCTTTCTCTGCTACTGTAGATGCTGTTGATGATGCCATTCCAAGCTTAAATCCTTTC
CTCACAAAAAGTAGTGGTGATGTTCACCTTTCCATTTCTTCAGATGTATCTACTTTTACTACTAGGACACCTACTCATGAAATGTTTGTT
GGATTCACTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCTACAAAT
GTTATTGTAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTTGCCAAA
CTCCCACCTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACCACTAAG
AATGATGTAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCTTGGAAT
GCTGCAACAATGCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAAC

>In-frame_KMT2A_ENST00000389506_chr11_118355029_+_PICALM_ENST00000532317_chr11_85718628_-_5286nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGCAAGTTGGAATT
GACAGAGGTGATATACCAGACCTTTCACAGGCCCCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAA
ATCAAAGATTCTACAGCTGCAAGCAGGGCAACTACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTG
GATGAAAGGGAAAAGCAGGCAGCATTAGAGGAAGAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAA
CCTCATACCTCTTTAACAACTGCAGCCTCTCCTGTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACC
CCTAGTTCTTCTAACAGCACATCAAAGCTGCCCAATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCA
ACTGCTTCTCAGGTAGCAAGTACATGGGGAGGATTCACTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTT
GAATCTGTGTTTGGAAATAAATCTACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCC
TCTCAGAACCAGAACCTTCCTGTTGCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGC
AATCTTGGCATCGGAAATGGAACCACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAA
CCAAAGGTTGCACCAACAACCGCTTGGAATGCTGCAACAATGAATGGCATGCATTTTCCACAATACGCACCCCCTGTAATGGCCTATCCT
GCTACTACACCAACAGGCATGATAGGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGC

>In-frame_KMT2A_ENST00000389506_chr11_118355029_+_PICALM_ENST00000526033_chr11_85718628_-_5391nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGCAAGTTGGAATT
GACAGAGGTGATATACCAGACCTTTCACAGGCCCCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAA
ATCAAAGATTCTACAGCTGCAAGCAGGGCAACTACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTG
GATGAAAGGGAAAAGCAGGCAGCATTAGAGGAAGAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAA
CCTCATACCTCTTTAACAACTGCAGCCTCTCCTGTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACC
CCTAGTTCTTCTAACAGCACATCAAAGCTGCCCAATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCA
ACTGCTTCTCAGGTAGCAAGTACATGGGGAGATGCTGTTGATGATGCCATTCCAAGCTTAAATCCTTTCCTCACAAAAAGTAGTGGTGAT
GTTCACCTTTCCATTTCTTCAGATGTATCTACTTTTACTACTAGGACACCTACTCATGAAATGTTTGTTGGATTCACTCCTTCTCCAGTT
GCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCTACAAATGTTATTGTAGATTCTGGGGGC
TTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTTGCCAAACTCCCACCTAGCAAGTTAGTA
TCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACCACTAAGAATGATGTAAATTGGAGTCAA
CCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCTTGGAATGCTGCAACAATGGCACCCCCT
GTAATGGCCTATCCTGCTACTACACCAACAGGCATGATAGGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCA

>In-frame_KMT2A_ENST00000389506_chr11_118355029_+_PICALM_ENST00000393346_chr11_85718628_-_5412nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGCAAGTTGGAATT
GACAGAGGTGATATACCAGACCTTTCACAGGCCCCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAA
ATCAAAGATTCTACAGCTGCAAGCAGGGCAACTACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTG
GATGAAAGGGAAAAGCAGGCAGCATTAGAGGAAGAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAA
CCTCATACCTCTTTAACAACTGCAGCCTCTCCTGTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACC
CCTAGTTCTTCTAACAGCACATCAAAGCTGCCCAATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCA
ACTGCTTCTCAGGTAGCAAGTACATGGGGAGATCCTTTCTCTGCTACTGTAGATGCTGTTGATGATGCCATTCCAAGCTTAAATCCTTTC
CTCACAAAAAGTAGTGGTGATGTTCACCTTTCCATTTCTTCAGATGTATCTACTTTTACTACTAGGACACCTACTCATGAAATGTTTGTT
GGATTCACTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCTACAAAT
GTTATTGTAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTTGCCAAA
CTCCCACCTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACCACTAAG
AATGATGTAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCTTGGAAT
GCTGCAACAATGGCACCCCCTGTAATGGCCTATCCTGCTACTACACCAACAGGCATGATAGGATATGGAATTCCTCCACAAATGGGAAGT
GTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATA

>In-frame_KMT2A_ENST00000389506_chr11_118355029_+_PICALM_ENST00000528398_chr11_85718628_-_5262nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGCAAGTTGGAATT
GACAGAGGTGATATACCAGACCTTTCACAGGCCCCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAA
ATCAAAGATTCTACAGCTGCAAGCAGGGCAACTACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTG
GATGAAAGGGAAAAGCAGGCAGCATTAGAGGAAGAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAA
CCTCATACCTCTTTAACAACTGCAGCCTCTCCTGTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACC
CCTAGTTCTTCTAACAGCACATCAAAGCTGCCCAATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCA
ACTGCTTCTCAGGTAGCAAGTACATGGGGAGGATTCACTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTT
GAATCTGTGTTTGGAAATAAATCTACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCC
TCTCAGAACCAGAACCTTCCTGTTGCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGC
AATCTTGGCATCGGAAATGGAACCACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAA
CCAAAGGTTGCACCAACAACCGCTTGGAATGCTGCAACAATGGCACCCCCTGTAATGGCCTATCCTGCTACTACACCAACAGGCATGATA
GGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAAC

>In-frame_KMT2A_ENST00000389506_chr11_118355029_+_PICALM_ENST00000356360_chr11_85718628_-_5352nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGCAAGTTGGAATT
GACAGAGGTGATATACCAGACCTTTCACAGGCCCCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAA
ATCAAAGATTCTACAGCTGCAAGCAGGGCAACTACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTG
GATGAAAGGGAAAAGCAGGCAGCATTAGAGGAAGAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAA
CCTCATACCTCTTTAACAACTGCAGCCTCTCCTGTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACC
CCTAGTTCTTCTAACAGCACATCAAAGCTGCCCAATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCA
ACTGCTTCTCAGGTAGCAAGTACATGGGGAGATCCTTTCTCTGCTACTGTAGATGCTGTTGATGATGCCATTCCAAGCTTAAATCCTTTC
CTCACAAAAAGTAGTGGTGATGTTCACCTTTCCATTTCTTCAGATGTATCTACTTTTACTACTAGGACACCTACTCATGAAATGTTTGTT
GGATTCACTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCTACAAAT
GTTATTGTAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTTGCCAAA
CTCCCACCTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACCACTAAG
AATGATGTAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCTTGGAAT
GCTGCAACAATGCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAAC

>In-frame_KMT2A_ENST00000354520_chr11_118355029_+_PICALM_ENST00000532317_chr11_85718628_-_5286nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGCAAGTTGGAATT
GACAGAGGTGATATACCAGACCTTTCACAGGCCCCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAA
ATCAAAGATTCTACAGCTGCAAGCAGGGCAACTACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTG
GATGAAAGGGAAAAGCAGGCAGCATTAGAGGAAGAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAA
CCTCATACCTCTTTAACAACTGCAGCCTCTCCTGTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACC
CCTAGTTCTTCTAACAGCACATCAAAGCTGCCCAATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCA
ACTGCTTCTCAGGTAGCAAGTACATGGGGAGGATTCACTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTT
GAATCTGTGTTTGGAAATAAATCTACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCC
TCTCAGAACCAGAACCTTCCTGTTGCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGC
AATCTTGGCATCGGAAATGGAACCACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAA
CCAAAGGTTGCACCAACAACCGCTTGGAATGCTGCAACAATGAATGGCATGCATTTTCCACAATACGCACCCCCTGTAATGGCCTATCCT
GCTACTACACCAACAGGCATGATAGGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGC

>In-frame_KMT2A_ENST00000354520_chr11_118355029_+_PICALM_ENST00000526033_chr11_85718628_-_5391nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGCAAGTTGGAATT
GACAGAGGTGATATACCAGACCTTTCACAGGCCCCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAA
ATCAAAGATTCTACAGCTGCAAGCAGGGCAACTACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTG
GATGAAAGGGAAAAGCAGGCAGCATTAGAGGAAGAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAA
CCTCATACCTCTTTAACAACTGCAGCCTCTCCTGTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACC
CCTAGTTCTTCTAACAGCACATCAAAGCTGCCCAATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCA
ACTGCTTCTCAGGTAGCAAGTACATGGGGAGATGCTGTTGATGATGCCATTCCAAGCTTAAATCCTTTCCTCACAAAAAGTAGTGGTGAT
GTTCACCTTTCCATTTCTTCAGATGTATCTACTTTTACTACTAGGACACCTACTCATGAAATGTTTGTTGGATTCACTCCTTCTCCAGTT
GCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCTACAAATGTTATTGTAGATTCTGGGGGC
TTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTTGCCAAACTCCCACCTAGCAAGTTAGTA
TCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACCACTAAGAATGATGTAAATTGGAGTCAA
CCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCTTGGAATGCTGCAACAATGGCACCCCCT
GTAATGGCCTATCCTGCTACTACACCAACAGGCATGATAGGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCA

