FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 19102

FusionGeneSummary for KMT2A_MLLT10

check button Fusion gene summary
Fusion gene informationFusion gene name: KMT2A_MLLT10
Fusion gene ID: 19102
HgeneTgene
Gene symbol

KMT2A

MLLT10

Gene ID

4297

8028

Gene namelysine methyltransferase 2AMLLT10, histone lysine methyltransferase DOT1L cofactor
SynonymsALL-1|CXXC7|HRX|HTRX1|MLL|MLL1|MLL1A|TRX1|WDSTSAF10
Cytomap

11q23.3

10p12.31

Type of geneprotein-codingprotein-coding
Descriptionhistone-lysine N-methyltransferase 2ACXXC-type zinc finger protein 7lysine (K)-specific methyltransferase 2Alysine N-methyltransferase 2Amixed lineage leukemia 1myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila)trithorax-likeprotein AF-10ALL1-fused gene from chromosome 10 proteinmyeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 10myeloid/lymphoid or mixed-lineage leukemia; translocated to, 10type I AF10 proteintype III AF10 prot
Modification date2018051920180522
UniProtAcc

Q03164

P55197

Ensembl transtripts involved in fusion geneENST00000534358, ENST00000389506, 
ENST00000354520, ENST00000420751, 
ENST00000446906, ENST00000377072, 
ENST00000307729, ENST00000377059, 
ENST00000495130, ENST00000377100, 
ENST00000377091, 
Fusion gene scores* DoF score31 X 72 X 6=133925 X 15 X 3=225
# samples 12920
** MAII scorelog2(129/13392*10)=-3.37592846223973
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(20/225*10)=-0.169925001442312
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: KMT2A [Title/Abstract] AND MLLT10 [Title/Abstract] AND fusion [Title/Abstract]

MLL-MLLT10 fusion in acute monoblastic leukemia: variant complex rearrangements and 11q proximal breakpoint heterogeneity. (pmid: 15262427)
Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Transcription factor involved fusion gene, inframe and retained DNA-binding domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneKMT2A

GO:0045944

positive regulation of transcription by RNA polymerase II

20861184

HgeneKMT2A

GO:0051568

histone H3-K4 methylation

19556245

HgeneKMT2A

GO:0065003

protein-containing complex assembly

15199122

HgeneKMT2A

GO:0080182

histone H3-K4 trimethylation

20861184

TgeneMLLT10

GO:0045944

positive regulation of transcription by RNA polymerase II

17868029


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDLAMLTCGA-AB-2832-03AKMT2Achr11

118096459

+MLLT10chr10

22537236

+
TCGALDLAMLTCGA-AB-2842-03AKMT2Achr11

118094640

+MLLT10chr10

22453081

+
TCGALDLAMLTCGA-AB-2985-03AKMT2Achr11

118097120

+MLLT10chr10

22518460

+
TCGALDLAMLTCGA-AB-3005-03AKMT2Achr11

118092383

+MLLT10chr10

22580559

+
ChiTaRS3.1AF272384KMT2Achr11

118355690

+MLLT10chr10

21959376

+
ChiTaRS3.1AF272383KMT2Achr11

118355029

+MLLT10chr10

21959376

+
ChiTaRS3.1AF272385KMT2Achr11

118355690

+MLLT10chr10

21959376

+
ChiTaRS3.1AF272375KMT2Achr11

118355029

+MLLT10chr10

21959376

+
ChiTaRS3.1AY187923KMT2Achr11

118355029

+MLLT10chr10

21875216

+
ChiTaRS3.1AF272376KMT2Achr11

118355690

+MLLT10chr10

21959376

+
ChiTaRS3.1DQ525423KMT2Achr11

118358749

+MLLT10chr10

21943434

+
ChiTaRS3.1AF242207KMT2Achr11

118352983

+MLLT10chr10

22015355

+
ChiTaRS3.1KF778381KMT2Achr11

118352809

+MLLT10chr10

22002698

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
intron-intronENST00000534358ENST00000446906KMT2Achr11