>In-frame_KMT2A_ENST00000354520_chr11_118355029_+_PICALM_ENST00000393346_chr11_85718628_-_5412nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGCAAGTTGGAATT
GACAGAGGTGATATACCAGACCTTTCACAGGCCCCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAA
ATCAAAGATTCTACAGCTGCAAGCAGGGCAACTACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTG
GATGAAAGGGAAAAGCAGGCAGCATTAGAGGAAGAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAA
CCTCATACCTCTTTAACAACTGCAGCCTCTCCTGTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACC
CCTAGTTCTTCTAACAGCACATCAAAGCTGCCCAATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCA
ACTGCTTCTCAGGTAGCAAGTACATGGGGAGATCCTTTCTCTGCTACTGTAGATGCTGTTGATGATGCCATTCCAAGCTTAAATCCTTTC
CTCACAAAAAGTAGTGGTGATGTTCACCTTTCCATTTCTTCAGATGTATCTACTTTTACTACTAGGACACCTACTCATGAAATGTTTGTT
GGATTCACTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCTACAAAT
GTTATTGTAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTTGCCAAA
CTCCCACCTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACCACTAAG
AATGATGTAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCTTGGAAT
GCTGCAACAATGGCACCCCCTGTAATGGCCTATCCTGCTACTACACCAACAGGCATGATAGGATATGGAATTCCTCCACAAATGGGAAGT
GTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATA

>In-frame_KMT2A_ENST00000354520_chr11_118355029_+_PICALM_ENST00000528398_chr11_85718628_-_5262nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGCAAGTTGGAATT
GACAGAGGTGATATACCAGACCTTTCACAGGCCCCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAA
ATCAAAGATTCTACAGCTGCAAGCAGGGCAACTACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTG
GATGAAAGGGAAAAGCAGGCAGCATTAGAGGAAGAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAA
CCTCATACCTCTTTAACAACTGCAGCCTCTCCTGTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACC
CCTAGTTCTTCTAACAGCACATCAAAGCTGCCCAATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCA
ACTGCTTCTCAGGTAGCAAGTACATGGGGAGGATTCACTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTT
GAATCTGTGTTTGGAAATAAATCTACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCC
TCTCAGAACCAGAACCTTCCTGTTGCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGC
AATCTTGGCATCGGAAATGGAACCACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAA
CCAAAGGTTGCACCAACAACCGCTTGGAATGCTGCAACAATGGCACCCCCTGTAATGGCCTATCCTGCTACTACACCAACAGGCATGATA
GGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAAC

>In-frame_KMT2A_ENST00000354520_chr11_118355029_+_PICALM_ENST00000356360_chr11_85718628_-_5352nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGCAAGTTGGAATT
GACAGAGGTGATATACCAGACCTTTCACAGGCCCCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAA
ATCAAAGATTCTACAGCTGCAAGCAGGGCAACTACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTG
GATGAAAGGGAAAAGCAGGCAGCATTAGAGGAAGAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAA
CCTCATACCTCTTTAACAACTGCAGCCTCTCCTGTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACC
CCTAGTTCTTCTAACAGCACATCAAAGCTGCCCAATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCA
ACTGCTTCTCAGGTAGCAAGTACATGGGGAGATCCTTTCTCTGCTACTGTAGATGCTGTTGATGATGCCATTCCAAGCTTAAATCCTTTC
CTCACAAAAAGTAGTGGTGATGTTCACCTTTCCATTTCTTCAGATGTATCTACTTTTACTACTAGGACACCTACTCATGAAATGTTTGTT
GGATTCACTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCTACAAAT
GTTATTGTAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTTGCCAAA
CTCCCACCTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACCACTAAG
AATGATGTAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCTTGGAAT
GCTGCAACAATGCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAAC


* Fusion transcript sequences (Full-length transcript).
>In-frame_KMT2A_ENST00000534358_chr11_118355029_+_PICALM_ENST00000532317_chr11_85718628_-_6671nt
CTGCTTCACTTCACGGGGCGAACATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGG
GGCGCCGGGGCCTAGGGGGCGCCCCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGG
CGCCCCCCTCCCCCCCGGCTGTGGCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAG
CAGCCTCCTCGTCGTCCGCCTCGTCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCG
ACGCGGCGCTGCAGGTCTCGGCCGCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCG
GAGAGGATGAGCAATTCTTAGGTTTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTC
GAAAACCTCGTGGGAGACCTAGAAGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAG
AGACCAAATCTGGAGATAAGATCAAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAA
TCAAAATAACACATGGAAAGGACATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTA
CGTTTCAGCAAGCCACAAAGATTAAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAG
GAAGGAAGGGGGTACAAATTGTACGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTG
AACTGGAAAAGCCCCAGAAAGTCCGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTC
GAAGGATTAAGCCAGTTAGGATTATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGG
CTCAAAAGAAAATTGAAAAAGAAGCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTG
TTGTCAGTGCTATCTCCTCGCGGATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGAT
TAGAGTCTACACCGAATAGTAGATTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGT
CTTCAGACTCCTCTCGATCTAGTAGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGC
GGAGCGATACCCCTGAAGTTCATCCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAG
TGTCGGAGAGAAGTTTTGGATCTAGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTC
CACCTCTGCTGACTCCACCGCCACCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAG
CATCACCATTTTTGCCTGCTTCCACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAA
AGCATTCTAGGTCAGAGCCACAATACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGAC
CCCCTCCACTAACTCCCGAGGACGTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCC
ATTCTGGAACAAGGTTTGATATGCACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTG
AGTCTGTAACCTTGCCTAGTAATCGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTC
CTATTCGATCTGAACCAAGATCTCCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCC
CGTCTTCTGTCTCTTCCTCGTTAAGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCC
TGACTCAGTCTGGGGAATCTGCAGAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTA
CTCCTCTCTTCCCTTGGTTTACCCCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAG
ATGCTGACAAGAGCGTGGAGAAGGACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAA
GGAAAAAGGGATCAGAAATTCAGAGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCA
CTTCATCTTCTGCCAAAAAAGCAACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATA
CAACAGCTGTCAAAACCAAAATACTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCC
TGGAGAAGGAGAAAACCCTCTGCCTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGG
CAGACAAGCTTCCAATGACTGACAAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTC
TTAAACAAACCGACCAGCCCAAAGCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCA
GAAGAGCAGCTGTTGCCCTTGGCCGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAA
AGATTTTGTCTTCCATGGGGAATGATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTA
AACCTGTCACTAGAAACAAGGCACCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGG
TGCCTGAGGACTGTGGTGTTTGTACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAA
AATGTCAGAATCTACAATGGATGCCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCA
GTGAAAAGAAAGACAGCAAAGAGAGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTG
CCCCAAAGAAAAGCAGTAGTGAGCCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAAT
CCAAACAGGCCACCACTCCAGCTTCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAG
GACCGCCAAGAAAAGAAGTTCCCAAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCA
AACAGAAAAAAGTGGCTCCCCGCCCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGA
ATGCAGGCACTTTGAACATCCTCAGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAG
TGGACTTTAAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCCCCTAGCAGTCTTCTTGATGCTTTGGAACAACATT
TAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACTACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCA
CTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAAGAACAGGCACGTTTGAAAGCTTTAAAGGAACAGC
GCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCTGTATCCACCTCAGCAGGAGGGATAATGACTGCAC
CAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCCAATGATCTGCTTGATTTGCAGCAGCCAACTTTTC
ACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGGATTCACTCCTTCTCCAGTTGCACAGCCACACCCTT
CAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCTACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTAGGTG
GACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTTGCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTGGATT
CATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACCACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAGAAGT
TAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCTTGGAATGCTGCAACAATGAATGGCATGCATTTTCCACAATACG
CACCCCCTGTAATGGCCTATCCTGCTACTACACCAACAGGCATGATAGGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGA
CGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAAC
TTGATGGAAGAAAATGGAATTACTCCAAAAAGACAAGTGCTCAAGCAGCAAAATCCTTACTTCCAGCAAAATCCAAACTGCTGTCTCTTA
AATCTCTTAAACTCTCTTCTTCCATTAGAATGCTACAAGTAACTCAGTGAAGGCCCATGAAGGAAATTGGGACTAGTTTATAGGAGAACG
TATCAATACAGTTTATAAAGCCAAGAATTGCTATGATTTAAGACTAAGATCTGTCTTTTTGGTGACTAACCCTTCAATTCTTTCAACTCC
TGTTAATACCCATAATCAGTAACCTATCAAGAAAAGCCCTTATTTGGAAAGTGTGAAATTTGTATTTGGAAAAGCTGCCTGGAGAGAAGA
ACTGTGTCCTTTACTGTATTTCAACAGGACTCTTTTGGGGGATCAAAATTAAAATTCCTAATTATGCATTATCTTTCTTTTCTCCAGTCC
TCACAAATACAGAAACAATAACTGAAATTAACTTTTCTTTTTTTAAAAAAAATTATATTCAGTTTGCAGTAGACATTCCTTAAGTATTTG
TATTTATTTATGATTATCAATTTTACATAACATTAATATTGTATCAGACCTCCTTATGAAAATGAGTATGGATGTGCACAGTATGTTTGA
TTTTTATCCACAAGAATGAATCTGATTCAGAATGCTTTTCTCAGCTGACATACAGAGCACTAAATATTTTAAGGCAAGTCCATAGGTCTG
AATCTCTTAAGAATTCTCGGCCTCTGTGGGATTTAGGGAAGCATTATAAATGCATTAATCCTTATAGTCAATTCTGTGCCTAGGATTTTG
CCAGGGAACAGTTCACTGACTAGGAAAAGCACTACATTTTAAATTCAGCATTAGTGCATTGGGAAGGATCTTTACTGCTTTGTGCTTGGC
ATGTCATTATTTTCCATTTGACATTAGGGCCTTTCCAAAATGAATGTGAGGAATTGCTTTCACTTCAAGACTTTCCTTCTTTTCACTAAA
ACTCTAGAAGGTGTTACAAGGGGGAGGGAAGGGGGGCAAAGTCCTTGAACATTTTCTTTGGCTCGTGCCATGTTATGATCATATACCTTT
TAAATAAGGGGAAATAGTATCTTTAAAGTTAATGTCTAGCCAAGAGTTTAGTAAACGAAGAATTAAACTGCACTGTTGATCGGTGCTTTG
TGTAAATACATCTTTAACATTTGGGTGGAGAGGGGCCTTAAGAAGGACAGTTCATTGTAGGAAAGCAATTCTGTACATGAGTTTAAGCAT
TCTTGTTGCATTGTCTCTGCAGATTCTATTTTTGTTTACAATATTAAAATGTATGTTAGCAAAATGGGTGGATTTTCAAATAAAATGCAG