118096459

+MLLT10chr10

22537236

+
intron-intronENST00000534358ENST00000377072KMT2Achr11

118096459

+MLLT10chr10

22537236

+
intron-intronENST00000534358ENST00000307729KMT2Achr11

118096459

+MLLT10chr10

22537236

+
intron-intronENST00000534358ENST00000377059KMT2Achr11

118096459

+MLLT10chr10

22537236

+
intron-intronENST00000534358ENST00000495130KMT2Achr11

118096459

+MLLT10chr10

22537236

+
intron-intronENST00000534358ENST00000377100KMT2Achr11

118096459

+MLLT10chr10

22537236

+
intron-intronENST00000534358ENST00000377091KMT2Achr11

118096459

+MLLT10chr10

22537236

+
intron-intronENST00000389506ENST00000446906KMT2Achr11

118096459

+MLLT10chr10

22537236

+
intron-intronENST00000389506ENST00000377072KMT2Achr11

118096459

+MLLT10chr10

22537236

+
intron-intronENST00000389506ENST00000307729KMT2Achr11

118096459

+MLLT10chr10

22537236

+
intron-intronENST00000389506ENST00000377059KMT2Achr11

118096459

+MLLT10chr10

22537236

+
intron-intronENST00000389506ENST00000495130KMT2Achr11

118096459

+MLLT10chr10

22537236

+
intron-intronENST00000389506ENST00000377100KMT2Achr11

118096459

+MLLT10chr10

22537236

+
intron-intronENST00000389506ENST00000377091KMT2Achr11

118096459

+MLLT10chr10

22537236

+
intron-intronENST00000354520ENST00000446906KMT2Achr11

118096459

+MLLT10chr10

22537236

+
intron-intronENST00000354520ENST00000377072KMT2Achr11

118096459

+MLLT10chr10

22537236

+
intron-intronENST00000354520ENST00000307729KMT2Achr11

118096459

+MLLT10chr10

22537236

+
intron-intronENST00000354520ENST00000377059KMT2Achr11

118096459

+MLLT10chr10

22537236

+
intron-intronENST00000354520ENST00000495130KMT2Achr11

118096459

+MLLT10chr10

22537236

+
intron-intronENST00000354520ENST00000377100KMT2Achr11

118096459

+MLLT10chr10

22537236

+
intron-intronENST00000354520ENST00000377091KMT2Achr11

118096459

+MLLT10chr10

22537236

+
intron-intronENST00000420751ENST00000446906KMT2Achr11

118096459

+MLLT10chr10

22537236

+
intron-intronENST00000420751ENST00000377072KMT2Achr11

118096459

+MLLT10chr10

22537236

+
intron-intronENST00000420751ENST00000307729KMT2Achr11

118096459

+MLLT10chr10

22537236

+
intron-intronENST00000420751ENST00000377059KMT2Achr11

118096459

+MLLT10chr10

22537236

+
intron-intronENST00000420751ENST00000495130KMT2Achr11

118096459

+MLLT10chr10

22537236

+
intron-intronENST00000420751ENST00000377100KMT2Achr11

118096459

+MLLT10chr10

22537236

+
intron-intronENST00000420751ENST00000377091KMT2Achr11

118096459

+MLLT10chr10

22537236

+
intron-intronENST00000534358ENST00000446906KMT2Achr11

118094640

+MLLT10chr10

22453081

+
intron-intronENST00000534358ENST00000377072KMT2Achr11

118094640

+MLLT10chr10

22453081

+
intron-intronENST00000534358ENST00000307729KMT2Achr11

118094640

+MLLT10chr10

22453081

+
intron-intronENST00000534358ENST00000377059KMT2Achr11

118094640

+MLLT10chr10

22453081

+
intron-intronENST00000534358ENST00000495130KMT2Achr11

118094640

+MLLT10chr10

22453081

+
intron-intronENST00000534358ENST00000377100KMT2Achr11

118094640

+MLLT10chr10

22453081

+
intron-intronENST00000534358ENST00000377091KMT2Achr11

118094640

+MLLT10chr10

22453081

+
intron-intronENST00000389506ENST00000446906KMT2Achr11

118094640

+MLLT10chr10

22453081

+
intron-intronENST00000389506ENST00000377072KMT2Achr11

118094640

+MLLT10chr10

22453081

+
intron-intronENST00000389506ENST00000307729KMT2Achr11

118094640

+MLLT10chr10

22453081

+
intron-intronENST00000389506ENST00000377059KMT2Achr11

118094640

+MLLT10chr10

22453081

+
intron-intronENST00000389506ENST00000495130KMT2Achr11

118094640

+MLLT10chr10

22453081

+
intron-intronENST00000389506ENST00000377100KMT2Achr11

118094640

+MLLT10chr10

22453081

+
intron-intronENST00000389506ENST00000377091KMT2Achr11

118094640

+MLLT10chr10

22453081

+
intron-intronENST00000354520ENST00000446906KMT2Achr11

118094640

+MLLT10chr10

22453081

+
intron-intronENST00000354520ENST00000377072KMT2Achr11

118094640

+MLLT10chr10

22453081

+
intron-intronENST00000354520ENST00000307729KMT2Achr11

118094640

+MLLT10chr10

22453081

+
intron-intronENST00000354520ENST00000377059KMT2Achr11

118094640

+MLLT10chr10

22453081

+
intron-intronENST00000354520ENST00000495130KMT2Achr11

118094640

+MLLT10chr10

22453081

+
intron-intronENST00000354520ENST00000377100KMT2Achr11

118094640

+MLLT10chr10

22453081

+
intron-intronENST00000354520ENST00000377091KMT2Achr11

118094640

+MLLT10chr10

22453081

+
intron-intronENST00000420751ENST00000446906KMT2Achr11

118094640

+MLLT10chr10

22453081

+
intron-intronENST00000420751ENST00000377072KMT2Achr11

118094640

+MLLT10chr10

22453081

+
intron-intronENST00000420751ENST00000307729KMT2Achr11

118094640

+MLLT10chr10

22453081

+
intron-intronENST00000420751ENST00000377059KMT2Achr11

118094640

+MLLT10chr10

22453081

+
intron-intronENST00000420751ENST00000495130KMT2Achr11

118094640

+MLLT10chr10

22453081

+
intron-intronENST00000420751ENST00000377100KMT2Achr11

118094640

+MLLT10chr10

22453081

+
intron-intronENST00000420751ENST00000377091KMT2Achr11

118094640

+MLLT10chr10

22453081

+
intron-intronENST00000534358ENST00000446906KMT2Achr11

118097120

+MLLT10chr10

22518460

+
intron-intronENST00000534358ENST00000377072KMT2Achr11

118097120

+MLLT10chr10

22518460

+
intron-intronENST00000534358ENST00000307729KMT2Achr11

118097120

+MLLT10chr10

22518460

+
intron-intronENST00000534358ENST00000377059KMT2Achr11

118097120

+MLLT10chr10

22518460

+
intron-intronENST00000534358ENST00000495130KMT2Achr11

118097120

+MLLT10chr10

22518460

+
intron-intronENST00000534358ENST00000377100KMT2Achr11

118097120

+MLLT10chr10

22518460

+
intron-intronENST00000534358ENST00000377091KMT2Achr11

118097120

+MLLT10chr10

22518460

+
intron-intronENST00000389506ENST00000446906KMT2Achr11

118097120

+MLLT10chr10

22518460

+
intron-intronENST00000389506ENST00000377072KMT2Achr11

118097120

+MLLT10chr10

22518460

+
intron-intronENST00000389506ENST00000307729KMT2Achr11

118097120

+MLLT10chr10

22518460

+
intron-intronENST00000389506ENST00000377059KMT2Achr11

118097120

+MLLT10chr10

22518460

+
intron-intronENST00000389506ENST00000495130KMT2Achr11

118097120

+MLLT10chr10

22518460

+
intron-intronENST00000389506ENST00000377100KMT2Achr11

118097120

+MLLT10chr10

22518460

+
intron-intronENST00000389506ENST00000377091KMT2Achr11

118097120

+MLLT10chr10

22518460

+
intron-intronENST00000354520ENST00000446906KMT2Achr11

118097120

+MLLT10chr10

22518460

+
intron-intronENST00000354520ENST00000377072KMT2Achr11

118097120

+MLLT10chr10

22518460

+
intron-intronENST00000354520ENST00000307729KMT2Achr11

118097120

+MLLT10chr10

22518460

+
intron-intronENST00000354520ENST00000377059KMT2Achr11

118097120

+MLLT10chr10

22518460

+
intron-intronENST00000354520ENST00000495130KMT2Achr11

118097120

+MLLT10chr10

22518460

+
intron-intronENST00000354520ENST00000377100KMT2Achr11

118097120

+MLLT10chr10

22518460

+
intron-intronENST00000354520ENST00000377091KMT2Achr11

118097120

+MLLT10chr10

22518460

+
intron-intronENST00000420751ENST00000446906KMT2Achr11

118097120

+MLLT10chr10

22518460

+
intron-intronENST00000420751ENST00000377072KMT2Achr11

118097120

+MLLT10chr10

22518460

+
intron-intronENST00000420751ENST00000307729KMT2Achr11

118097120

+MLLT10chr10

22518460

+
intron-intronENST00000420751ENST00000377059KMT2Achr11

118097120

+MLLT10chr10

22518460

+
intron-intronENST00000420751ENST00000495130KMT2Achr11

118097120

+MLLT10chr10

22518460

+
intron-intronENST00000420751ENST00000377100KMT2Achr11

118097120

+MLLT10chr10

22518460

+
intron-intronENST00000420751ENST00000377091KMT2Achr11

118097120

+MLLT10chr10

22518460

+
intron-intronENST00000534358ENST00000446906KMT2Achr11

118092383

+MLLT10chr10

22580559

+
intron-intronENST00000534358ENST00000377072KMT2Achr11

118092383

+MLLT10chr10

22580559

+
intron-intronENST00000534358ENST00000307729KMT2Achr11

118092383

+MLLT10chr10

22580559

+
intron-intronENST00000534358ENST00000377059KMT2Achr11

118092383

+MLLT10chr10

22580559

+
intron-intronENST00000534358ENST00000495130KMT2Achr11

118092383

+MLLT10chr10

22580559

+
intron-intronENST00000534358ENST00000377100KMT2Achr11

118092383

+MLLT10chr10

22580559

+
intron-intronENST00000534358ENST00000377091KMT2Achr11

118092383

+MLLT10chr10

22580559

+
intron-intronENST00000389506ENST00000446906KMT2Achr11

118092383

+MLLT10chr10

22580559

+
intron-intronENST00000389506ENST00000377072KMT2Achr11

118092383

+MLLT10chr10

22580559

+
intron-intronENST00000389506ENST00000307729KMT2Achr11

118092383

+MLLT10chr10

22580559

+
intron-intronENST00000389506ENST00000377059KMT2Achr11

118092383

+MLLT10chr10

22580559

+
intron-intronENST00000389506ENST00000495130KMT2Achr11

118092383

+MLLT10chr10

22580559

+
intron-intronENST00000389506ENST00000377100KMT2Achr11

118092383

+MLLT10chr10

22580559

+
intron-intronENST00000389506ENST00000377091KMT2Achr11

118092383

+MLLT10chr10

22580559

+
intron-intronENST00000354520ENST00000446906KMT2Achr11

118092383

+MLLT10chr10

22580559

+
intron-intronENST00000354520ENST00000377072KMT2Achr11

118092383

+MLLT10chr10

22580559

+
intron-intronENST00000354520ENST00000307729KMT2Achr11

118092383

+MLLT10chr10

22580559

+
intron-intronENST00000354520ENST00000377059KMT2Achr11

118092383

+MLLT10chr10

22580559

+
intron-intronENST00000354520ENST00000495130KMT2Achr11

118092383

+MLLT10chr10

22580559

+
intron-intronENST00000354520ENST00000377100KMT2Achr11

118092383

+MLLT10chr10

22580559

+
intron-intronENST00000354520ENST00000377091KMT2Achr11

118092383

+MLLT10chr10

22580559

+
intron-intronENST00000420751ENST00000446906KMT2Achr11

118092383

+MLLT10chr10

22580559

+
intron-intronENST00000420751ENST00000377072KMT2Achr11

118092383

+MLLT10chr10

22580559

+
intron-intronENST00000420751ENST00000307729KMT2Achr11

118092383

+MLLT10chr10

22580559

+
intron-intronENST00000420751ENST00000377059KMT2Achr11

118092383

+MLLT10chr10

22580559

+
intron-intronENST00000420751ENST00000495130KMT2Achr11

118092383

+MLLT10chr10

22580559

+
intron-intronENST00000420751ENST00000377100KMT2Achr11

118092383

+MLLT10chr10

22580559

+
intron-intronENST00000420751ENST00000377091KMT2Achr11

118092383

+MLLT10chr10

22580559

+
In-frameENST00000534358ENST00000446906KMT2Achr11

118355690

+MLLT10chr10

21959376

+
In-frameENST00000534358ENST00000377072KMT2Achr11

118355690

+MLLT10chr10

21959376

+
In-frameENST00000534358ENST00000307729KMT2Achr11

118355690

+MLLT10chr10

21959376

+
In-frameENST00000534358ENST00000377059KMT2Achr11

118355690

+MLLT10chr10

21959376

+
5CDS-intronENST00000534358ENST00000495130KMT2Achr11

118355690

+MLLT10chr10

21959376

+
5CDS-intronENST00000534358ENST00000377100KMT2Achr11

118355690

+MLLT10chr10

21959376

+
5CDS-intronENST00000534358ENST00000377091KMT2Achr11

118355690

+MLLT10chr10

21959376

+
In-frameENST00000389506ENST00000446906KMT2Achr11

118355690

+MLLT10chr10

21959376

+
In-frameENST00000389506ENST00000377072KMT2Achr11

118355690

+MLLT10chr10

21959376

+
In-frameENST00000389506ENST00000307729KMT2Achr11

118355690

+MLLT10chr10

21959376

+
In-frameENST00000389506ENST00000377059KMT2Achr11

118355690

+MLLT10chr10

21959376

+