>In-frame_KMT2A_ENST00000534358_chr11_118355029_+_PICALM_ENST00000526033_chr11_85718628_-_6772nt
CTGCTTCACTTCACGGGGCGAACATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGG
GGCGCCGGGGCCTAGGGGGCGCCCCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGG
CGCCCCCCTCCCCCCCGGCTGTGGCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAG
CAGCCTCCTCGTCGTCCGCCTCGTCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCG
ACGCGGCGCTGCAGGTCTCGGCCGCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCG
GAGAGGATGAGCAATTCTTAGGTTTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTC
GAAAACCTCGTGGGAGACCTAGAAGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAG
AGACCAAATCTGGAGATAAGATCAAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAA
TCAAAATAACACATGGAAAGGACATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTA
CGTTTCAGCAAGCCACAAAGATTAAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAG
GAAGGAAGGGGGTACAAATTGTACGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTG
AACTGGAAAAGCCCCAGAAAGTCCGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTC
GAAGGATTAAGCCAGTTAGGATTATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGG
CTCAAAAGAAAATTGAAAAAGAAGCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTG
TTGTCAGTGCTATCTCCTCGCGGATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGAT
TAGAGTCTACACCGAATAGTAGATTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGT
CTTCAGACTCCTCTCGATCTAGTAGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGC
GGAGCGATACCCCTGAAGTTCATCCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAG
TGTCGGAGAGAAGTTTTGGATCTAGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTC
CACCTCTGCTGACTCCACCGCCACCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAG
CATCACCATTTTTGCCTGCTTCCACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAA
AGCATTCTAGGTCAGAGCCACAATACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGAC
CCCCTCCACTAACTCCCGAGGACGTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCC
ATTCTGGAACAAGGTTTGATATGCACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTG
AGTCTGTAACCTTGCCTAGTAATCGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTC
CTATTCGATCTGAACCAAGATCTCCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCC
CGTCTTCTGTCTCTTCCTCGTTAAGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCC
TGACTCAGTCTGGGGAATCTGCAGAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTA
CTCCTCTCTTCCCTTGGTTTACCCCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAG
ATGCTGACAAGAGCGTGGAGAAGGACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAA
GGAAAAAGGGATCAGAAATTCAGAGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCA
CTTCATCTTCTGCCAAAAAAGCAACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATA
CAACAGCTGTCAAAACCAAAATACTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCC
TGGAGAAGGAGAAAACCCTCTGCCTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGG
CAGACAAGCTTCCAATGACTGACAAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTC
TTAAACAAACCGACCAGCCCAAAGCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCA
GAAGAGCAGCTGTTGCCCTTGGCCGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAA
AGATTTTGTCTTCCATGGGGAATGATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTA
AACCTGTCACTAGAAACAAGGCACCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGG
TGCCTGAGGACTGTGGTGTTTGTACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAA
AATGTCAGAATCTACAATGGATGCCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCA
GTGAAAAGAAAGACAGCAAAGAGAGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTG
CCCCAAAGAAAAGCAGTAGTGAGCCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAAT
CCAAACAGGCCACCACTCCAGCTTCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAG
GACCGCCAAGAAAAGAAGTTCCCAAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCA
AACAGAAAAAAGTGGCTCCCCGCCCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGA
ATGCAGGCACTTTGAACATCCTCAGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAG
TGGACTTTAAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCCCCTAGCAGTCTTCTTGATGCTTTGGAACAACATT
TAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACTACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCA
CTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAAGAACAGGCACGTTTGAAAGCTTTAAAGGAACAGC
GCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCTGTATCCACCTCAGCAGGAGGGATAATGACTGCAC
CAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCCAATGATCTGCTTGATTTGCAGCAGCCAACTTTTC
ACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGATGCTGTTGATGATGCCATTCCAAGCTTAAATCCTT
TCCTCACAAAAAGTAGTGGTGATGTTCACCTTTCCATTTCTTCAGATGTATCTACTTTTACTACTAGGACACCTACTCATGAAATGTTTG
TTGGATTCACTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCTACAA
ATGTTATTGTAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTTGCCA
AACTCCCACCTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACCACTA
AGAATGATGTAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCTTGGA
ATGCTGCAACAATGGCACCCCCTGTAATGGCCTATCCTGCTACTACACCAACAGGCATGATAGGATATGGAATTCCTCCACAAATGGGAA
GTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGA
TACAGTTTATGTAACTTGATGGAAGAAAATGGAATTACTCCAAAAAGACAAGTGCTCAAGCAGCAAAATCCTTACTTCCAGCAAAATCCA
AACTGCTGTCTCTTAAATCTCTTAAACTCTCTTCTTCCATTAGAATGCTACAAGTAACTCAGTGAAGGCCCATGAAGGAAATTGGGACTA
GTTTATAGGAGAACGTATCAATACAGTTTATAAAGCCAAGAATTGCTATGATTTAAGACTAAGATCTGTCTTTTTGGTGACTAACCCTTC
AATTCTTTCAACTCCTGTTAATACCCATAATCAGTAACCTATCAAGAAAAGCCCTTATTTGGAAAGTGTGAAATTTGTATTTGGAAAAGC
TGCCTGGAGAGAAGAACTGTGTCCTTTACTGTATTTCAACAGGACTCTTTTGGGGGATCAAAATTAAAATTCCTAATTATGCATTATCTT
TCTTTTCTCCAGTCCTCACAAATACAGAAACAATAACTGAAATTAACTTTTCTTTTTTTAAAAAAAATTATATTCAGTTTGCAGTAGACA
TTCCTTAAGTATTTGTATTTATTTATGATTATCAATTTTACATAACATTAATATTGTATCAGACCTCCTTATGAAAATGAGTATGGATGT
GCACAGTATGTTTGATTTTTATCCACAAGAATGAATCTGATTCAGAATGCTTTTCTCAGCTGACATACAGAGCACTAAATATTTTAAGGC
AAGTCCATAGGTCTGAATCTCTTAAGAATTCTCGGCCTCTGTGGGATTTAGGGAAGCATTATAAATGCATTAATCCTTATAGTCAATTCT
GTGCCTAGGATTTTGCCAGGGAACAGTTCACTGACTAGGAAAAGCACTACATTTTAAATTCAGCATTAGTGCATTGGGAAGGATCTTTAC
TGCTTTGTGCTTGGCATGTCATTATTTTCCATTTGACATTAGGGCCTTTCCAAAATGAATGTGAGGAATTGCTTTCACTTCAAGACTTTC
CTTCTTTTCACTAAAACTCTAGAAGGTGTTACAAGGGGGAGGGAAGGGGGGCAAAGTCCTTGAACATTTTCTTTGGCTCGTGCCATGTTA
TGATCATATACCTTTTAAATAAGGGGAAATAGTATCTTTAAAGTTAATGTCTAGCCAAGAGTTTAGTAAACGAAGAATTAAACTGCACTG
TTGATCGGTGCTTTGTGTAAATACATCTTTAACATTTGGGTGGAGAGGGGCCTTAAGAAGGACAGTTCATTGTAGGAAAGCAATTCTGTA
CATGAGTTTAAGCATTCTTGTTGCATTGTCTCTGCAGATTCTATTTTTGTTTACAATATTAAAATGTATGTTAGCAAAATGGGTGGATTT

>In-frame_KMT2A_ENST00000534358_chr11_118355029_+_PICALM_ENST00000393346_chr11_85718628_-_5667nt
CTGCTTCACTTCACGGGGCGAACATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGG
GGCGCCGGGGCCTAGGGGGCGCCCCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGG
CGCCCCCCTCCCCCCCGGCTGTGGCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAG
CAGCCTCCTCGTCGTCCGCCTCGTCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCG
ACGCGGCGCTGCAGGTCTCGGCCGCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCG
GAGAGGATGAGCAATTCTTAGGTTTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTC
GAAAACCTCGTGGGAGACCTAGAAGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAG
AGACCAAATCTGGAGATAAGATCAAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAA
TCAAAATAACACATGGAAAGGACATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTA
CGTTTCAGCAAGCCACAAAGATTAAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAG
GAAGGAAGGGGGTACAAATTGTACGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTG
AACTGGAAAAGCCCCAGAAAGTCCGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTC
GAAGGATTAAGCCAGTTAGGATTATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGG
CTCAAAAGAAAATTGAAAAAGAAGCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTG
TTGTCAGTGCTATCTCCTCGCGGATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGAT
TAGAGTCTACACCGAATAGTAGATTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGT
CTTCAGACTCCTCTCGATCTAGTAGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGC
GGAGCGATACCCCTGAAGTTCATCCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAG
TGTCGGAGAGAAGTTTTGGATCTAGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTC
CACCTCTGCTGACTCCACCGCCACCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAG
CATCACCATTTTTGCCTGCTTCCACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAA
AGCATTCTAGGTCAGAGCCACAATACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGAC
CCCCTCCACTAACTCCCGAGGACGTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCC
ATTCTGGAACAAGGTTTGATATGCACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTG
AGTCTGTAACCTTGCCTAGTAATCGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTC
CTATTCGATCTGAACCAAGATCTCCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCC
CGTCTTCTGTCTCTTCCTCGTTAAGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCC
TGACTCAGTCTGGGGAATCTGCAGAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTA
CTCCTCTCTTCCCTTGGTTTACCCCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAG
ATGCTGACAAGAGCGTGGAGAAGGACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAA
GGAAAAAGGGATCAGAAATTCAGAGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCA
CTTCATCTTCTGCCAAAAAAGCAACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATA
CAACAGCTGTCAAAACCAAAATACTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCC
TGGAGAAGGAGAAAACCCTCTGCCTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGG
CAGACAAGCTTCCAATGACTGACAAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTC
TTAAACAAACCGACCAGCCCAAAGCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCA
GAAGAGCAGCTGTTGCCCTTGGCCGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAA
AGATTTTGTCTTCCATGGGGAATGATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTA
AACCTGTCACTAGAAACAAGGCACCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGG
TGCCTGAGGACTGTGGTGTTTGTACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAA
AATGTCAGAATCTACAATGGATGCCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCA
GTGAAAAGAAAGACAGCAAAGAGAGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTG
CCCCAAAGAAAAGCAGTAGTGAGCCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAAT
CCAAACAGGCCACCACTCCAGCTTCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAG
GACCGCCAAGAAAAGAAGTTCCCAAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCA
AACAGAAAAAAGTGGCTCCCCGCCCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGA
ATGCAGGCACTTTGAACATCCTCAGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAG
TGGACTTTAAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCCCCTAGCAGTCTTCTTGATGCTTTGGAACAACATT
TAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACTACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCA
CTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAAGAACAGGCACGTTTGAAAGCTTTAAAGGAACAGC
GCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCTGTATCCACCTCAGCAGGAGGGATAATGACTGCAC
CAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCCAATGATCTGCTTGATTTGCAGCAGCCAACTTTTC
ACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGATCCTTTCTCTGCTACTGTAGATGCTGTTGATGATG
CCATTCCAAGCTTAAATCCTTTCCTCACAAAAAGTAGTGGTGATGTTCACCTTTCCATTTCTTCAGATGTATCTACTTTTACTACTAGGA
CACCTACTCATGAAATGTTTGTTGGATTCACTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTTGAATCTG
TGTTTGGAAATAAATCTACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCCTCTCAGA
ACCAGAACCTTCCTGTTGCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGCAATCTTG
GCATCGGAAATGGAACCACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAACCAAAGG
TTGCACCAACAACCGCTTGGAATGCTGCAACAATGGCACCCCCTGTAATGGCCTATCCTGCTACTACACCAACAGGCATGATAGGATATG
GAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTG
GCCCTGTATCAGGAGCACAGATACAGTTTATGTAACTTGATGGAAGAAAATGGAATTACTCCAAAAAGACAAGTGCTCAAGCAGCAAAAT
CCTTACTTCCAGCAAAATCCAAACTGCTGTCTCTTAAATCTCTTAAACTCTCTTCTTCCATTAGAATGCTACAAGTAACTCAGTGAAGGC

>In-frame_KMT2A_ENST00000534358_chr11_118355029_+_PICALM_ENST00000528398_chr11_85718628_-_5492nt
CTGCTTCACTTCACGGGGCGAACATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGG
GGCGCCGGGGCCTAGGGGGCGCCCCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGG
CGCCCCCCTCCCCCCCGGCTGTGGCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAG
CAGCCTCCTCGTCGTCCGCCTCGTCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCG
ACGCGGCGCTGCAGGTCTCGGCCGCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCG
GAGAGGATGAGCAATTCTTAGGTTTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTC
GAAAACCTCGTGGGAGACCTAGAAGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAG
AGACCAAATCTGGAGATAAGATCAAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAA
TCAAAATAACACATGGAAAGGACATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTA
CGTTTCAGCAAGCCACAAAGATTAAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAG
GAAGGAAGGGGGTACAAATTGTACGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTG
AACTGGAAAAGCCCCAGAAAGTCCGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTC
GAAGGATTAAGCCAGTTAGGATTATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGG
CTCAAAAGAAAATTGAAAAAGAAGCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTG
TTGTCAGTGCTATCTCCTCGCGGATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGAT
TAGAGTCTACACCGAATAGTAGATTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGT
CTTCAGACTCCTCTCGATCTAGTAGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGC
GGAGCGATACCCCTGAAGTTCATCCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAG
TGTCGGAGAGAAGTTTTGGATCTAGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTC
CACCTCTGCTGACTCCACCGCCACCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAG
CATCACCATTTTTGCCTGCTTCCACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAA
AGCATTCTAGGTCAGAGCCACAATACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGAC
CCCCTCCACTAACTCCCGAGGACGTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCC
ATTCTGGAACAAGGTTTGATATGCACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTG
AGTCTGTAACCTTGCCTAGTAATCGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTC
CTATTCGATCTGAACCAAGATCTCCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCC
CGTCTTCTGTCTCTTCCTCGTTAAGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCC
TGACTCAGTCTGGGGAATCTGCAGAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTA
CTCCTCTCTTCCCTTGGTTTACCCCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAG
ATGCTGACAAGAGCGTGGAGAAGGACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAA
GGAAAAAGGGATCAGAAATTCAGAGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCA
CTTCATCTTCTGCCAAAAAAGCAACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATA
CAACAGCTGTCAAAACCAAAATACTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCC
TGGAGAAGGAGAAAACCCTCTGCCTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGG
CAGACAAGCTTCCAATGACTGACAAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTC
TTAAACAAACCGACCAGCCCAAAGCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCA
GAAGAGCAGCTGTTGCCCTTGGCCGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAA
AGATTTTGTCTTCCATGGGGAATGATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTA
AACCTGTCACTAGAAACAAGGCACCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGG
TGCCTGAGGACTGTGGTGTTTGTACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAA
AATGTCAGAATCTACAATGGATGCCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCA
GTGAAAAGAAAGACAGCAAAGAGAGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTG
CCCCAAAGAAAAGCAGTAGTGAGCCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAAT
CCAAACAGGCCACCACTCCAGCTTCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAG
GACCGCCAAGAAAAGAAGTTCCCAAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCA
AACAGAAAAAAGTGGCTCCCCGCCCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGA
ATGCAGGCACTTTGAACATCCTCAGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAG
TGGACTTTAAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCCCCTAGCAGTCTTCTTGATGCTTTGGAACAACATT
TAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACTACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCA
CTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAAGAACAGGCACGTTTGAAAGCTTTAAAGGAACAGC
GCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCTGTATCCACCTCAGCAGGAGGGATAATGACTGCAC
CAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCCAATGATCTGCTTGATTTGCAGCAGCCAACTTTTC
ACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGGATTCACTCCTTCTCCAGTTGCACAGCCACACCCTT
CAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCTACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTAGGTG
GACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTTGCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTGGATT
CATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACCACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAGAAGT
TAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCTTGGAATGCTGCAACAATGGCACCCCCTGTAATGGCCTATCCTG
CTACTACACCAACAGGCATGATAGGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCC
AGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAACTTGATGGAAGAAAATGGAATTACT
CCAAAAAGACAAGTGCTCAAGCAGCAAAATCCTTACTTCCAGCAAAATCCAAACTGCTGTCTCTTAAATCTCTTAAACTCTCTTCTTCCA
TTAGAATGCTACAAGTAACTCAGTGAAGGCCCATGAAGGAAATTGGGACTAGTTTATAGGAGAACGTATCAATACAGTTTATAAAGCCAA