5CDS-intronENST00000389506ENST00000495130KMT2Achr11

118355690

+MLLT10chr10

21959376

+
5CDS-intronENST00000389506ENST00000377100KMT2Achr11

118355690

+MLLT10chr10

21959376

+
5CDS-intronENST00000389506ENST00000377091KMT2Achr11

118355690

+MLLT10chr10

21959376

+
intron-3CDSENST00000354520ENST00000446906KMT2Achr11

118355690

+MLLT10chr10

21959376

+
intron-3CDSENST00000354520ENST00000377072KMT2Achr11

118355690

+MLLT10chr10

21959376

+
intron-3CDSENST00000354520ENST00000307729KMT2Achr11

118355690

+MLLT10chr10

21959376

+
intron-3CDSENST00000354520ENST00000377059KMT2Achr11

118355690

+MLLT10chr10

21959376

+
intron-intronENST00000354520ENST00000495130KMT2Achr11

118355690

+MLLT10chr10

21959376

+
intron-intronENST00000354520ENST00000377100KMT2Achr11

118355690

+MLLT10chr10

21959376

+
intron-intronENST00000354520ENST00000377091KMT2Achr11

118355690

+MLLT10chr10

21959376

+
intron-3CDSENST00000420751ENST00000446906KMT2Achr11

118355690

+MLLT10chr10

21959376

+
intron-3CDSENST00000420751ENST00000377072KMT2Achr11

118355690

+MLLT10chr10

21959376

+
intron-3CDSENST00000420751ENST00000307729KMT2Achr11

118355690

+MLLT10chr10

21959376

+
intron-3CDSENST00000420751ENST00000377059KMT2Achr11

118355690

+MLLT10chr10

21959376

+
intron-intronENST00000420751ENST00000495130KMT2Achr11

118355690

+MLLT10chr10

21959376

+
intron-intronENST00000420751ENST00000377100KMT2Achr11

118355690

+MLLT10chr10

21959376

+
intron-intronENST00000420751ENST00000377091KMT2Achr11

118355690

+MLLT10chr10

21959376

+
In-frameENST00000534358ENST00000446906KMT2Achr11

118355029

+MLLT10chr10

21959376

+
In-frameENST00000534358ENST00000377072KMT2Achr11

118355029

+MLLT10chr10

21959376

+
In-frameENST00000534358ENST00000307729KMT2Achr11

118355029

+MLLT10chr10

21959376

+
In-frameENST00000534358ENST00000377059KMT2Achr11

118355029

+MLLT10chr10

21959376

+
5CDS-intronENST00000534358ENST00000495130KMT2Achr11

118355029

+MLLT10chr10

21959376

+
5CDS-intronENST00000534358ENST00000377100KMT2Achr11

118355029

+MLLT10chr10

21959376

+
5CDS-intronENST00000534358ENST00000377091KMT2Achr11

118355029

+MLLT10chr10

21959376

+
In-frameENST00000389506ENST00000446906KMT2Achr11

118355029

+MLLT10chr10

21959376

+
In-frameENST00000389506ENST00000377072KMT2Achr11

118355029

+MLLT10chr10

21959376

+
In-frameENST00000389506ENST00000307729KMT2Achr11

118355029

+MLLT10chr10

21959376

+
In-frameENST00000389506ENST00000377059KMT2Achr11

118355029

+MLLT10chr10

21959376

+
5CDS-intronENST00000389506ENST00000495130KMT2Achr11

118355029

+MLLT10chr10

21959376

+
5CDS-intronENST00000389506ENST00000377100KMT2Achr11

118355029

+MLLT10chr10

21959376

+
5CDS-intronENST00000389506ENST00000377091KMT2Achr11

118355029

+MLLT10chr10

21959376

+
In-frameENST00000354520ENST00000446906KMT2Achr11

118355029

+MLLT10chr10

21959376

+
In-frameENST00000354520ENST00000377072KMT2Achr11

118355029

+MLLT10chr10

21959376

+
In-frameENST00000354520ENST00000307729KMT2Achr11

118355029

+MLLT10chr10

21959376

+
In-frameENST00000354520ENST00000377059KMT2Achr11

118355029

+MLLT10chr10

21959376

+
5CDS-intronENST00000354520ENST00000495130KMT2Achr11

118355029

+MLLT10chr10

21959376

+
5CDS-intronENST00000354520ENST00000377100KMT2Achr11

118355029

+MLLT10chr10

21959376

+
5CDS-intronENST00000354520ENST00000377091KMT2Achr11

118355029

+MLLT10chr10

21959376

+
3UTR-3CDSENST00000420751ENST00000446906KMT2Achr11

118355029

+MLLT10chr10

21959376

+
3UTR-3CDSENST00000420751ENST00000377072KMT2Achr11

118355029

+MLLT10chr10

21959376

+
3UTR-3CDSENST00000420751ENST00000307729KMT2Achr11

118355029

+MLLT10chr10

21959376

+
3UTR-3CDSENST00000420751ENST00000377059KMT2Achr11

118355029

+MLLT10chr10

21959376

+
3UTR-intronENST00000420751ENST00000495130KMT2Achr11

118355029

+MLLT10chr10

21959376

+
3UTR-intronENST00000420751ENST00000377100KMT2Achr11

118355029

+MLLT10chr10

21959376

+
3UTR-intronENST00000420751ENST00000377091KMT2Achr11

118355029

+MLLT10chr10

21959376

+
In-frameENST00000534358ENST00000446906KMT2Achr11

118355029

+MLLT10chr10

21875216

+
In-frameENST00000534358ENST00000377072KMT2Achr11

118355029

+MLLT10chr10

21875216

+
In-frameENST00000534358ENST00000307729KMT2Achr11

118355029

+MLLT10chr10

21875216

+
In-frameENST00000534358ENST00000377059KMT2Achr11

118355029

+MLLT10chr10

21875216

+
5CDS-3UTRENST00000534358ENST00000495130KMT2Achr11

118355029

+MLLT10chr10

21875216

+
5CDS-intronENST00000534358ENST00000377100KMT2Achr11

118355029

+MLLT10chr10

21875216

+
5CDS-intronENST00000534358ENST00000377091KMT2Achr11

118355029

+MLLT10chr10

21875216

+
In-frameENST00000389506ENST00000446906KMT2Achr11

118355029

+MLLT10chr10

21875216

+
In-frameENST00000389506ENST00000377072KMT2Achr11

118355029

+MLLT10chr10

21875216

+
In-frameENST00000389506ENST00000307729KMT2Achr11

118355029

+MLLT10chr10

21875216

+
In-frameENST00000389506ENST00000377059KMT2Achr11

118355029

+MLLT10chr10

21875216

+
5CDS-3UTRENST00000389506ENST00000495130KMT2Achr11

118355029

+MLLT10chr10

21875216

+
5CDS-intronENST00000389506ENST00000377100KMT2Achr11

118355029

+MLLT10chr10

21875216

+
5CDS-intronENST00000389506ENST00000377091KMT2Achr11

118355029

+MLLT10chr10

21875216

+
In-frameENST00000354520ENST00000446906KMT2Achr11

118355029

+MLLT10chr10

21875216

+
In-frameENST00000354520ENST00000377072KMT2Achr11

118355029

+MLLT10chr10

21875216

+
In-frameENST00000354520ENST00000307729KMT2Achr11

118355029

+MLLT10chr10

21875216

+
In-frameENST00000354520ENST00000377059KMT2Achr11

118355029

+MLLT10chr10

21875216

+
5CDS-3UTRENST00000354520ENST00000495130KMT2Achr11

118355029

+MLLT10chr10

21875216

+
5CDS-intronENST00000354520ENST00000377100KMT2Achr11

118355029

+MLLT10chr10

21875216

+
5CDS-intronENST00000354520ENST00000377091KMT2Achr11

118355029

+MLLT10chr10

21875216

+
3UTR-3CDSENST00000420751ENST00000446906KMT2Achr11

118355029

+MLLT10chr10

21875216

+
3UTR-3CDSENST00000420751ENST00000377072KMT2Achr11

118355029

+MLLT10chr10

21875216

+
3UTR-3CDSENST00000420751ENST00000307729KMT2Achr11

118355029

+MLLT10chr10

21875216

+
3UTR-3CDSENST00000420751ENST00000377059KMT2Achr11

118355029

+MLLT10chr10

21875216

+
3UTR-3UTRENST00000420751ENST00000495130KMT2Achr11

118355029

+MLLT10chr10

21875216

+
3UTR-intronENST00000420751ENST00000377100KMT2Achr11

118355029

+MLLT10chr10

21875216

+
3UTR-intronENST00000420751ENST00000377091KMT2Achr11

118355029

+MLLT10chr10

21875216

+
intron-intronENST00000534358ENST00000446906KMT2Achr11

118358749

+MLLT10chr10

21943434

+
intron-intronENST00000534358ENST00000377072KMT2Achr11

118358749

+MLLT10chr10

21943434

+
intron-intronENST00000534358ENST00000307729KMT2Achr11

118358749

+MLLT10chr10

21943434

+
intron-intronENST00000534358ENST00000377059KMT2Achr11

118358749

+MLLT10chr10

21943434

+
intron-intronENST00000534358ENST00000495130KMT2Achr11

118358749

+MLLT10chr10

21943434

+
intron-intronENST00000534358ENST00000377100KMT2Achr11

118358749

+MLLT10chr10

21943434

+
intron-intronENST00000534358ENST00000377091KMT2Achr11

118358749

+MLLT10chr10

21943434

+
intron-intronENST00000389506ENST00000446906KMT2Achr11

118358749

+MLLT10chr10

21943434

+
intron-intronENST00000389506ENST00000377072KMT2Achr11

118358749

+MLLT10chr10

21943434

+
intron-intronENST00000389506ENST00000307729KMT2Achr11

118358749

+MLLT10chr10

21943434

+
intron-intronENST00000389506ENST00000377059KMT2Achr11

118358749

+MLLT10chr10

21943434

+
intron-intronENST00000389506ENST00000495130KMT2Achr11

118358749

+MLLT10chr10

21943434

+
intron-intronENST00000389506ENST00000377100KMT2Achr11

118358749

+MLLT10chr10

21943434

+
intron-intronENST00000389506ENST00000377091KMT2Achr11

118358749

+MLLT10chr10

21943434

+
intron-intronENST00000354520ENST00000446906KMT2Achr11

118358749

+MLLT10chr10

21943434

+
intron-intronENST00000354520ENST00000377072KMT2Achr11

118358749

+MLLT10chr10

21943434

+
intron-intronENST00000354520ENST00000307729KMT2Achr11

118358749

+MLLT10chr10

21943434

+
intron-intronENST00000354520ENST00000377059KMT2Achr11

118358749

+MLLT10chr10

21943434

+
intron-intronENST00000354520ENST00000495130KMT2Achr11

118358749

+MLLT10chr10

21943434

+
intron-intronENST00000354520ENST00000377100KMT2Achr11

118358749

+MLLT10chr10

21943434

+
intron-intronENST00000354520ENST00000377091KMT2Achr11

118358749

+MLLT10chr10

21943434

+
intron-intronENST00000420751ENST00000446906KMT2Achr11

118358749

+MLLT10chr10

21943434

+
intron-intronENST00000420751ENST00000377072KMT2Achr11

118358749

+MLLT10chr10

21943434

+
intron-intronENST00000420751ENST00000307729KMT2Achr11

118358749

+MLLT10chr10

21943434

+
intron-intronENST00000420751ENST00000377059KMT2Achr11

118358749

+MLLT10chr10

21943434

+
intron-intronENST00000420751ENST00000495130KMT2Achr11

118358749

+MLLT10chr10

21943434

+
intron-intronENST00000420751ENST00000377100KMT2Achr11

118358749

+MLLT10chr10

21943434

+
intron-intronENST00000420751ENST00000377091KMT2Achr11

118358749

+MLLT10chr10

21943434

+
intron-intronENST00000534358ENST00000446906KMT2Achr11

118352983

+MLLT10chr10

22015355

+
intron-intronENST00000534358ENST00000377072KMT2Achr11

118352983

+MLLT10chr10

22015355

+
intron-intronENST00000534358ENST00000307729KMT2Achr11

118352983

+MLLT10chr10

22015355

+
intron-intronENST00000534358ENST00000377059KMT2Achr11

118352983

+MLLT10chr10

22015355

+
intron-intronENST00000534358ENST00000495130KMT2Achr11

118352983

+MLLT10chr10

22015355

+
intron-intronENST00000534358ENST00000377100KMT2Achr11

118352983

+MLLT10chr10

22015355

+
intron-intronENST00000534358ENST00000377091KMT2Achr11

118352983

+MLLT10chr10

22015355

+
intron-intronENST00000389506ENST00000446906KMT2Achr11

118352983

+MLLT10chr10

22015355

+
intron-intronENST00000389506ENST00000377072KMT2Achr11

118352983

+MLLT10chr10

22015355

+
intron-intronENST00000389506ENST00000307729KMT2Achr11

118352983

+MLLT10chr10

22015355

+
intron-intronENST00000389506ENST00000377059KMT2Achr11

118352983

+MLLT10chr10

22015355

+
intron-intronENST00000389506ENST00000495130KMT2Achr11

118352983

+MLLT10chr10

22015355

+
intron-intronENST00000389506ENST00000377100KMT2Achr11

118352983

+MLLT10chr10

22015355

+
intron-intronENST00000389506ENST00000377091KMT2Achr11

118352983

+MLLT10chr10

22015355

+
intron-intronENST00000354520ENST00000446906KMT2Achr11

118352983

+MLLT10chr10

22015355

+
intron-intronENST00000354520ENST00000377072KMT2Achr11

118352983

+MLLT10chr10

22015355

+
intron-intronENST00000354520ENST00000307729KMT2Achr11

118352983

+MLLT10chr10

22015355

+
intron-intronENST00000354520ENST00000377059KMT2Achr11

118352983

+MLLT10chr10

22015355

+
intron-intronENST00000354520ENST00000495130KMT2Achr11

118352983

+MLLT10chr10

22015355

+
intron-intronENST00000354520ENST00000377100KMT2Achr11

118352983

+MLLT10chr10

22015355

+
intron-intronENST00000354520ENST00000377091KMT2Achr11

118352983

+MLLT10chr10

22015355

+
intron-intronENST00000420751ENST00000446906KMT2Achr11

118352983

+MLLT10chr10

22015355

+
intron-intronENST00000420751ENST00000377072KMT2Achr11

118352983

+MLLT10chr10

22015355

+
intron-intronENST00000420751ENST00000307729KMT2Achr11