>In-frame_KMT2A_ENST00000534358_chr11_118355029_+_PICALM_ENST00000356360_chr11_85718628_-_5434nt
CTGCTTCACTTCACGGGGCGAACATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGG
GGCGCCGGGGCCTAGGGGGCGCCCCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGG
CGCCCCCCTCCCCCCCGGCTGTGGCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAG
CAGCCTCCTCGTCGTCCGCCTCGTCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCG
ACGCGGCGCTGCAGGTCTCGGCCGCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCG
GAGAGGATGAGCAATTCTTAGGTTTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTC
GAAAACCTCGTGGGAGACCTAGAAGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAG
AGACCAAATCTGGAGATAAGATCAAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAA
TCAAAATAACACATGGAAAGGACATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTA
CGTTTCAGCAAGCCACAAAGATTAAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAG
GAAGGAAGGGGGTACAAATTGTACGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTG
AACTGGAAAAGCCCCAGAAAGTCCGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTC
GAAGGATTAAGCCAGTTAGGATTATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGG
CTCAAAAGAAAATTGAAAAAGAAGCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTG
TTGTCAGTGCTATCTCCTCGCGGATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGAT
TAGAGTCTACACCGAATAGTAGATTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGT
CTTCAGACTCCTCTCGATCTAGTAGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGC
GGAGCGATACCCCTGAAGTTCATCCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAG
TGTCGGAGAGAAGTTTTGGATCTAGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTC
CACCTCTGCTGACTCCACCGCCACCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAG
CATCACCATTTTTGCCTGCTTCCACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAA
AGCATTCTAGGTCAGAGCCACAATACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGAC
CCCCTCCACTAACTCCCGAGGACGTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCC
ATTCTGGAACAAGGTTTGATATGCACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTG
AGTCTGTAACCTTGCCTAGTAATCGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTC
CTATTCGATCTGAACCAAGATCTCCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCC
CGTCTTCTGTCTCTTCCTCGTTAAGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCC
TGACTCAGTCTGGGGAATCTGCAGAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTA
CTCCTCTCTTCCCTTGGTTTACCCCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAG
ATGCTGACAAGAGCGTGGAGAAGGACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAA
GGAAAAAGGGATCAGAAATTCAGAGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCA
CTTCATCTTCTGCCAAAAAAGCAACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATA
CAACAGCTGTCAAAACCAAAATACTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCC
TGGAGAAGGAGAAAACCCTCTGCCTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGG
CAGACAAGCTTCCAATGACTGACAAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTC
TTAAACAAACCGACCAGCCCAAAGCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCA
GAAGAGCAGCTGTTGCCCTTGGCCGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAA
AGATTTTGTCTTCCATGGGGAATGATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTA
AACCTGTCACTAGAAACAAGGCACCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGG
TGCCTGAGGACTGTGGTGTTTGTACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAA
AATGTCAGAATCTACAATGGATGCCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCA
GTGAAAAGAAAGACAGCAAAGAGAGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTG
CCCCAAAGAAAAGCAGTAGTGAGCCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAAT
CCAAACAGGCCACCACTCCAGCTTCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAG
GACCGCCAAGAAAAGAAGTTCCCAAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCA
AACAGAAAAAAGTGGCTCCCCGCCCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGA
ATGCAGGCACTTTGAACATCCTCAGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAG
TGGACTTTAAGCAAGTTGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCCCCTAGCAGTCTTCTTGATGCTTTGGAACAACATT
TAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACTACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCA
CTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGCATTAGAGGAAGAACAGGCACGTTTGAAAGCTTTAAAGGAACAGC
GCCTAAAAGAACTTGCAAAGAAACCTCATACCTCTTTAACAACTGCAGCCTCTCCTGTATCCACCTCAGCAGGAGGGATAATGACTGCAC
CAGCCATTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCCAATGATCTGCTTGATTTGCAGCAGCCAACTTTTC
ACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGATCCTTTCTCTGCTACTGTAGATGCTGTTGATGATG
CCATTCCAAGCTTAAATCCTTTCCTCACAAAAAGTAGTGGTGATGTTCACCTTTCCATTTCTTCAGATGTATCTACTTTTACTACTAGGA
CACCTACTCATGAAATGTTTGTTGGATTCACTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTTGAATCTG
TGTTTGGAAATAAATCTACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCCTCTCAGA
ACCAGAACCTTCCTGTTGCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGCAATCTTG
GCATCGGAAATGGAACCACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAACCAAAGG
TTGCACCAACAACCGCTTGGAATGCTGCAACAATGCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCC
AGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAACTTGATGGAAGAAAATGGAATTACT

>In-frame_KMT2A_ENST00000389506_chr11_118355029_+_PICALM_ENST00000532317_chr11_85718628_-_6648nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGCAAGTTGGAATT
GACAGAGGTGATATACCAGACCTTTCACAGGCCCCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAA
ATCAAAGATTCTACAGCTGCAAGCAGGGCAACTACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTG
GATGAAAGGGAAAAGCAGGCAGCATTAGAGGAAGAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAA
CCTCATACCTCTTTAACAACTGCAGCCTCTCCTGTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACC
CCTAGTTCTTCTAACAGCACATCAAAGCTGCCCAATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCA
ACTGCTTCTCAGGTAGCAAGTACATGGGGAGGATTCACTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTT
GAATCTGTGTTTGGAAATAAATCTACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCC
TCTCAGAACCAGAACCTTCCTGTTGCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGC
AATCTTGGCATCGGAAATGGAACCACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAA
CCAAAGGTTGCACCAACAACCGCTTGGAATGCTGCAACAATGAATGGCATGCATTTTCCACAATACGCACCCCCTGTAATGGCCTATCCT
GCTACTACACCAACAGGCATGATAGGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGC
CAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAACTTGATGGAAGAAAATGGAATTAC
TCCAAAAAGACAAGTGCTCAAGCAGCAAAATCCTTACTTCCAGCAAAATCCAAACTGCTGTCTCTTAAATCTCTTAAACTCTCTTCTTCC
ATTAGAATGCTACAAGTAACTCAGTGAAGGCCCATGAAGGAAATTGGGACTAGTTTATAGGAGAACGTATCAATACAGTTTATAAAGCCA
AGAATTGCTATGATTTAAGACTAAGATCTGTCTTTTTGGTGACTAACCCTTCAATTCTTTCAACTCCTGTTAATACCCATAATCAGTAAC
CTATCAAGAAAAGCCCTTATTTGGAAAGTGTGAAATTTGTATTTGGAAAAGCTGCCTGGAGAGAAGAACTGTGTCCTTTACTGTATTTCA
ACAGGACTCTTTTGGGGGATCAAAATTAAAATTCCTAATTATGCATTATCTTTCTTTTCTCCAGTCCTCACAAATACAGAAACAATAACT
GAAATTAACTTTTCTTTTTTTAAAAAAAATTATATTCAGTTTGCAGTAGACATTCCTTAAGTATTTGTATTTATTTATGATTATCAATTT
TACATAACATTAATATTGTATCAGACCTCCTTATGAAAATGAGTATGGATGTGCACAGTATGTTTGATTTTTATCCACAAGAATGAATCT
GATTCAGAATGCTTTTCTCAGCTGACATACAGAGCACTAAATATTTTAAGGCAAGTCCATAGGTCTGAATCTCTTAAGAATTCTCGGCCT
CTGTGGGATTTAGGGAAGCATTATAAATGCATTAATCCTTATAGTCAATTCTGTGCCTAGGATTTTGCCAGGGAACAGTTCACTGACTAG
GAAAAGCACTACATTTTAAATTCAGCATTAGTGCATTGGGAAGGATCTTTACTGCTTTGTGCTTGGCATGTCATTATTTTCCATTTGACA
TTAGGGCCTTTCCAAAATGAATGTGAGGAATTGCTTTCACTTCAAGACTTTCCTTCTTTTCACTAAAACTCTAGAAGGTGTTACAAGGGG
GAGGGAAGGGGGGCAAAGTCCTTGAACATTTTCTTTGGCTCGTGCCATGTTATGATCATATACCTTTTAAATAAGGGGAAATAGTATCTT
TAAAGTTAATGTCTAGCCAAGAGTTTAGTAAACGAAGAATTAAACTGCACTGTTGATCGGTGCTTTGTGTAAATACATCTTTAACATTTG
GGTGGAGAGGGGCCTTAAGAAGGACAGTTCATTGTAGGAAAGCAATTCTGTACATGAGTTTAAGCATTCTTGTTGCATTGTCTCTGCAGA

>In-frame_KMT2A_ENST00000389506_chr11_118355029_+_PICALM_ENST00000526033_chr11_85718628_-_6749nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGCAAGTTGGAATT
GACAGAGGTGATATACCAGACCTTTCACAGGCCCCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAA
ATCAAAGATTCTACAGCTGCAAGCAGGGCAACTACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTG
GATGAAAGGGAAAAGCAGGCAGCATTAGAGGAAGAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAA
CCTCATACCTCTTTAACAACTGCAGCCTCTCCTGTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACC
CCTAGTTCTTCTAACAGCACATCAAAGCTGCCCAATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCA
ACTGCTTCTCAGGTAGCAAGTACATGGGGAGATGCTGTTGATGATGCCATTCCAAGCTTAAATCCTTTCCTCACAAAAAGTAGTGGTGAT
GTTCACCTTTCCATTTCTTCAGATGTATCTACTTTTACTACTAGGACACCTACTCATGAAATGTTTGTTGGATTCACTCCTTCTCCAGTT
GCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCTACAAATGTTATTGTAGATTCTGGGGGC
TTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTTGCCAAACTCCCACCTAGCAAGTTAGTA
TCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACCACTAAGAATGATGTAAATTGGAGTCAA
CCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCTTGGAATGCTGCAACAATGGCACCCCCT
GTAATGGCCTATCCTGCTACTACACCAACAGGCATGATAGGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCA
ACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAACTTGATGGA
AGAAAATGGAATTACTCCAAAAAGACAAGTGCTCAAGCAGCAAAATCCTTACTTCCAGCAAAATCCAAACTGCTGTCTCTTAAATCTCTT
AAACTCTCTTCTTCCATTAGAATGCTACAAGTAACTCAGTGAAGGCCCATGAAGGAAATTGGGACTAGTTTATAGGAGAACGTATCAATA
CAGTTTATAAAGCCAAGAATTGCTATGATTTAAGACTAAGATCTGTCTTTTTGGTGACTAACCCTTCAATTCTTTCAACTCCTGTTAATA
CCCATAATCAGTAACCTATCAAGAAAAGCCCTTATTTGGAAAGTGTGAAATTTGTATTTGGAAAAGCTGCCTGGAGAGAAGAACTGTGTC
CTTTACTGTATTTCAACAGGACTCTTTTGGGGGATCAAAATTAAAATTCCTAATTATGCATTATCTTTCTTTTCTCCAGTCCTCACAAAT
ACAGAAACAATAACTGAAATTAACTTTTCTTTTTTTAAAAAAAATTATATTCAGTTTGCAGTAGACATTCCTTAAGTATTTGTATTTATT
TATGATTATCAATTTTACATAACATTAATATTGTATCAGACCTCCTTATGAAAATGAGTATGGATGTGCACAGTATGTTTGATTTTTATC
CACAAGAATGAATCTGATTCAGAATGCTTTTCTCAGCTGACATACAGAGCACTAAATATTTTAAGGCAAGTCCATAGGTCTGAATCTCTT
AAGAATTCTCGGCCTCTGTGGGATTTAGGGAAGCATTATAAATGCATTAATCCTTATAGTCAATTCTGTGCCTAGGATTTTGCCAGGGAA
CAGTTCACTGACTAGGAAAAGCACTACATTTTAAATTCAGCATTAGTGCATTGGGAAGGATCTTTACTGCTTTGTGCTTGGCATGTCATT
ATTTTCCATTTGACATTAGGGCCTTTCCAAAATGAATGTGAGGAATTGCTTTCACTTCAAGACTTTCCTTCTTTTCACTAAAACTCTAGA
AGGTGTTACAAGGGGGAGGGAAGGGGGGCAAAGTCCTTGAACATTTTCTTTGGCTCGTGCCATGTTATGATCATATACCTTTTAAATAAG
GGGAAATAGTATCTTTAAAGTTAATGTCTAGCCAAGAGTTTAGTAAACGAAGAATTAAACTGCACTGTTGATCGGTGCTTTGTGTAAATA
CATCTTTAACATTTGGGTGGAGAGGGGCCTTAAGAAGGACAGTTCATTGTAGGAAAGCAATTCTGTACATGAGTTTAAGCATTCTTGTTG

>In-frame_KMT2A_ENST00000389506_chr11_118355029_+_PICALM_ENST00000393346_chr11_85718628_-_5644nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGCAAGTTGGAATT
GACAGAGGTGATATACCAGACCTTTCACAGGCCCCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAA
ATCAAAGATTCTACAGCTGCAAGCAGGGCAACTACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTG
GATGAAAGGGAAAAGCAGGCAGCATTAGAGGAAGAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAA
CCTCATACCTCTTTAACAACTGCAGCCTCTCCTGTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACC
CCTAGTTCTTCTAACAGCACATCAAAGCTGCCCAATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCA
ACTGCTTCTCAGGTAGCAAGTACATGGGGAGATCCTTTCTCTGCTACTGTAGATGCTGTTGATGATGCCATTCCAAGCTTAAATCCTTTC
CTCACAAAAAGTAGTGGTGATGTTCACCTTTCCATTTCTTCAGATGTATCTACTTTTACTACTAGGACACCTACTCATGAAATGTTTGTT
GGATTCACTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCTACAAAT
GTTATTGTAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTTGCCAAA
CTCCCACCTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACCACTAAG
AATGATGTAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCTTGGAAT
GCTGCAACAATGGCACCCCCTGTAATGGCCTATCCTGCTACTACACCAACAGGCATGATAGGATATGGAATTCCTCCACAAATGGGAAGT
GTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATA
CAGTTTATGTAACTTGATGGAAGAAAATGGAATTACTCCAAAAAGACAAGTGCTCAAGCAGCAAAATCCTTACTTCCAGCAAAATCCAAA
CTGCTGTCTCTTAAATCTCTTAAACTCTCTTCTTCCATTAGAATGCTACAAGTAACTCAGTGAAGGCCCATGAAGGAAATTGGGACTAGT

>In-frame_KMT2A_ENST00000389506_chr11_118355029_+_PICALM_ENST00000528398_chr11_85718628_-_5469nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGCAAGTTGGAATT
GACAGAGGTGATATACCAGACCTTTCACAGGCCCCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAA
ATCAAAGATTCTACAGCTGCAAGCAGGGCAACTACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTG
GATGAAAGGGAAAAGCAGGCAGCATTAGAGGAAGAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAA
CCTCATACCTCTTTAACAACTGCAGCCTCTCCTGTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACC
CCTAGTTCTTCTAACAGCACATCAAAGCTGCCCAATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCA
ACTGCTTCTCAGGTAGCAAGTACATGGGGAGGATTCACTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTT
GAATCTGTGTTTGGAAATAAATCTACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCC
TCTCAGAACCAGAACCTTCCTGTTGCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGC
AATCTTGGCATCGGAAATGGAACCACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAA
CCAAAGGTTGCACCAACAACCGCTTGGAATGCTGCAACAATGGCACCCCCTGTAATGGCCTATCCTGCTACTACACCAACAGGCATGATA
GGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAAC
CCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAACTTGATGGAAGAAAATGGAATTACTCCAAAAAGACAAGTGCTCAAGCA
GCAAAATCCTTACTTCCAGCAAAATCCAAACTGCTGTCTCTTAAATCTCTTAAACTCTCTTCTTCCATTAGAATGCTACAAGTAACTCAG

>In-frame_KMT2A_ENST00000389506_chr11_118355029_+_PICALM_ENST00000356360_chr11_85718628_-_5411nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGCAAGTTGGAATT
GACAGAGGTGATATACCAGACCTTTCACAGGCCCCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAA
ATCAAAGATTCTACAGCTGCAAGCAGGGCAACTACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTG
GATGAAAGGGAAAAGCAGGCAGCATTAGAGGAAGAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAA
CCTCATACCTCTTTAACAACTGCAGCCTCTCCTGTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACC
CCTAGTTCTTCTAACAGCACATCAAAGCTGCCCAATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCA
ACTGCTTCTCAGGTAGCAAGTACATGGGGAGATCCTTTCTCTGCTACTGTAGATGCTGTTGATGATGCCATTCCAAGCTTAAATCCTTTC
CTCACAAAAAGTAGTGGTGATGTTCACCTTTCCATTTCTTCAGATGTATCTACTTTTACTACTAGGACACCTACTCATGAAATGTTTGTT
GGATTCACTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCTACAAAT
GTTATTGTAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTTGCCAAA
CTCCCACCTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACCACTAAG
AATGATGTAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCTTGGAAT
GCTGCAACAATGCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAAC
CCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAACTTGATGGAAGAAAATGGAATTACTCCAAAAAGACAAGTGCTCAAGCA