118352983

+MLLT10chr10

22015355

+
intron-intronENST00000420751ENST00000377059KMT2Achr11

118352983

+MLLT10chr10

22015355

+
intron-intronENST00000420751ENST00000495130KMT2Achr11

118352983

+MLLT10chr10

22015355

+
intron-intronENST00000420751ENST00000377100KMT2Achr11

118352983

+MLLT10chr10

22015355

+
intron-intronENST00000420751ENST00000377091KMT2Achr11

118352983

+MLLT10chr10

22015355

+
In-frameENST00000534358ENST00000446906KMT2Achr11

118352809

+MLLT10chr10

22002698

+
In-frameENST00000534358ENST00000377072KMT2Achr11

118352809

+MLLT10chr10

22002698

+
In-frameENST00000534358ENST00000307729KMT2Achr11

118352809

+MLLT10chr10

22002698

+
In-frameENST00000534358ENST00000377059KMT2Achr11

118352809

+MLLT10chr10

22002698

+
5CDS-intronENST00000534358ENST00000495130KMT2Achr11

118352809

+MLLT10chr10

22002698

+
5CDS-intronENST00000534358ENST00000377100KMT2Achr11

118352809

+MLLT10chr10

22002698

+
5CDS-intronENST00000534358ENST00000377091KMT2Achr11

118352809

+MLLT10chr10

22002698

+
In-frameENST00000389506ENST00000446906KMT2Achr11

118352809

+MLLT10chr10

22002698

+
In-frameENST00000389506ENST00000377072KMT2Achr11

118352809

+MLLT10chr10

22002698

+
In-frameENST00000389506ENST00000307729KMT2Achr11

118352809

+MLLT10chr10

22002698

+
In-frameENST00000389506ENST00000377059KMT2Achr11

118352809

+MLLT10chr10

22002698

+
5CDS-intronENST00000389506ENST00000495130KMT2Achr11

118352809

+MLLT10chr10

22002698

+
5CDS-intronENST00000389506ENST00000377100KMT2Achr11

118352809

+MLLT10chr10

22002698

+
5CDS-intronENST00000389506ENST00000377091KMT2Achr11

118352809

+MLLT10chr10

22002698

+
In-frameENST00000354520ENST00000446906KMT2Achr11

118352809

+MLLT10chr10

22002698

+
In-frameENST00000354520ENST00000377072KMT2Achr11

118352809

+MLLT10chr10

22002698

+
In-frameENST00000354520ENST00000307729KMT2Achr11

118352809

+MLLT10chr10

22002698

+
In-frameENST00000354520ENST00000377059KMT2Achr11

118352809

+MLLT10chr10

22002698

+
5CDS-intronENST00000354520ENST00000495130KMT2Achr11

118352809

+MLLT10chr10

22002698

+
5CDS-intronENST00000354520ENST00000377100KMT2Achr11

118352809

+MLLT10chr10

22002698

+
5CDS-intronENST00000354520ENST00000377091KMT2Achr11

118352809

+MLLT10chr10

22002698

+
3UTR-3CDSENST00000420751ENST00000446906KMT2Achr11

118352809

+MLLT10chr10

22002698

+
3UTR-3CDSENST00000420751ENST00000377072KMT2Achr11

118352809

+MLLT10chr10

22002698

+
3UTR-3CDSENST00000420751ENST00000307729KMT2Achr11

118352809

+MLLT10chr10

22002698

+
3UTR-3CDSENST00000420751ENST00000377059KMT2Achr11

118352809

+MLLT10chr10

22002698

+
3UTR-intronENST00000420751ENST00000495130KMT2Achr11

118352809

+MLLT10chr10

22002698

+
3UTR-intronENST00000420751ENST00000377100KMT2Achr11

118352809

+MLLT10chr10

22002698

+
3UTR-intronENST00000420751ENST00000377091KMT2Achr11

118352809

+MLLT10chr10

22002698

+

Top

FusionProtFeatures for KMT2A_MLLT10


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
KMT2A

Q03164

MLLT10

P55197

Probably involved in transcriptional regulation. Invitro or as fusion protein with KMT2A/MLL1 has transactivationactivity. Binds to cruciform DNA. In cells, binding to unmodifiedhistone H3 regulates DOT1L functions including histone H3 'Lys-79'dimethylation (H3K79me2) and gene activation (PubMed:26439302).{ECO:0000269|PubMed:17868029, ECO:0000269|PubMed:26439302}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneKMT2Achr11:118352809chr10:22002698ENST00000354520+735137_14313373932Compositional biasNote=Poly-Gly
HgeneKMT2Achr11:118352809chr10:22002698ENST00000354520+73517_10213373932Compositional biasNote=Ala/Gly/Ser-rich
HgeneKMT2Achr11:118352809chr10:22002698ENST00000354520+735561_56413373932Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118352809chr10:22002698ENST00000354520+735568_57113373932Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118352809chr10:22002698ENST00000389506+736137_14313373970Compositional biasNote=Poly-Gly
HgeneKMT2Achr11:118352809chr10:22002698ENST00000389506+73617_10213373970Compositional biasNote=Ala/Gly/Ser-rich
HgeneKMT2Achr11:118352809chr10:22002698ENST00000389506+736561_56413373970Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118352809chr10:22002698ENST00000389506+736568_57113373970Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118352809chr10:22002698ENST00000534358+736137_14313373973Compositional biasNote=Poly-Gly
HgeneKMT2Achr11:118352809chr10:22002698ENST00000534358+73617_10213373973Compositional biasNote=Ala/Gly/Ser-rich
HgeneKMT2Achr11:118352809chr10:22002698ENST00000534358+736561_56413373973Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118352809chr10:22002698ENST00000534358+736568_57113373973Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118355029chr10:21875216ENST00000354520+935137_14314063932Compositional biasNote=Poly-Gly
HgeneKMT2Achr11:118355029chr10:21875216ENST00000354520+93517_10214063932Compositional biasNote=Ala/Gly/Ser-rich
HgeneKMT2Achr11:118355029chr10:21875216ENST00000354520+935561_56414063932Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118355029chr10:21875216ENST00000354520+935568_57114063932Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118355029chr10:21875216ENST00000389506+936137_14314063970Compositional biasNote=Poly-Gly
HgeneKMT2Achr11:118355029chr10:21875216ENST00000389506+93617_10214063970Compositional biasNote=Ala/Gly/Ser-rich
HgeneKMT2Achr11:118355029chr10:21875216ENST00000389506+936561_56414063970Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118355029chr10:21875216ENST00000389506+936568_57114063970Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118355029chr10:21875216ENST00000534358+936137_14314063973Compositional biasNote=Poly-Gly
HgeneKMT2Achr11:118355029chr10:21875216ENST00000534358+93617_10214063973Compositional biasNote=Ala/Gly/Ser-rich
HgeneKMT2Achr11:118355029chr10:21875216ENST00000534358+936561_56414063973Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118355029chr10:21875216ENST00000534358+936568_57114063973Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118355029chr10:21959376ENST00000354520+935137_14314063932Compositional biasNote=Poly-Gly
HgeneKMT2Achr11:118355029chr10:21959376ENST00000354520+93517_10214063932Compositional biasNote=Ala/Gly/Ser-rich
HgeneKMT2Achr11:118355029chr10:21959376ENST00000354520+935561_56414063932Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118355029chr10:21959376ENST00000354520+935568_57114063932Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118355029chr10:21959376ENST00000389506+936137_14314063970Compositional biasNote=Poly-Gly
HgeneKMT2Achr11:118355029chr10:21959376ENST00000389506+93617_10214063970Compositional biasNote=Ala/Gly/Ser-rich
HgeneKMT2Achr11:118355029chr10:21959376ENST00000389506+936561_56414063970Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118355029chr10:21959376ENST00000389506+936568_57114063970Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118355029chr10:21959376ENST00000534358+936137_14314063973Compositional biasNote=Poly-Gly
HgeneKMT2Achr11:118355029chr10:21959376ENST00000534358+93617_10214063973Compositional biasNote=Ala/Gly/Ser-rich
HgeneKMT2Achr11:118355029chr10:21959376ENST00000534358+936561_56414063973Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118355029chr10:21959376ENST00000534358+936568_57114063973Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118355690chr10:21959376ENST00000389506+1036137_14314443970Compositional biasNote=Poly-Gly
HgeneKMT2Achr11:118355690chr10:21959376ENST00000389506+103617_10214443970Compositional biasNote=Ala/Gly/Ser-rich
HgeneKMT2Achr11:118355690chr10:21959376ENST00000389506+1036561_56414443970Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118355690chr10:21959376ENST00000389506+1036568_57114443970Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118355690chr10:21959376ENST00000534358+1036137_14314443973Compositional biasNote=Poly-Gly
HgeneKMT2Achr11:118355690chr10:21959376ENST00000534358+103617_10214443973Compositional biasNote=Ala/Gly/Ser-rich
HgeneKMT2Achr11:118355690chr10:21959376ENST00000534358+1036561_56414443973Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118355690chr10:21959376ENST00000534358+1036568_57114443973Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118352809chr10:22002698ENST00000354520+735169_18013373932DNA bindingNote=A.T hook 1
HgeneKMT2Achr11:118352809chr10:22002698ENST00000354520+735217_22713373932DNA bindingNote=A.T hook 2
HgeneKMT2Achr11:118352809chr10:22002698ENST00000354520+735301_30913373932DNA bindingNote=A.T hook 3
HgeneKMT2Achr11:118352809chr10:22002698ENST00000389506+736169_18013373970DNA bindingNote=A.T hook 1
HgeneKMT2Achr11:118352809chr10:22002698ENST00000389506+736217_22713373970DNA bindingNote=A.T hook 2
HgeneKMT2Achr11:118352809chr10:22002698ENST00000389506+736301_30913373970DNA bindingNote=A.T hook 3
HgeneKMT2Achr11:118352809chr10:22002698ENST00000534358+736169_18013373973DNA bindingNote=A.T hook 1
HgeneKMT2Achr11:118352809chr10:22002698ENST00000534358+736217_22713373973DNA bindingNote=A.T hook 2
HgeneKMT2Achr11:118352809chr10:22002698ENST00000534358+736301_30913373973DNA bindingNote=A.T hook 3
HgeneKMT2Achr11:118355029chr10:21875216ENST00000354520+935169_18014063932DNA bindingNote=A.T hook 1
HgeneKMT2Achr11:118355029chr10:21875216ENST00000354520+935217_22714063932DNA bindingNote=A.T hook 2
HgeneKMT2Achr11:118355029chr10:21875216ENST00000354520+935301_30914063932DNA bindingNote=A.T hook 3
HgeneKMT2Achr11:118355029chr10:21875216ENST00000389506+936169_18014063970DNA bindingNote=A.T hook 1
HgeneKMT2Achr11:118355029chr10:21875216ENST00000389506+936217_22714063970DNA bindingNote=A.T hook 2
HgeneKMT2Achr11:118355029chr10:21875216ENST00000389506+936301_30914063970DNA bindingNote=A.T hook 3
HgeneKMT2Achr11:118355029chr10:21875216ENST00000534358+936169_18014063973DNA bindingNote=A.T hook 1
HgeneKMT2Achr11:118355029chr10:21875216ENST00000534358+936217_22714063973DNA bindingNote=A.T hook 2
HgeneKMT2Achr11:118355029chr10:21875216ENST00000534358+936301_30914063973DNA bindingNote=A.T hook 3
HgeneKMT2Achr11:118355029chr10:21959376ENST00000354520+935169_18014063932DNA bindingNote=A.T hook 1
HgeneKMT2Achr11:118355029chr10:21959376ENST00000354520+935217_22714063932DNA bindingNote=A.T hook 2
HgeneKMT2Achr11:118355029chr10:21959376ENST00000354520+935301_30914063932DNA bindingNote=A.T hook 3
HgeneKMT2Achr11:118355029chr10:21959376ENST00000389506+936169_18014063970DNA bindingNote=A.T hook 1
HgeneKMT2Achr11:118355029chr10:21959376ENST00000389506+936217_22714063970DNA bindingNote=A.T hook 2
HgeneKMT2Achr11:118355029chr10:21959376ENST00000389506+936301_30914063970DNA bindingNote=A.T hook 3
HgeneKMT2Achr11:118355029chr10:21959376ENST00000534358+936169_18014063973DNA bindingNote=A.T hook 1
HgeneKMT2Achr11:118355029chr10:21959376ENST00000534358+936217_22714063973DNA bindingNote=A.T hook 2
HgeneKMT2Achr11:118355029chr10:21959376ENST00000534358+936301_30914063973DNA bindingNote=A.T hook 3
HgeneKMT2Achr11:118355690chr10:21959376ENST00000389506+1036169_18014443970DNA bindingNote=A.T hook 1
HgeneKMT2Achr11:118355690chr10:21959376ENST00000389506+1036217_22714443970DNA bindingNote=A.T hook 2
HgeneKMT2Achr11:118355690chr10:21959376ENST00000389506+1036301_30914443970DNA bindingNote=A.T hook 3