>In-frame_KMT2A_ENST00000354520_chr11_118355029_+_PICALM_ENST00000532317_chr11_85718628_-_6648nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGCAAGTTGGAATT
GACAGAGGTGATATACCAGACCTTTCACAGGCCCCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAA
ATCAAAGATTCTACAGCTGCAAGCAGGGCAACTACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTG
GATGAAAGGGAAAAGCAGGCAGCATTAGAGGAAGAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAA
CCTCATACCTCTTTAACAACTGCAGCCTCTCCTGTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACC
CCTAGTTCTTCTAACAGCACATCAAAGCTGCCCAATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCA
ACTGCTTCTCAGGTAGCAAGTACATGGGGAGGATTCACTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTT
GAATCTGTGTTTGGAAATAAATCTACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCC
TCTCAGAACCAGAACCTTCCTGTTGCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGC
AATCTTGGCATCGGAAATGGAACCACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAA
CCAAAGGTTGCACCAACAACCGCTTGGAATGCTGCAACAATGAATGGCATGCATTTTCCACAATACGCACCCCCTGTAATGGCCTATCCT
GCTACTACACCAACAGGCATGATAGGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGC
CAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAACTTGATGGAAGAAAATGGAATTAC
TCCAAAAAGACAAGTGCTCAAGCAGCAAAATCCTTACTTCCAGCAAAATCCAAACTGCTGTCTCTTAAATCTCTTAAACTCTCTTCTTCC
ATTAGAATGCTACAAGTAACTCAGTGAAGGCCCATGAAGGAAATTGGGACTAGTTTATAGGAGAACGTATCAATACAGTTTATAAAGCCA
AGAATTGCTATGATTTAAGACTAAGATCTGTCTTTTTGGTGACTAACCCTTCAATTCTTTCAACTCCTGTTAATACCCATAATCAGTAAC
CTATCAAGAAAAGCCCTTATTTGGAAAGTGTGAAATTTGTATTTGGAAAAGCTGCCTGGAGAGAAGAACTGTGTCCTTTACTGTATTTCA
ACAGGACTCTTTTGGGGGATCAAAATTAAAATTCCTAATTATGCATTATCTTTCTTTTCTCCAGTCCTCACAAATACAGAAACAATAACT
GAAATTAACTTTTCTTTTTTTAAAAAAAATTATATTCAGTTTGCAGTAGACATTCCTTAAGTATTTGTATTTATTTATGATTATCAATTT
TACATAACATTAATATTGTATCAGACCTCCTTATGAAAATGAGTATGGATGTGCACAGTATGTTTGATTTTTATCCACAAGAATGAATCT
GATTCAGAATGCTTTTCTCAGCTGACATACAGAGCACTAAATATTTTAAGGCAAGTCCATAGGTCTGAATCTCTTAAGAATTCTCGGCCT
CTGTGGGATTTAGGGAAGCATTATAAATGCATTAATCCTTATAGTCAATTCTGTGCCTAGGATTTTGCCAGGGAACAGTTCACTGACTAG
GAAAAGCACTACATTTTAAATTCAGCATTAGTGCATTGGGAAGGATCTTTACTGCTTTGTGCTTGGCATGTCATTATTTTCCATTTGACA
TTAGGGCCTTTCCAAAATGAATGTGAGGAATTGCTTTCACTTCAAGACTTTCCTTCTTTTCACTAAAACTCTAGAAGGTGTTACAAGGGG
GAGGGAAGGGGGGCAAAGTCCTTGAACATTTTCTTTGGCTCGTGCCATGTTATGATCATATACCTTTTAAATAAGGGGAAATAGTATCTT
TAAAGTTAATGTCTAGCCAAGAGTTTAGTAAACGAAGAATTAAACTGCACTGTTGATCGGTGCTTTGTGTAAATACATCTTTAACATTTG
GGTGGAGAGGGGCCTTAAGAAGGACAGTTCATTGTAGGAAAGCAATTCTGTACATGAGTTTAAGCATTCTTGTTGCATTGTCTCTGCAGA

>In-frame_KMT2A_ENST00000354520_chr11_118355029_+_PICALM_ENST00000526033_chr11_85718628_-_6749nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGCAAGTTGGAATT
GACAGAGGTGATATACCAGACCTTTCACAGGCCCCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAA
ATCAAAGATTCTACAGCTGCAAGCAGGGCAACTACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTG
GATGAAAGGGAAAAGCAGGCAGCATTAGAGGAAGAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAA
CCTCATACCTCTTTAACAACTGCAGCCTCTCCTGTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACC
CCTAGTTCTTCTAACAGCACATCAAAGCTGCCCAATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCA
ACTGCTTCTCAGGTAGCAAGTACATGGGGAGATGCTGTTGATGATGCCATTCCAAGCTTAAATCCTTTCCTCACAAAAAGTAGTGGTGAT
GTTCACCTTTCCATTTCTTCAGATGTATCTACTTTTACTACTAGGACACCTACTCATGAAATGTTTGTTGGATTCACTCCTTCTCCAGTT
GCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCTACAAATGTTATTGTAGATTCTGGGGGC
TTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTTGCCAAACTCCCACCTAGCAAGTTAGTA
TCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACCACTAAGAATGATGTAAATTGGAGTCAA
CCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCTTGGAATGCTGCAACAATGGCACCCCCT
GTAATGGCCTATCCTGCTACTACACCAACAGGCATGATAGGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCA
ACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAACTTGATGGA
AGAAAATGGAATTACTCCAAAAAGACAAGTGCTCAAGCAGCAAAATCCTTACTTCCAGCAAAATCCAAACTGCTGTCTCTTAAATCTCTT
AAACTCTCTTCTTCCATTAGAATGCTACAAGTAACTCAGTGAAGGCCCATGAAGGAAATTGGGACTAGTTTATAGGAGAACGTATCAATA
CAGTTTATAAAGCCAAGAATTGCTATGATTTAAGACTAAGATCTGTCTTTTTGGTGACTAACCCTTCAATTCTTTCAACTCCTGTTAATA
CCCATAATCAGTAACCTATCAAGAAAAGCCCTTATTTGGAAAGTGTGAAATTTGTATTTGGAAAAGCTGCCTGGAGAGAAGAACTGTGTC
CTTTACTGTATTTCAACAGGACTCTTTTGGGGGATCAAAATTAAAATTCCTAATTATGCATTATCTTTCTTTTCTCCAGTCCTCACAAAT
ACAGAAACAATAACTGAAATTAACTTTTCTTTTTTTAAAAAAAATTATATTCAGTTTGCAGTAGACATTCCTTAAGTATTTGTATTTATT
TATGATTATCAATTTTACATAACATTAATATTGTATCAGACCTCCTTATGAAAATGAGTATGGATGTGCACAGTATGTTTGATTTTTATC
CACAAGAATGAATCTGATTCAGAATGCTTTTCTCAGCTGACATACAGAGCACTAAATATTTTAAGGCAAGTCCATAGGTCTGAATCTCTT
AAGAATTCTCGGCCTCTGTGGGATTTAGGGAAGCATTATAAATGCATTAATCCTTATAGTCAATTCTGTGCCTAGGATTTTGCCAGGGAA
CAGTTCACTGACTAGGAAAAGCACTACATTTTAAATTCAGCATTAGTGCATTGGGAAGGATCTTTACTGCTTTGTGCTTGGCATGTCATT
ATTTTCCATTTGACATTAGGGCCTTTCCAAAATGAATGTGAGGAATTGCTTTCACTTCAAGACTTTCCTTCTTTTCACTAAAACTCTAGA
AGGTGTTACAAGGGGGAGGGAAGGGGGGCAAAGTCCTTGAACATTTTCTTTGGCTCGTGCCATGTTATGATCATATACCTTTTAAATAAG
GGGAAATAGTATCTTTAAAGTTAATGTCTAGCCAAGAGTTTAGTAAACGAAGAATTAAACTGCACTGTTGATCGGTGCTTTGTGTAAATA
CATCTTTAACATTTGGGTGGAGAGGGGCCTTAAGAAGGACAGTTCATTGTAGGAAAGCAATTCTGTACATGAGTTTAAGCATTCTTGTTG

>In-frame_KMT2A_ENST00000354520_chr11_118355029_+_PICALM_ENST00000393346_chr11_85718628_-_5644nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGCAAGTTGGAATT
GACAGAGGTGATATACCAGACCTTTCACAGGCCCCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAA
ATCAAAGATTCTACAGCTGCAAGCAGGGCAACTACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTG
GATGAAAGGGAAAAGCAGGCAGCATTAGAGGAAGAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAA
CCTCATACCTCTTTAACAACTGCAGCCTCTCCTGTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACC
CCTAGTTCTTCTAACAGCACATCAAAGCTGCCCAATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCA
ACTGCTTCTCAGGTAGCAAGTACATGGGGAGATCCTTTCTCTGCTACTGTAGATGCTGTTGATGATGCCATTCCAAGCTTAAATCCTTTC
CTCACAAAAAGTAGTGGTGATGTTCACCTTTCCATTTCTTCAGATGTATCTACTTTTACTACTAGGACACCTACTCATGAAATGTTTGTT
GGATTCACTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCTACAAAT
GTTATTGTAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTTGCCAAA
CTCCCACCTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACCACTAAG
AATGATGTAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCTTGGAAT
GCTGCAACAATGGCACCCCCTGTAATGGCCTATCCTGCTACTACACCAACAGGCATGATAGGATATGGAATTCCTCCACAAATGGGAAGT
GTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATA
CAGTTTATGTAACTTGATGGAAGAAAATGGAATTACTCCAAAAAGACAAGTGCTCAAGCAGCAAAATCCTTACTTCCAGCAAAATCCAAA
CTGCTGTCTCTTAAATCTCTTAAACTCTCTTCTTCCATTAGAATGCTACAAGTAACTCAGTGAAGGCCCATGAAGGAAATTGGGACTAGT

>In-frame_KMT2A_ENST00000354520_chr11_118355029_+_PICALM_ENST00000528398_chr11_85718628_-_5469nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGCAAGTTGGAATT
GACAGAGGTGATATACCAGACCTTTCACAGGCCCCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAA
ATCAAAGATTCTACAGCTGCAAGCAGGGCAACTACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTG
GATGAAAGGGAAAAGCAGGCAGCATTAGAGGAAGAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAA
CCTCATACCTCTTTAACAACTGCAGCCTCTCCTGTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACC
CCTAGTTCTTCTAACAGCACATCAAAGCTGCCCAATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCA
ACTGCTTCTCAGGTAGCAAGTACATGGGGAGGATTCACTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTT
GAATCTGTGTTTGGAAATAAATCTACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCC
TCTCAGAACCAGAACCTTCCTGTTGCCAAACTCCCACCTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGC
AATCTTGGCATCGGAAATGGAACCACTAAGAATGATGTAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAA
CCAAAGGTTGCACCAACAACCGCTTGGAATGCTGCAACAATGGCACCCCCTGTAATGGCCTATCCTGCTACTACACCAACAGGCATGATA
GGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAAC
CCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAACTTGATGGAAGAAAATGGAATTACTCCAAAAAGACAAGTGCTCAAGCA
GCAAAATCCTTACTTCCAGCAAAATCCAAACTGCTGTCTCTTAAATCTCTTAAACTCTCTTCTTCCATTAGAATGCTACAAGTAACTCAG

>In-frame_KMT2A_ENST00000354520_chr11_118355029_+_PICALM_ENST00000356360_chr11_85718628_-_5411nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGCAAGTTGGAATT
GACAGAGGTGATATACCAGACCTTTCACAGGCCCCTAGCAGTCTTCTTGATGCTTTGGAACAACATTTAGCTTCCTTGGAAGGAAAGAAA
ATCAAAGATTCTACAGCTGCAAGCAGGGCAACTACACTTTCCAATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTG
GATGAAAGGGAAAAGCAGGCAGCATTAGAGGAAGAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAA
CCTCATACCTCTTTAACAACTGCAGCCTCTCCTGTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCATTGACATATTTTCTACC
CCTAGTTCTTCTAACAGCACATCAAAGCTGCCCAATGATCTGCTTGATTTGCAGCAGCCAACTTTTCACCCATCTGTACATCCTATGTCA
ACTGCTTCTCAGGTAGCAAGTACATGGGGAGATCCTTTCTCTGCTACTGTAGATGCTGTTGATGATGCCATTCCAAGCTTAAATCCTTTC
CTCACAAAAAGTAGTGGTGATGTTCACCTTTCCATTTCTTCAGATGTATCTACTTTTACTACTAGGACACCTACTCATGAAATGTTTGTT
GGATTCACTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTTGAATCTGTGTTTGGAAATAAATCTACAAAT
GTTATTGTAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTCTCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTTGCCAAA
CTCCCACCTAGCAAGTTAGTATCTGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACCACTAAG
AATGATGTAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCACCAACAACCGCTTGGAAT
GCTGCAACAATGCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAAC
CCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAACTTGATGGAAGAAAATGGAATTACTCCAAAAAGACAAGTGCTCAAGCA


Top

FusionGenePPI for KMT2A_PICALM


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
KMT2APPIE, PPP1R15A, KMT2A, ASH2L, HCFC1, HCFC2, MEN1, RBBP5, WDR5, AVP, INS, OXT, MAP3K5, HDAC1, CTBP1, CBX4, BMI1, CREBBP, SMARCB1, CXXC1, MYB, CTNNB1, SNW1, E2F2, E2F4, E2F6, PSIP1, MLLT4, POLR2A, KAT8, RNF2, TP53, SBF1, MTM1, SET, HIST1H3A, HIST1H4A, KAT6A, ELL, AFF1, AFF4, CDK9, CCNT1, CTR9, LEO1, PAF1, CDC73, WDR61, MLLT3, DOT1L, SKP2, HIST3H3, SVIL, HIST2H3C, SIN3A, MLLT1, RUNX1, CBFB, H3F3A, SIRT7, ASB2, TCEB1, TCEB2, CBX8, TOP1, TAF6, NCL, HECW2, LGR4, CSNK2A2, SENP3, SYMPK, PKN1, PIH1D1, KRAS, TAF1, CHD3, SMARCA2, SMARCC2, SMARCC1, HDAC2, RBBP4, RBBP7, TBP, MBD3, SAP30, RAN, TAF9, TASP1, HIST1H2BG, EWSR1, DYNLT1, KIF11, ING4, ZNF131, ASB7PICALMPLCG1, CLTC, ITSN1, AP2A1, HIP1R, LAMTOR3, EEF1A1, SEC24D, DNM2, EGFR, FLOT1, SEC24C, ATP6V1E1, ILF3, HNRNPDL, SH3GLB2, ABCC2, ATP6V1F, CD55, SIRT1, FN1, VCAM1, ITGA4, PELI2, KLHL20, SLC25A41, ITLN1, ATF6B, SLC25A32, SOX2, FAM64A, CYP1A1, HNRNPA1, UNK, NTRK1, C14orf166, CARS, CPPED1, HNRNPD, ILVBL, ITGB1, LPP, PAPOLA, DDX1, EWSR1, FERMT2, FUS, ILK, NPLOC4, PFKM, PTPRF, VCL, PXN, STXBP1, TRIM25, UNC13D, XPO1, AP2B1, AP2M1, CLTA, CLTB, DAB2, EPS15, GAK, MYO6, PIK3C2A, SEC13, CLTCL1, CAPZA2, DBN1, MYH9, LIMA1, GTSE1, ANLN, MYO19, MYO18A, CLINT1, SEC16A, TNRC6A, BMP2K, MICAL3, DENND1A, WNK1, PRRC2B, STON2, FCHO2, MCM2, SNW1, CDC5L, SMURF1, CDH1, STAMBPL1, RALBP1, SNRNP27, DLST


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
TgenePICALMchr11:118355029chr11:85718628ENST00000528398-619221_294204552PIMREG


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneKMT2Achr11:118355029chr11:85718628ENST00000354520+9351584_160014063932histone H3K4me3
HgeneKMT2Achr11:118355029chr11:85718628ENST00000389506+9361584_160014063970histone H3K4me3
HgeneKMT2Achr11:118355029chr11:85718628ENST00000534358+9361584_160014063973histone H3K4me3
HgeneKMT2Achr11:118355029chr11:85718628ENST00000354520+9353764_377114063932WDR5
HgeneKMT2Achr11:118355029chr11:85718628ENST00000389506+9363764_377114063970WDR5
HgeneKMT2Achr11:118355029chr11:85718628ENST00000534358+9363764_377114063973WDR5
TgenePICALMchr11:118355029chr11:85718628ENST00000356360-619221_294255633PIMREG
TgenePICALMchr11:118355029chr11:85718628ENST00000393346-620221_294255653PIMREG
TgenePICALMchr11:118355029chr11:85718628ENST00000526033-620221_294255646PIMREG
TgenePICALMchr11:118355029chr11:85718628ENST00000532317-620221_294255611PIMREG


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for KMT2A_PICALM


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for KMT2A_PICALM


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneKMT2AC0023418leukemia2CTD_human
HgeneKMT2AC0023467Leukemia, Myelocytic, Acute2CTD_human
HgeneKMT2AC0023470Myeloid Leukemia2CTD_human
HgeneKMT2AC1961102Precursor Cell Lymphoblastic Leukemia Lymphoma2CTD_human
HgeneKMT2AC0001418Adenocarcinoma1CTD_human
HgeneKMT2AC0005695Bladder Neoplasm1CTD_human
HgeneKMT2AC0007138Carcinoma, Transitional Cell1CTD_human
HgeneKMT2AC0008625Chromosome Aberrations1CTD_human
HgeneKMT2AC0023448Lymphoid leukemia1CTD_human
HgeneKMT2AC0023465Acute monocytic leukemia1CTD_human
HgeneKMT2AC0023479Acute myelomonocytic leukemia1CTD_human
HgeneKMT2AC0036341Schizophrenia1PSYGENET
HgeneKMT2AC0038356Stomach Neoplasms1CTD_human
HgeneKMT2AC0149925Small cell carcinoma of lung1CTD_human
HgeneKMT2AC2239176Liver carcinoma1CTD_human
TgenePICALMC0002395Alzheimer's Disease2CTD_human