HgeneKMT2Achr11:118355690chr10:21959376ENST00000534358+1036169_18014443973DNA bindingNote=A.T hook 1
HgeneKMT2Achr11:118355690chr10:21959376ENST00000534358+1036217_22714443973DNA bindingNote=A.T hook 2
HgeneKMT2Achr11:118355690chr10:21959376ENST00000534358+1036301_30914443973DNA bindingNote=A.T hook 3
HgeneKMT2Achr11:118352809chr10:22002698ENST00000354520+7351147_119513373932Zinc fingerCXXC-type
HgeneKMT2Achr11:118352809chr10:22002698ENST00000389506+7361147_119513373970Zinc fingerCXXC-type
HgeneKMT2Achr11:118352809chr10:22002698ENST00000534358+7361147_119513373973Zinc fingerCXXC-type
HgeneKMT2Achr11:118355029chr10:21875216ENST00000354520+9351147_119514063932Zinc fingerCXXC-type
HgeneKMT2Achr11:118355029chr10:21875216ENST00000389506+9361147_119514063970Zinc fingerCXXC-type
HgeneKMT2Achr11:118355029chr10:21875216ENST00000534358+9361147_119514063973Zinc fingerCXXC-type
HgeneKMT2Achr11:118355029chr10:21959376ENST00000354520+9351147_119514063932Zinc fingerCXXC-type
HgeneKMT2Achr11:118355029chr10:21959376ENST00000389506+9361147_119514063970Zinc fingerCXXC-type
HgeneKMT2Achr11:118355029chr10:21959376ENST00000534358+9361147_119514063973Zinc fingerCXXC-type
HgeneKMT2Achr11:118355690chr10:21959376ENST00000389506+10361147_119514443970Zinc fingerCXXC-type
HgeneKMT2Achr11:118355690chr10:21959376ENST00000534358+10361147_119514443973Zinc fingerCXXC-type
TgeneMLLT10chr11:118352809chr10:22002698ENST00000377091+05229_240-59127Compositional biasNote=Glu/Lys-rich
TgeneMLLT10chr11:118352809chr10:22002698ENST00000377100+04229_240-119180Compositional biasNote=Glu/Lys-rich
TgeneMLLT10chr11:118355029chr10:21875216ENST00000307729+223229_240801069Compositional biasNote=Glu/Lys-rich
TgeneMLLT10chr11:118355029chr10:21875216ENST00000377072+224229_240801476Compositional biasNote=Glu/Lys-rich
TgeneMLLT10chr11:118355029chr10:21875216ENST00000377091+05229_240-59127Compositional biasNote=Glu/Lys-rich
TgeneMLLT10chr11:118355029chr10:21875216ENST00000377100+04229_240-119180Compositional biasNote=Glu/Lys-rich
TgeneMLLT10chr11:118355029chr10:21959376ENST00000377091+05229_240-59127Compositional biasNote=Glu/Lys-rich
TgeneMLLT10chr11:118355029chr10:21959376ENST00000377100+04229_240-119180Compositional biasNote=Glu/Lys-rich
TgeneMLLT10chr11:118355690chr10:21959376ENST00000377091+05229_240-59127Compositional biasNote=Glu/Lys-rich
TgeneMLLT10chr11:118355690chr10:21959376ENST00000377100+04229_240-119180Compositional biasNote=Glu/Lys-rich
TgeneMLLT10chr11:118352809chr10:22002698ENST00000307729+1223703_7845661069RegionNote=Transactivation domain%3B required for DOT1L-binding
TgeneMLLT10chr11:118352809chr10:22002698ENST00000307729+1223750_7785661069RegionNote=Leucine-zipper
TgeneMLLT10chr11:118352809chr10:22002698ENST00000377072+1324703_7845821476RegionNote=Transactivation domain%3B required for DOT1L-binding
TgeneMLLT10chr11:118352809chr10:22002698ENST00000377072+1324750_7785821476RegionNote=Leucine-zipper
TgeneMLLT10chr11:118352809chr10:22002698ENST00000377091+05311_674-59127RegionNote=DNA-binding
TgeneMLLT10chr11:118352809chr10:22002698ENST00000377091+05703_784-59127RegionNote=Transactivation domain%3B required for DOT1L-binding
TgeneMLLT10chr11:118352809chr10:22002698ENST00000377091+05750_778-59127RegionNote=Leucine-zipper
TgeneMLLT10chr11:118352809chr10:22002698ENST00000377091+0580_287-59127RegionNote=Self-association
TgeneMLLT10chr11:118352809chr10:22002698ENST00000377100+04311_674-119180RegionNote=DNA-binding
TgeneMLLT10chr11:118352809chr10:22002698ENST00000377100+04703_784-119180RegionNote=Transactivation domain%3B required for DOT1L-binding
TgeneMLLT10chr11:118352809chr10:22002698ENST00000377100+04750_778-119180RegionNote=Leucine-zipper
TgeneMLLT10chr11:118352809chr10:22002698ENST00000377100+0480_287-119180RegionNote=Self-association
TgeneMLLT10chr11:118355029chr10:21875216ENST00000307729+223311_674801069RegionNote=DNA-binding
TgeneMLLT10chr11:118355029chr10:21875216ENST00000307729+223703_784801069RegionNote=Transactivation domain%3B required for DOT1L-binding
TgeneMLLT10chr11:118355029chr10:21875216ENST00000307729+223750_778801069RegionNote=Leucine-zipper
TgeneMLLT10chr11:118355029chr10:21875216ENST00000307729+22380_287801069RegionNote=Self-association
TgeneMLLT10chr11:118355029chr10:21875216ENST00000377072+224311_674801476RegionNote=DNA-binding
TgeneMLLT10chr11:118355029chr10:21875216ENST00000377072+224703_784801476RegionNote=Transactivation domain%3B required for DOT1L-binding
TgeneMLLT10chr11:118355029chr10:21875216ENST00000377072+224750_778801476RegionNote=Leucine-zipper
TgeneMLLT10chr11:118355029chr10:21875216ENST00000377072+22480_287801476RegionNote=Self-association
TgeneMLLT10chr11:118355029chr10:21875216ENST00000377091+05311_674-59127RegionNote=DNA-binding
TgeneMLLT10chr11:118355029chr10:21875216ENST00000377091+05703_784-59127RegionNote=Transactivation domain%3B required for DOT1L-binding
TgeneMLLT10chr11:118355029chr10:21875216ENST00000377091+05750_778-59127RegionNote=Leucine-zipper
TgeneMLLT10chr11:118355029chr10:21875216ENST00000377091+0580_287-59127RegionNote=Self-association
TgeneMLLT10chr11:118355029chr10:21875216ENST00000377100+04311_674-119180RegionNote=DNA-binding
TgeneMLLT10chr11:118355029chr10:21875216ENST00000377100+04703_784-119180RegionNote=Transactivation domain%3B required for DOT1L-binding
TgeneMLLT10chr11:118355029chr10:21875216ENST00000377100+04750_778-119180RegionNote=Leucine-zipper
TgeneMLLT10chr11:118355029chr10:21875216ENST00000377100+0480_287-119180RegionNote=Self-association
TgeneMLLT10chr11:118355029chr10:21959376ENST00000307729+823311_6742651069RegionNote=DNA-binding
TgeneMLLT10chr11:118355029chr10:21959376ENST00000307729+823703_7842651069RegionNote=Transactivation domain%3B required for DOT1L-binding
TgeneMLLT10chr11:118355029chr10:21959376ENST00000307729+823750_7782651069RegionNote=Leucine-zipper
TgeneMLLT10chr11:118355029chr10:21959376ENST00000377072+824311_6742651476RegionNote=DNA-binding
TgeneMLLT10chr11:118355029chr10:21959376ENST00000377072+824703_7842651476RegionNote=Transactivation domain%3B required for DOT1L-binding
TgeneMLLT10chr11:118355029chr10:21959376ENST00000377072+824750_7782651476RegionNote=Leucine-zipper
TgeneMLLT10chr11:118355029chr10:21959376ENST00000377091+05311_674-59127RegionNote=DNA-binding
TgeneMLLT10chr11:118355029chr10:21959376ENST00000377091+05703_784-59127RegionNote=Transactivation domain%3B required for DOT1L-binding
TgeneMLLT10chr11:118355029chr10:21959376ENST00000377091+05750_778-59127RegionNote=Leucine-zipper
TgeneMLLT10chr11:118355029chr10:21959376ENST00000377091+0580_287-59127RegionNote=Self-association
TgeneMLLT10chr11:118355029chr10:21959376ENST00000377100+04311_674-119180RegionNote=DNA-binding
TgeneMLLT10chr11:118355029chr10:21959376ENST00000377100+04703_784-119180RegionNote=Transactivation domain%3B required for DOT1L-binding
TgeneMLLT10chr11:118355029chr10:21959376ENST00000377100+04750_778-119180RegionNote=Leucine-zipper
TgeneMLLT10chr11:118355029chr10:21959376ENST00000377100+0480_287-119180RegionNote=Self-association
TgeneMLLT10chr11:118355690chr10:21959376ENST00000307729+823311_6742651069RegionNote=DNA-binding
TgeneMLLT10chr11:118355690chr10:21959376ENST00000307729+823703_7842651069RegionNote=Transactivation domain%3B required for DOT1L-binding
TgeneMLLT10chr11:118355690chr10:21959376ENST00000307729+823750_7782651069RegionNote=Leucine-zipper
TgeneMLLT10chr11:118355690chr10:21959376ENST00000377072+824311_6742651476RegionNote=DNA-binding
TgeneMLLT10chr11:118355690chr10:21959376ENST00000377072+824703_7842651476RegionNote=Transactivation domain%3B required for DOT1L-binding
TgeneMLLT10chr11:118355690chr10:21959376ENST00000377072+824750_7782651476RegionNote=Leucine-zipper
TgeneMLLT10chr11:118355690chr10:21959376ENST00000377091+05311_674-59127RegionNote=DNA-binding
TgeneMLLT10chr11:118355690chr10:21959376ENST00000377091+05703_784-59127RegionNote=Transactivation domain%3B required for DOT1L-binding
TgeneMLLT10chr11:118355690chr10:21959376ENST00000377091+05750_778-59127RegionNote=Leucine-zipper
TgeneMLLT10chr11:118355690chr10:21959376ENST00000377091+0580_287-59127RegionNote=Self-association
TgeneMLLT10chr11:118355690chr10:21959376ENST00000377100+04311_674-119180RegionNote=DNA-binding
TgeneMLLT10chr11:118355690chr10:21959376ENST00000377100+04703_784-119180RegionNote=Transactivation domain%3B required for DOT1L-binding
TgeneMLLT10chr11:118355690chr10:21959376ENST00000377100+04750_778-119180RegionNote=Leucine-zipper
TgeneMLLT10chr11:118355690chr10:21959376ENST00000377100+0480_287-119180RegionNote=Self-association
TgeneMLLT10chr11:118352809chr10:22002698ENST00000377091+05135_198-59127Zinc fingerPHD-type 2
TgeneMLLT10chr11:118352809chr10:22002698ENST00000377091+0522_74-59127Zinc fingerPHD-type 1
TgeneMLLT10chr11:118352809chr10:22002698ENST00000377091+0579_112-59127Zinc fingerC2HC pre-PHD-type
TgeneMLLT10chr11:118352809chr10:22002698ENST00000377100+04135_198-119180Zinc fingerPHD-type 2
TgeneMLLT10chr11:118352809chr10:22002698ENST00000377100+0422_74-119180Zinc fingerPHD-type 1
TgeneMLLT10chr11:118352809chr10:22002698ENST00000377100+0479_112-119180Zinc fingerC2HC pre-PHD-type
TgeneMLLT10chr11:118355029chr10:21875216ENST00000307729+223135_198801069Zinc fingerPHD-type 2
TgeneMLLT10chr11:118355029chr10:21875216ENST00000307729+22379_112801069Zinc fingerC2HC pre-PHD-type
TgeneMLLT10chr11:118355029chr10:21875216ENST00000377072+224135_198801476Zinc fingerPHD-type 2
TgeneMLLT10chr11:118355029chr10:21875216ENST00000377072+22479_112801476Zinc fingerC2HC pre-PHD-type
TgeneMLLT10chr11:118355029chr10:21875216ENST00000377091+05135_198-59127Zinc fingerPHD-type 2
TgeneMLLT10chr11:118355029chr10:21875216ENST00000377091+0522_74-59127Zinc fingerPHD-type 1
TgeneMLLT10chr11:118355029chr10:21875216ENST00000377091+0579_112-59127Zinc fingerC2HC pre-PHD-type
TgeneMLLT10chr11:118355029chr10:21875216ENST00000377100+04135_198-119180Zinc fingerPHD-type 2
TgeneMLLT10chr11:118355029chr10:21875216ENST00000377100+0422_74-119180Zinc fingerPHD-type 1
TgeneMLLT10chr11:118355029chr10:21875216ENST00000377100+0479_112-119180Zinc fingerC2HC pre-PHD-type
TgeneMLLT10chr11:118355029chr10:21959376ENST00000377091+05135_198-59127Zinc fingerPHD-type 2
TgeneMLLT10chr11:118355029chr10:21959376ENST00000377091+0522_74-59127Zinc fingerPHD-type 1
TgeneMLLT10chr11:118355029chr10:21959376ENST00000377091+0579_112-59127Zinc fingerC2HC pre-PHD-type
TgeneMLLT10chr11:118355029chr10:21959376ENST00000377100+04135_198-119180Zinc fingerPHD-type 2
TgeneMLLT10chr11:118355029chr10:21959376ENST00000377100+0422_74-119180Zinc fingerPHD-type 1
TgeneMLLT10chr11:118355029chr10:21959376ENST00000377100+0479_112-119180Zinc fingerC2HC pre-PHD-type
TgeneMLLT10chr11:118355690chr10:21959376ENST00000377091+05135_198-59127Zinc fingerPHD-type 2
TgeneMLLT10chr11:118355690chr10:21959376ENST00000377091+0522_74-59127Zinc fingerPHD-type 1
TgeneMLLT10chr11:118355690chr10:21959376ENST00000377091+0579_112-59127Zinc fingerC2HC pre-PHD-type
TgeneMLLT10chr11:118355690chr10:21959376ENST00000377100+04135_198-119180Zinc fingerPHD-type 2
TgeneMLLT10chr11:118355690chr10:21959376ENST00000377100+0422_74-119180Zinc fingerPHD-type 1
TgeneMLLT10chr11:118355690chr10:21959376ENST00000377100+0479_112-119180Zinc fingerC2HC pre-PHD-type

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneKMT2Achr11:118355690chr10:21959376ENST00000354520+135137_14303932Compositional biasNote=Poly-Gly
HgeneKMT2Achr11:118355690chr10:21959376ENST00000354520+13517_10203932Compositional biasNote=Ala/Gly/Ser-rich
HgeneKMT2Achr11:118355690chr10:21959376ENST00000354520+135561_56403932Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118355690chr10:21959376ENST00000354520+135568_57103932Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118355690chr10:21959376ENST00000354520+135169_18003932DNA bindingNote=A.T hook 1
HgeneKMT2Achr11:118355690chr10:21959376ENST00000354520+135217_22703932DNA bindingNote=A.T hook 2
HgeneKMT2Achr11:118355690chr10:21959376ENST00000354520+135301_30903932DNA bindingNote=A.T hook 3
HgeneKMT2Achr11:118352809chr10:22002698ENST00000354520+7351703_174813373932DomainBromo%3B divergent
HgeneKMT2Achr11:118352809chr10:22002698ENST00000354520+7352018_207413373932DomainFYR N-terminal
HgeneKMT2Achr11:118352809chr10:22002698ENST00000354520+7353666_374713373932DomainFYR C-terminal
HgeneKMT2Achr11:118352809chr10:22002698ENST00000354520+7353829_394513373932DomainSET
HgeneKMT2Achr11:118352809chr10:22002698ENST00000354520+7353953_396913373932DomainPost-SET
HgeneKMT2Achr11:118352809chr10:22002698ENST00000389506+7361703_174813373970DomainBromo%3B divergent
HgeneKMT2Achr11:118352809chr10:22002698ENST00000389506+7362018_207413373970DomainFYR N-terminal
HgeneKMT2Achr11:118352809chr10:22002698ENST00000389506+7363666_374713373970DomainFYR C-terminal
HgeneKMT2Achr11:118352809chr10:22002698ENST00000389506+7363829_394513373970DomainSET
HgeneKMT2Achr11:118352809chr10:22002698ENST00000389506+7363953_396913373970DomainPost-SET
HgeneKMT2Achr11:118352809chr10:22002698ENST00000534358+7361703_174813373973DomainBromo%3B divergent
HgeneKMT2Achr11:118352809chr10:22002698ENST00000534358+7362018_207413373973DomainFYR N-terminal
HgeneKMT2Achr11:118352809chr10:22002698ENST00000534358+7363666_374713373973DomainFYR C-terminal
HgeneKMT2Achr11:118352809chr10:22002698ENST00000534358+7363829_394513373973DomainSET
HgeneKMT2Achr11:118352809chr10:22002698ENST00000534358+7363953_396913373973DomainPost-SET
HgeneKMT2Achr11:118355029chr10:21875216ENST00000354520+9351703_174814063932DomainBromo%3B divergent
HgeneKMT2Achr11:118355029chr10:21875216ENST00000354520+9352018_207414063932DomainFYR N-terminal
HgeneKMT2Achr11:118355029chr10:21875216ENST00000354520+9353666_374714063932DomainFYR C-terminal
HgeneKMT2Achr11:118355029chr10:21875216ENST00000354520+9353829_394514063932DomainSET
HgeneKMT2Achr11:118355029chr10:21875216ENST00000354520+9353953_396914063932DomainPost-SET
HgeneKMT2Achr11:118355029chr10:21875216ENST00000389506+9361703_174814063970DomainBromo%3B divergent
HgeneKMT2Achr11:118355029chr10:21875216ENST00000389506+9362018_207414063970DomainFYR N-terminal
HgeneKMT2Achr11:118355029chr10:21875216ENST00000389506+9363666_374714063970DomainFYR C-terminal
HgeneKMT2Achr11:118355029chr10:21875216ENST00000389506+9363829_394514063970DomainSET
HgeneKMT2Achr11:118355029chr10:21875216ENST00000389506+9363953_396914063970DomainPost-SET
HgeneKMT2Achr11:118355029chr10:21875216ENST00000534358+9361703_174814063973DomainBromo%3B divergent
HgeneKMT2Achr11:118355029chr10:21875216ENST00000534358+9362018_207414063973DomainFYR N-terminal
HgeneKMT2Achr11:118355029chr10:21875216ENST00000534358+9363666_374714063973DomainFYR C-terminal
HgeneKMT2Achr11:118355029chr10:21875216ENST00000534358+9363829_394514063973DomainSET
HgeneKMT2Achr11:118355029chr10:21875216ENST00000534358+9363953_396914063973DomainPost-SET
HgeneKMT2Achr11:118355029chr10:21959376ENST00000354520+9351703_174814063932DomainBromo%3B divergent
HgeneKMT2Achr11:118355029chr10:21959376ENST00000354520+9352018_207414063932DomainFYR N-terminal
HgeneKMT2Achr11:118355029chr10:21959376ENST00000354520+9353666_374714063932DomainFYR C-terminal
HgeneKMT2Achr11:118355029chr10:21959376ENST00000354520+9353829_394514063932DomainSET
HgeneKMT2Achr11:118355029chr10:21959376ENST00000354520+9353953_396914063932DomainPost-SET
HgeneKMT2Achr11:118355029chr10:21959376ENST00000389506+9361703_174814063970DomainBromo%3B divergent
HgeneKMT2Achr11:118355029chr10:21959376ENST00000389506+9362018_207414063970DomainFYR N-terminal
HgeneKMT2Achr11:118355029chr10:21959376ENST00000389506+9363666_374714063970DomainFYR C-terminal
HgeneKMT2Achr11:118355029chr10:21959376ENST00000389506+9363829_394514063970DomainSET
HgeneKMT2Achr11:118355029chr10:21959376ENST00000389506+9363953_396914063970DomainPost-SET
HgeneKMT2Achr11:118355029chr10:21959376ENST00000534358+9361703_174814063973DomainBromo%3B divergent
HgeneKMT2Achr11:118355029chr10:21959376ENST00000534358+9362018_207414063973DomainFYR N-terminal
HgeneKMT2Achr11:118355029chr10:21959376ENST00000534358+9363666_374714063973DomainFYR C-terminal
HgeneKMT2Achr11:118355029chr10:21959376ENST00000534358+9363829_394514063973DomainSET
HgeneKMT2Achr11:118355029chr10:21959376ENST00000534358+9363953_396914063973DomainPost-SET
HgeneKMT2Achr11:118355690chr10:21959376ENST00000354520+1351703_174803932DomainBromo%3B divergent
HgeneKMT2Achr11:118355690chr10:21959376ENST00000354520+1352018_207403932DomainFYR N-terminal
HgeneKMT2Achr11:118355690chr10:21959376ENST00000354520+1353666_374703932DomainFYR C-terminal
HgeneKMT2Achr11:118355690chr10:21959376ENST00000354520+1353829_394503932DomainSET
HgeneKMT2Achr11:118355690chr10:21959376ENST00000354520+1353953_396903932DomainPost-SET
HgeneKMT2Achr11:118355690chr10:21959376ENST00000389506+10361703_174814443970DomainBromo%3B divergent
HgeneKMT2Achr11:118355690chr10:21959376ENST00000389506+10362018_207414443970DomainFYR N-terminal
HgeneKMT2Achr11:118355690chr10:21959376ENST00000389506+10363666_374714443970DomainFYR C-terminal
HgeneKMT2Achr11:118355690chr10:21959376ENST00000389506+10363829_394514443970DomainSET
HgeneKMT2Achr11:118355690chr10:21959376ENST00000389506+10363953_396914443970DomainPost-SET
HgeneKMT2Achr11:118355690chr10:21959376ENST00000534358+10361703_174814443973DomainBromo%3B divergent
HgeneKMT2Achr11:118355690chr10:21959376ENST00000534358+10362018_207414443973DomainFYR N-terminal
HgeneKMT2Achr11:118355690chr10:21959376ENST00000534358+10363666_374714443973DomainFYR C-terminal
HgeneKMT2Achr11:118355690chr10:21959376ENST00000534358+10363829_394514443973DomainSET
HgeneKMT2Achr11:118355690chr10:21959376ENST00000534358+10363953_396914443973DomainPost-SET
HgeneKMT2Achr11:118352809chr10:22002698ENST00000354520+7353906_390713373932RegionS-adenosyl-L-methionine binding
HgeneKMT2Achr11:118352809chr10:22002698ENST00000389506+7363906_390713373970RegionS-adenosyl-L-methionine binding
HgeneKMT2Achr11:118352809chr10:22002698ENST00000534358+7363906_390713373973RegionS-adenosyl-L-methionine binding
HgeneKMT2Achr11:118355029chr10:21875216ENST00000354520+9353906_390714063932RegionS-adenosyl-L-methionine binding
HgeneKMT2Achr11:118355029chr10:21875216ENST00000389506+9363906_390714063970RegionS-adenosyl-L-methionine binding
HgeneKMT2Achr11:118355029chr10:21875216ENST00000534358+9363906_390714063973RegionS-adenosyl-L-methionine binding
HgeneKMT2Achr11:118355029chr10:21959376ENST00000354520+9353906_390714063932RegionS-adenosyl-L-methionine binding
HgeneKMT2Achr11:118355029chr10:21959376ENST00000389506+9363906_390714063970RegionS-adenosyl-L-methionine binding
HgeneKMT2Achr11:118355029chr10:21959376ENST00000534358+9363906_390714063973RegionS-adenosyl-L-methionine binding
HgeneKMT2Achr11:118355690chr10:21959376ENST00000354520+1353906_390703932RegionS-adenosyl-L-methionine binding
HgeneKMT2Achr11:118355690chr10:21959376ENST00000389506+10363906_390714443970RegionS-adenosyl-L-methionine binding
HgeneKMT2Achr11:118355690chr10:21959376ENST00000534358+10363906_390714443973RegionS-adenosyl-L-methionine binding
HgeneKMT2Achr11:118352809chr10:22002698ENST00000354520+7351431_148213373932Zinc fingerPHD-type 1
HgeneKMT2Achr11:118352809chr10:22002698ENST00000354520+7351479_153313373932Zinc fingerPHD-type 2
HgeneKMT2Achr11:118352809chr10:22002698ENST00000354520+7351566_162713373932Zinc fingerPHD-type 3
HgeneKMT2Achr11:118352809chr10:22002698ENST00000354520+7351870_191013373932Zinc fingerC2HC pre-PHD-type
HgeneKMT2Achr11:118352809chr10:22002698ENST00000354520+7351931_197813373932Zinc fingerPHD-type 4
HgeneKMT2Achr11:118352809chr10:22002698ENST00000389506+7361431_148213373970Zinc fingerPHD-type 1
HgeneKMT2Achr11:118352809chr10:22002698ENST00000389506+7361479_153313373970Zinc fingerPHD-type 2
HgeneKMT2Achr11:118352809chr10:22002698ENST00000389506+7361566_162713373970Zinc fingerPHD-type 3
HgeneKMT2Achr11:118352809chr10:22002698ENST00000389506+7361870_191013373970Zinc fingerC2HC pre-PHD-type
HgeneKMT2Achr11:118352809chr10:22002698ENST00000389506+7361931_197813373970Zinc fingerPHD-type 4
HgeneKMT2Achr11:118352809chr10:22002698ENST00000534358+7361431_148213373973Zinc fingerPHD-type 1
HgeneKMT2Achr11:118352809chr10:22002698ENST00000534358+7361479_153313373973Zinc fingerPHD-type 2
HgeneKMT2Achr11:118352809chr10:22002698ENST00000534358+7361566_162713373973Zinc fingerPHD-type 3
HgeneKMT2Achr11:118352809chr10:22002698ENST00000534358+7361870_191013373973Zinc fingerC2HC pre-PHD-type
HgeneKMT2Achr11:118352809chr10:22002698ENST00000534358+7361931_197813373973Zinc fingerPHD-type 4
HgeneKMT2Achr11:118355029chr10:21875216ENST00000354520+9351431_148214063932Zinc fingerPHD-type 1
HgeneKMT2Achr11:118355029chr10:21875216ENST00000354520+9351479_153314063932Zinc fingerPHD-type 2
HgeneKMT2Achr11:118355029chr10:21875216ENST00000354520+9351566_162714063932Zinc fingerPHD-type 3
HgeneKMT2Achr11:118355029chr10:21875216ENST00000354520+9351870_191014063932Zinc fingerC2HC pre-PHD-type
HgeneKMT2Achr11:118355029chr10:21875216ENST00000354520+9351931_197814063932Zinc fingerPHD-type 4
HgeneKMT2Achr11:118355029chr10:21875216ENST00000389506+9361431_148214063970Zinc fingerPHD-type 1
HgeneKMT2Achr11:118355029chr10:21875216ENST00000389506+9361479_153314063970Zinc fingerPHD-type 2
HgeneKMT2Achr11:118355029chr10:21875216ENST00000389506+9361566_162714063970Zinc fingerPHD-type 3
HgeneKMT2Achr11:118355029chr10:21875216ENST00000389506+9361870_191014063970Zinc fingerC2HC pre-PHD-type
HgeneKMT2Achr11:118355029chr10:21875216ENST00000389506+9361931_197814063970Zinc fingerPHD-type 4
HgeneKMT2Achr11:118355029chr10:21875216ENST00000534358+9361431_148214063973Zinc fingerPHD-type 1
HgeneKMT2Achr11:118355029chr10:21875216ENST00000534358+9361479_153314063973Zinc fingerPHD-type 2
HgeneKMT2Achr11:118355029chr10:21875216ENST00000534358+9361566_162714063973Zinc fingerPHD-type 3
HgeneKMT2Achr11:118355029chr10:21875216ENST00000534358+9361870_191014063973Zinc fingerC2HC pre-PHD-type
HgeneKMT2Achr11:118355029chr10:21875216ENST00000534358+9361931_197814063973Zinc fingerPHD-type 4
HgeneKMT2Achr11:118355029chr10:21959376ENST00000354520+9351431_148214063932Zinc fingerPHD-type 1
HgeneKMT2Achr11:118355029chr10:21959376ENST00000354520+9351479_153314063932Zinc fingerPHD-type 2
HgeneKMT2Achr11:118355029chr10:21959376ENST00000354520+9351566_162714063932Zinc fingerPHD-type 3
HgeneKMT2Achr11:118355029chr10:21959376ENST00000354520+9351870_191014063932Zinc fingerC2HC pre-PHD-type
HgeneKMT2Achr11:118355029chr10:21959376ENST00000354520+9351931_197814063932Zinc fingerPHD-type 4
HgeneKMT2Achr11:118355029chr10:21959376ENST00000389506+9361431_148214063970Zinc fingerPHD-type 1
HgeneKMT2Achr11:118355029chr10:21959376ENST00000389506+9361479_153314063970Zinc fingerPHD-type 2
HgeneKMT2Achr11:118355029chr10:21959376ENST00000389506+9361566_162714063970Zinc fingerPHD-type 3
HgeneKMT2Achr11:118355029chr10:21959376ENST00000389506+9361870_191014063970Zinc fingerC2HC pre-PHD-type
HgeneKMT2Achr11:118355029chr10:21959376ENST00000389506+9361931_197814063970Zinc fingerPHD-type 4
HgeneKMT2Achr11:118355029chr10:21959376ENST00000534358+9361431_148214063973Zinc fingerPHD-type 1
HgeneKMT2Achr11:118355029chr10:21959376ENST00000534358+9361479_153314063973Zinc fingerPHD-type 2
HgeneKMT2Achr11:118355029chr10:21959376ENST00000534358+9361566_162714063973Zinc fingerPHD-type 3
HgeneKMT2Achr11:118355029chr10:21959376ENST00000534358+9361870_191014063973Zinc fingerC2HC pre-PHD-type
HgeneKMT2Achr11:118355029chr10:21959376ENST00000534358+9361931_197814063973Zinc fingerPHD-type 4
HgeneKMT2Achr11:118355690chr10:21959376ENST00000354520+1351147_119503932Zinc fingerCXXC-type
HgeneKMT2Achr11:118355690chr10:21959376ENST00000354520+1351431_148203932Zinc fingerPHD-type 1
HgeneKMT2Achr11:118355690chr10:21959376ENST00000354520+1351479_153303932Zinc fingerPHD-type 2
HgeneKMT2Achr11:118355690chr10:21959376ENST00000354520+1351566_162703932Zinc fingerPHD-type 3
HgeneKMT2Achr11:118355690chr10:21959376ENST00000354520+1351870_191003932Zinc fingerC2HC pre-PHD-type
HgeneKMT2Achr11:118355690chr10:21959376ENST00000354520+1351931_197803932Zinc fingerPHD-type 4
HgeneKMT2Achr11:118355690chr10:21959376ENST00000389506+10361431_148214443970Zinc fingerPHD-type 1
HgeneKMT2Achr11:118355690chr10:21959376ENST00000389506+10361479_153314443970Zinc fingerPHD-type 2
HgeneKMT2Achr11:118355690chr10:21959376ENST00000389506+10361566_162714443970Zinc fingerPHD-type 3
HgeneKMT2Achr11:118355690chr10:21959376ENST00000389506+10361870_191014443970Zinc fingerC2HC pre-PHD-type
HgeneKMT2Achr11:118355690chr10:21959376ENST00000389506+10361931_197814443970Zinc fingerPHD-type 4
HgeneKMT2Achr11:118355690chr10:21959376ENST00000534358+10361431_148214443973Zinc fingerPHD-type 1
HgeneKMT2Achr11:118355690chr10:21959376ENST00000534358+10361479_153314443973Zinc fingerPHD-type 2
HgeneKMT2Achr11:118355690chr10:21959376ENST00000534358+10361566_162714443973Zinc fingerPHD-type 3
HgeneKMT2Achr11:118355690chr10:21959376ENST00000534358+10361870_191014443973Zinc fingerC2HC pre-PHD-type
HgeneKMT2Achr11:118355690chr10:21959376ENST00000534358+10361931_197814443973Zinc fingerPHD-type 4
TgeneMLLT10chr11:118352809chr10:22002698ENST00000307729+1223229_2405661069Compositional biasNote=Glu/Lys-rich
TgeneMLLT10chr11:118352809chr10:22002698ENST00000377072+1324229_2405821476Compositional biasNote=Glu/Lys-rich
TgeneMLLT10chr11:118355029chr10:21959376ENST00000307729+823229_2402651069Compositional biasNote=Glu/Lys-rich
TgeneMLLT10chr11:118355029chr10:21959376ENST00000377072+824229_2402651476Compositional biasNote=Glu/Lys-rich
TgeneMLLT10chr11:118355690chr10:21959376ENST00000307729+823229_2402651069Compositional biasNote=Glu/Lys-rich
TgeneMLLT10chr11:118355690chr10:21959376ENST00000377072+824229_2402651476Compositional biasNote=Glu/Lys-rich
TgeneMLLT10chr11:118352809chr10:22002698ENST00000307729+1223311_6745661069RegionNote=DNA-binding
TgeneMLLT10chr11:118352809chr10:22002698ENST00000307729+122380_2875661069RegionNote=Self-association
TgeneMLLT10chr11:118352809chr10:22002698ENST00000377072+1324311_6745821476RegionNote=DNA-binding
TgeneMLLT10chr11:118352809chr10:22002698ENST00000377072+132480_2875821476RegionNote=Self-association
TgeneMLLT10chr11:118355029chr10:21959376ENST00000307729+82380_2872651069RegionNote=Self-association
TgeneMLLT10chr11:118355029chr10:21959376ENST00000377072+82480_2872651476RegionNote=Self-association
TgeneMLLT10chr11:118355690chr10:21959376ENST00000307729+82380_2872651069RegionNote=Self-association
TgeneMLLT10chr11:118355690chr10:21959376ENST00000377072+82480_2872651476RegionNote=Self-association
TgeneMLLT10chr11:118352809chr10:22002698ENST00000307729+1223135_1985661069Zinc fingerPHD-type 2
TgeneMLLT10chr11:118352809chr10:22002698ENST00000307729+122322_745661069Zinc fingerPHD-type 1
TgeneMLLT10chr11:118352809chr10:22002698ENST00000307729+122379_1125661069Zinc fingerC2HC pre-PHD-type
TgeneMLLT10chr11:118352809chr10:22002698ENST00000377072+1324135_1985821476Zinc fingerPHD-type 2
TgeneMLLT10chr11:118352809chr10:22002698ENST00000377072+132422_745821476Zinc fingerPHD-type 1
TgeneMLLT10chr11:118352809chr10:22002698ENST00000377072+132479_1125821476Zinc fingerC2HC pre-PHD-type
TgeneMLLT10chr11:118355029chr10:21875216ENST00000307729+22322_74801069Zinc fingerPHD-type 1
TgeneMLLT10chr11:118355029chr10:21875216ENST00000377072+22422_74801476Zinc fingerPHD-type 1
TgeneMLLT10chr11:118355029chr10:21959376ENST00000307729+823135_1982651069Zinc fingerPHD-type 2
TgeneMLLT10chr11:118355029chr10:21959376ENST00000307729+82322_742651069Zinc fingerPHD-type 1
TgeneMLLT10chr11:118355029chr10:21959376ENST00000307729+82379_1122651069Zinc fingerC2HC pre-PHD-type
TgeneMLLT10chr11:118355029chr10:21959376ENST00000377072+824135_1982651476Zinc fingerPHD-type 2
TgeneMLLT10chr11:118355029chr10:21959376ENST00000377072+82422_742651476Zinc fingerPHD-type 1
TgeneMLLT10chr11:118355029chr10:21959376ENST00000377072+82479_1122651476Zinc fingerC2HC pre-PHD-type
TgeneMLLT10chr11:118355690chr10:21959376ENST00000307729+823135_1982651069Zinc fingerPHD-type 2
TgeneMLLT10chr11:118355690chr10:21959376ENST00000307729+82322_742651069Zinc fingerPHD-type 1
TgeneMLLT10chr11:118355690chr10:21959376ENST00000307729+82379_1122651069Zinc fingerC2HC pre-PHD-type
TgeneMLLT10chr11:118355690chr10:21959376ENST00000377072+824135_1982651476Zinc fingerPHD-type 2
TgeneMLLT10chr11:118355690chr10:21959376ENST00000377072+82422_742651476Zinc fingerPHD-type 1
TgeneMLLT10chr11:118355690chr10:21959376ENST00000377072+82479_1122651476Zinc fingerC2HC pre-PHD-type


Top

FusionGeneSequence for KMT2A_MLLT10


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_KMT2A_ENST00000534358_chr11_118355690_+_MLLT10_ENST00000446906_chr10_21959376_+_2191aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDTDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRTSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKTAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALTPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKEDCEAENVWEMGGLGILTSVPITPRVVCFLCASS
GHVETTTSTSNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQG
SFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLG
NSSLPTAGTKRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSL
SVGSSPVGSEISMQTRHDGACPTTTFSELLNAIHNGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPA
VATTQANTLSGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLPP
VAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSAQ
TAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPA
VSAVGGIIGALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNSQ

>In-frame_KMT2A_ENST00000534358_chr11_118355690_+_MLLT10_ENST00000377072_chr10_21959376_+_2207aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDTDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRTSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKTAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALTPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKEDCEAENVWEMGGLGILTSVPITPRVVCFLCASS
GHVETTTSTSNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQG
SFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLG
NSSLPTAGTKRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSL
SVGSSPVGSEISMQTRHDGACPTTTFSELLNAIHNDRGDSSTLTKQELKFIGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQ
QVGALSPSAVSSAAPAVATTQANTLSGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQ
IRTDQPGNSSLENLPPVAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTI
TANPSPSHQIHTFSAQTAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTV
GALASGMQPVTSTIPAVSAVGGIIGALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQR

>In-frame_KMT2A_ENST00000534358_chr11_118355690_+_MLLT10_ENST00000307729_chr10_21959376_+_2248aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDTDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRTSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKTAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALTPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKEDCEAENVWEMGGLGILTSVPITPRVVCFLCASS
GHVETTTSTSNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQG
SFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLG
NSSLPTAGTKRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSL
SVGSSPVGSEISMQTRHDGACPTTTFSELLNAIHNGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPA
VATTQANTLSGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLPP
VAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSAQ
TAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPA
VSAVGGIIGALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNSQ

>In-frame_KMT2A_ENST00000534358_chr11_118355690_+_MLLT10_ENST00000377059_chr10_21959376_+_2191aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDTDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRTSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKTAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALTPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKEDCEAENVWEMGGLGILTSVPITPRVVCFLCASS
GHVETTTSTSNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQG
SFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLG
NSSLPTAGTKRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSL
SVGSSPVGSEISMQTRHDGACPTTTFSELLNAIHNGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPA
VATTQANTLSGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLPP
VAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSAQ
TAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPA
VSAVGGIIGALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNSQ

>In-frame_KMT2A_ENST00000389506_chr11_118355690_+_MLLT10_ENST00000446906_chr10_21959376_+_2191aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDTDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRTSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKTAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALTPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKEDCEAENVWEMGGLGILTSVPITPRVVCFLCASS
GHVETTTSTSNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQG
SFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLG
NSSLPTAGTKRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSL
SVGSSPVGSEISMQTRHDGACPTTTFSELLNAIHNGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPA
VATTQANTLSGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLPP
VAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSAQ
TAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPA
VSAVGGIIGALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNSQ

>In-frame_KMT2A_ENST00000389506_chr11_118355690_+_MLLT10_ENST00000377072_chr10_21959376_+_2207aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDTDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRTSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKTAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALTPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKEDCEAENVWEMGGLGILTSVPITPRVVCFLCASS
GHVETTTSTSNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQG
SFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLG
NSSLPTAGTKRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSL
SVGSSPVGSEISMQTRHDGACPTTTFSELLNAIHNDRGDSSTLTKQELKFIGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQ
QVGALSPSAVSSAAPAVATTQANTLSGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQ
IRTDQPGNSSLENLPPVAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTI
TANPSPSHQIHTFSAQTAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTV
GALASGMQPVTSTIPAVSAVGGIIGALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQR

>In-frame_KMT2A_ENST00000389506_chr11_118355690_+_MLLT10_ENST00000307729_chr10_21959376_+_2248aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDTDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRTSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKTAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALTPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKEDCEAENVWEMGGLGILTSVPITPRVVCFLCASS
GHVETTTSTSNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQG
SFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLG
NSSLPTAGTKRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSL
SVGSSPVGSEISMQTRHDGACPTTTFSELLNAIHNGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPA
VATTQANTLSGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLPP
VAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSAQ
TAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPA
VSAVGGIIGALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNSQ

>In-frame_KMT2A_ENST00000389506_chr11_118355690_+_MLLT10_ENST00000377059_chr10_21959376_+_2191aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDTDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRTSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKTAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALTPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKEDCEAENVWEMGGLGILTSVPITPRVVCFLCASS
GHVETTTSTSNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQG
SFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLG
NSSLPTAGTKRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSL
SVGSSPVGSEISMQTRHDGACPTTTFSELLNAIHNGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPA
VATTQANTLSGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLPP
VAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSAQ
TAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPA
VSAVGGIIGALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNSQ

>In-frame_KMT2A_ENST00000534358_chr11_118355029_+_MLLT10_ENST00000446906_chr10_21959376_+_2153aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDTDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRTSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKTAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALTPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKTTTSTSNNSISGSLKRLEDTTARFTNANFQEVSA
HTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSH
SQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSLPTAGTKRAQTSGIEEETVKEKKRKGNKQSKHGPG
RPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGSSPVGSEISMQTRHDGACPTTTFSELLNAIHNGIT
NSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPAVATTQANTLSGSSLSQAPSHMTGNRSNSSMAALIAQSE
NNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLPPVAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQ
LQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSAQTAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQ
STSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPAVSAVGGIIGALPGNQLAINGIVGALNGVMQTPVTMSQN

>In-frame_KMT2A_ENST00000534358_chr11_118355029_+_MLLT10_ENST00000377072_chr10_21959376_+_2169aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDTDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRTSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKTAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALTPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKTTTSTSNNSISGSLKRLEDTTARFTNANFQEVSA
HTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSH
SQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSLPTAGTKRAQTSGIEEETVKEKKRKGNKQSKHGPG
RPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGSSPVGSEISMQTRHDGACPTTTFSELLNAIHNDRG
DSSTLTKQELKFIGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPAVATTQANTLSGSSLSQAPSHMT
GNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLPPVAASIEQLLERQWSEGQQFLLE
QGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSAQTAPTTDSLNSSKSPHIGNSFLP
DNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPAVSAVGGIIGALPGNQLAINGIV
GALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNSQQLTPVHRHPHFTQLPPTHFSPS

>In-frame_KMT2A_ENST00000534358_chr11_118355029_+_MLLT10_ENST00000307729_chr10_21959376_+_2210aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDTDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRTSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKTAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALTPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKTTTSTSNNSISGSLKRLEDTTARFTNANFQEVSA
HTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSH
SQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSLPTAGTKRAQTSGIEEETVKEKKRKGNKQSKHGPG
RPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGSSPVGSEISMQTRHDGACPTTTFSELLNAIHNGIT
NSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPAVATTQANTLSGSSLSQAPSHMTGNRSNSSMAALIAQSE
NNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLPPVAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQ
LQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSAQTAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQ
STSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPAVSAVGGIIGALPGNQLAINGIVGALNGVMQTPVTMSQN
PTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNSQQLTPEQHQAFLTQLMQHHHQQHHQPELQQLQIPGPTQI

>In-frame_KMT2A_ENST00000534358_chr11_118355029_+_MLLT10_ENST00000377059_chr10_21959376_+_2153aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDTDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRTSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKTAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALTPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKTTTSTSNNSISGSLKRLEDTTARFTNANFQEVSA
HTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSH
SQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSLPTAGTKRAQTSGIEEETVKEKKRKGNKQSKHGPG
RPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGSSPVGSEISMQTRHDGACPTTTFSELLNAIHNGIT
NSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPAVATTQANTLSGSSLSQAPSHMTGNRSNSSMAALIAQSE
NNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLPPVAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQ
LQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSAQTAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQ
STSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPAVSAVGGIIGALPGNQLAINGIVGALNGVMQTPVTMSQN

>In-frame_KMT2A_ENST00000389506_chr11_118355029_+_MLLT10_ENST00000446906_chr10_21959376_+_2153aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDTDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRTSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKTAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALTPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKTTTSTSNNSISGSLKRLEDTTARFTNANFQEVSA
HTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSH
SQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSLPTAGTKRAQTSGIEEETVKEKKRKGNKQSKHGPG
RPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGSSPVGSEISMQTRHDGACPTTTFSELLNAIHNGIT
NSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPAVATTQANTLSGSSLSQAPSHMTGNRSNSSMAALIAQSE
NNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLPPVAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQ
LQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSAQTAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQ
STSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPAVSAVGGIIGALPGNQLAINGIVGALNGVMQTPVTMSQN

>In-frame_KMT2A_ENST00000389506_chr11_118355029_+_MLLT10_ENST00000377072_chr10_21959376_+_2169aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDTDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRTSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKTAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALTPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKTTTSTSNNSISGSLKRLEDTTARFTNANFQEVSA
HTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSH
SQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSLPTAGTKRAQTSGIEEETVKEKKRKGNKQSKHGPG
RPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGSSPVGSEISMQTRHDGACPTTTFSELLNAIHNDRG
DSSTLTKQELKFIGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPAVATTQANTLSGSSLSQAPSHMT
GNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLPPVAASIEQLLERQWSEGQQFLLE
QGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSAQTAPTTDSLNSSKSPHIGNSFLP
DNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPAVSAVGGIIGALPGNQLAINGIV
GALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNSQQLTPVHRHPHFTQLPPTHFSPS

>In-frame_KMT2A_ENST00000389506_chr11_118355029_+_MLLT10_ENST00000307729_chr10_21959376_+_2210aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDTDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRTSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKTAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALTPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKTTTSTSNNSISGSLKRLEDTTARFTNANFQEVSA
HTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSH
SQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSLPTAGTKRAQTSGIEEETVKEKKRKGNKQSKHGPG
RPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGSSPVGSEISMQTRHDGACPTTTFSELLNAIHNGIT
NSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPAVATTQANTLSGSSLSQAPSHMTGNRSNSSMAALIAQSE
NNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLPPVAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQ
LQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSAQTAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQ
STSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPAVSAVGGIIGALPGNQLAINGIVGALNGVMQTPVTMSQN
PTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNSQQLTPEQHQAFLTQLMQHHHQQHHQPELQQLQIPGPTQI

>In-frame_KMT2A_ENST00000389506_chr11_118355029_+_MLLT10_ENST00000377059_chr10_21959376_+_2153aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDTDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRTSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKTAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALTPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKTTTSTSNNSISGSLKRLEDTTARFTNANFQEVSA
HTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSH
SQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSLPTAGTKRAQTSGIEEETVKEKKRKGNKQSKHGPG
RPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGSSPVGSEISMQTRHDGACPTTTFSELLNAIHNGIT
NSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPAVATTQANTLSGSSLSQAPSHMTGNRSNSSMAALIAQSE
NNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLPPVAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQ
LQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSAQTAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQ
STSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPAVSAVGGIIGALPGNQLAINGIVGALNGVMQTPVTMSQN

>In-frame_KMT2A_ENST00000354520_chr11_118355029_+_MLLT10_ENST00000446906_chr10_21959376_+_2153aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDTDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRTSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKTAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALTPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKTTTSTSNNSISGSLKRLEDTTARFTNANFQEVSA
HTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSH
SQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSLPTAGTKRAQTSGIEEETVKEKKRKGNKQSKHGPG
RPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGSSPVGSEISMQTRHDGACPTTTFSELLNAIHNGIT
NSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPAVATTQANTLSGSSLSQAPSHMTGNRSNSSMAALIAQSE
NNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLPPVAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQ
LQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSAQTAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQ
STSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPAVSAVGGIIGALPGNQLAINGIVGALNGVMQTPVTMSQN

>In-frame_KMT2A_ENST00000354520_chr11_118355029_+_MLLT10_ENST00000377072_chr10_21959376_+_2169aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDTDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRTSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKTAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALTPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKTTTSTSNNSISGSLKRLEDTTARFTNANFQEVSA
HTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSH
SQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSLPTAGTKRAQTSGIEEETVKEKKRKGNKQSKHGPG
RPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGSSPVGSEISMQTRHDGACPTTTFSELLNAIHNDRG
DSSTLTKQELKFIGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPAVATTQANTLSGSSLSQAPSHMT
GNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLPPVAASIEQLLERQWSEGQQFLLE
QGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSAQTAPTTDSLNSSKSPHIGNSFLP
DNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPAVSAVGGIIGALPGNQLAINGIV
GALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNSQQLTPVHRHPHFTQLPPTHFSPS

>In-frame_KMT2A_ENST00000354520_chr11_118355029_+_MLLT10_ENST00000307729_chr10_21959376_+_2210aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDTDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRTSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKTAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALTPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKTTTSTSNNSISGSLKRLEDTTARFTNANFQEVSA
HTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSH
SQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSLPTAGTKRAQTSGIEEETVKEKKRKGNKQSKHGPG
RPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGSSPVGSEISMQTRHDGACPTTTFSELLNAIHNGIT
NSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPAVATTQANTLSGSSLSQAPSHMTGNRSNSSMAALIAQSE
NNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLPPVAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQ
LQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSAQTAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQ
STSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPAVSAVGGIIGALPGNQLAINGIVGALNGVMQTPVTMSQN
PTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNSQQLTPEQHQAFLTQLMQHHHQQHHQPELQQLQIPGPTQI

>In-frame_KMT2A_ENST00000354520_chr11_118355029_+_MLLT10_ENST00000377059_chr10_21959376_+_2153aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDTDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRTSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKTAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALTPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKTTTSTSNNSISGSLKRLEDTTARFTNANFQEVSA
HTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSH
SQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSLPTAGTKRAQTSGIEEETVKEKKRKGNKQSKHGPG
RPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGSSPVGSEISMQTRHDGACPTTTFSELLNAIHNGIT
NSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPAVATTQANTLSGSSLSQAPSHMTGNRSNSSMAALIAQSE
NNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLPPVAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQ
LQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSAQTAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQ
STSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPAVSAVGGIIGALPGNQLAINGIVGALNGVMQTPVTMSQN

>In-frame_KMT2A_ENST00000534358_chr11_118355029_+_MLLT10_ENST00000446906_chr10_21875216_+_2338aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDTDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRTSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKTAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALTPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKRCELCPHKDGALKRTDNGGWAHVVCALTIPEVQF
ANVSTMEPIVLQSVPHDRTNKTCYICDEQGRESKAATGACMTCNKHGCRQAFHVTCAQFAGLLCEEEGNGADNVQYCGYCKYHFSKLKKS
KRGSNRSTDQSLSDSSSHSQDKHHEKEKKKTKEKDKHKQKHKKQPEPSPALVPSLTVTTEKTTTSTSNNSISGSLKRLEDTTARFTNANF
QEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRN
DSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSLPTAGTKRAQTSGIEEETVKEKKRKGNKQS
KHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGSSPVGSEISMQTRHDGACPTTTFSELLNAI
HNGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPAVATTQANTLSGSSLSQAPSHMTGNRSNSSMAAL
IAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLPPVAASIEQLLERQWSEGQQFLLEQGTPSDILGML
KSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSAQTAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDL
TSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPAVSAVGGIIGALPGNQLAINGIVGALNGVMQTPV

>In-frame_KMT2A_ENST00000534358_chr11_118355029_+_MLLT10_ENST00000377072_chr10_21875216_+_2354aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDTDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRTSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKTAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALTPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKRCELCPHKDGALKRTDNGGWAHVVCALTIPEVQF
ANVSTMEPIVLQSVPHDRTNKTCYICDEQGRESKAATGACMTCNKHGCRQAFHVTCAQFAGLLCEEEGNGADNVQYCGYCKYHFSKLKKS
KRGSNRSTDQSLSDSSSHSQDKHHEKEKKKTKEKDKHKQKHKKQPEPSPALVPSLTVTTEKTTTSTSNNSISGSLKRLEDTTARFTNANF
QEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRN
DSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSLPTAGTKRAQTSGIEEETVKEKKRKGNKQS
KHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGSSPVGSEISMQTRHDGACPTTTFSELLNAI
HNDRGDSSTLTKQELKFIGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPAVATTQANTLSGSSLSQA
PSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLPPVAASIEQLLERQWSEGQ
QFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSAQTAPTTDSLNSSKSPHIG
NSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPAVSAVGGIIGALPGNQLA
INGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNSQQLTPVHRHPHFTQLPPT

>In-frame_KMT2A_ENST00000534358_chr11_118355029_+_MLLT10_ENST00000307729_chr10_21875216_+_2395aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDTDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRTSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKTAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALTPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKRCELCPHKDGALKRTDNGGWAHVVCALTIPEVQF
ANVSTMEPIVLQSVPHDRTNKTCYICDEQGRESKAATGACMTCNKHGCRQAFHVTCAQFAGLLCEEEGNGADNVQYCGYCKYHFSKLKKS
KRGSNRSTDQSLSDSSSHSQDKHHEKEKKKTKEKDKHKQKHKKQPEPSPALVPSLTVTTEKTTTSTSNNSISGSLKRLEDTTARFTNANF
QEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRN
DSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSLPTAGTKRAQTSGIEEETVKEKKRKGNKQS
KHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGSSPVGSEISMQTRHDGACPTTTFSELLNAI
HNGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPAVATTQANTLSGSSLSQAPSHMTGNRSNSSMAAL
IAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLPPVAASIEQLLERQWSEGQQFLLEQGTPSDILGML
KSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSAQTAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDL
TSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPAVSAVGGIIGALPGNQLAINGIVGALNGVMQTPV
TMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNSQQLTPEQHQAFLTQLMQHHHQQHHQPELQQLQIP

>In-frame_KMT2A_ENST00000534358_chr11_118355029_+_MLLT10_ENST00000377059_chr10_21875216_+_2338aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDTDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRTSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKTAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALTPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKRCELCPHKDGALKRTDNGGWAHVVCALTIPEVQF
ANVSTMEPIVLQSVPHDRTNKTCYICDEQGRESKAATGACMTCNKHGCRQAFHVTCAQFAGLLCEEEGNGADNVQYCGYCKYHFSKLKKS
KRGSNRSTDQSLSDSSSHSQDKHHEKEKKKTKEKDKHKQKHKKQPEPSPALVPSLTVTTEKTTTSTSNNSISGSLKRLEDTTARFTNANF
QEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRN
DSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSLPTAGTKRAQTSGIEEETVKEKKRKGNKQS
KHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGSSPVGSEISMQTRHDGACPTTTFSELLNAI
HNGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPAVATTQANTLSGSSLSQAPSHMTGNRSNSSMAAL
IAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLPPVAASIEQLLERQWSEGQQFLLEQGTPSDILGML
KSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSAQTAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDL
TSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPAVSAVGGIIGALPGNQLAINGIVGALNGVMQTPV

>In-frame_KMT2A_ENST00000389506_chr11_118355029_+_MLLT10_ENST00000446906_chr10_21875216_+_2338aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDTDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRTSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKTAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALTPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKRCELCPHKDGALKRTDNGGWAHVVCALTIPEVQF
ANVSTMEPIVLQSVPHDRTNKTCYICDEQGRESKAATGACMTCNKHGCRQAFHVTCAQFAGLLCEEEGNGADNVQYCGYCKYHFSKLKKS
KRGSNRSTDQSLSDSSSHSQDKHHEKEKKKTKEKDKHKQKHKKQPEPSPALVPSLTVTTEKTTTSTSNNSISGSLKRLEDTTARFTNANF
QEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRN
DSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSLPTAGTKRAQTSGIEEETVKEKKRKGNKQS
KHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGSSPVGSEISMQTRHDGACPTTTFSELLNAI
HNGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPAVATTQANTLSGSSLSQAPSHMTGNRSNSSMAAL
IAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLPPVAASIEQLLERQWSEGQQFLLEQGTPSDILGML
KSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSAQTAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDL
TSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPAVSAVGGIIGALPGNQLAINGIVGALNGVMQTPV

>In-frame_KMT2A_ENST00000389506_chr11_118355029_+_MLLT10_ENST00000377072_chr10_21875216_+_2354aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDTDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRTSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKTAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALTPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKRCELCPHKDGALKRTDNGGWAHVVCALTIPEVQF
ANVSTMEPIVLQSVPHDRTNKTCYICDEQGRESKAATGACMTCNKHGCRQAFHVTCAQFAGLLCEEEGNGADNVQYCGYCKYHFSKLKKS
KRGSNRSTDQSLSDSSSHSQDKHHEKEKKKTKEKDKHKQKHKKQPEPSPALVPSLTVTTEKTTTSTSNNSISGSLKRLEDTTARFTNANF
QEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRN
DSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSLPTAGTKRAQTSGIEEETVKEKKRKGNKQS
KHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGSSPVGSEISMQTRHDGACPTTTFSELLNAI
HNDRGDSSTLTKQELKFIGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPAVATTQANTLSGSSLSQA
PSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLPPVAASIEQLLERQWSEGQ
QFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSAQTAPTTDSLNSSKSPHIG
NSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPAVSAVGGIIGALPGNQLA
INGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNSQQLTPVHRHPHFTQLPPT

>In-frame_KMT2A_ENST00000389506_chr11_118355029_+_MLLT10_ENST00000307729_chr10_21875216_+_2395aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDTDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRTSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKTAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALTPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKRCELCPHKDGALKRTDNGGWAHVVCALTIPEVQF
ANVSTMEPIVLQSVPHDRTNKTCYICDEQGRESKAATGACMTCNKHGCRQAFHVTCAQFAGLLCEEEGNGADNVQYCGYCKYHFSKLKKS
KRGSNRSTDQSLSDSSSHSQDKHHEKEKKKTKEKDKHKQKHKKQPEPSPALVPSLTVTTEKTTTSTSNNSISGSLKRLEDTTARFTNANF
QEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRN
DSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSLPTAGTKRAQTSGIEEETVKEKKRKGNKQS
KHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGSSPVGSEISMQTRHDGACPTTTFSELLNAI
HNGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPAVATTQANTLSGSSLSQAPSHMTGNRSNSSMAAL
IAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLPPVAASIEQLLERQWSEGQQFLLEQGTPSDILGML
KSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSAQTAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDL
TSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPAVSAVGGIIGALPGNQLAINGIVGALNGVMQTPV
TMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNSQQLTPEQHQAFLTQLMQHHHQQHHQPELQQLQIP

>In-frame_KMT2A_ENST00000389506_chr11_118355029_+_MLLT10_ENST00000377059_chr10_21875216_+_2338aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDTDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRTSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKTAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALTPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKRCELCPHKDGALKRTDNGGWAHVVCALTIPEVQF
ANVSTMEPIVLQSVPHDRTNKTCYICDEQGRESKAATGACMTCNKHGCRQAFHVTCAQFAGLLCEEEGNGADNVQYCGYCKYHFSKLKKS
KRGSNRSTDQSLSDSSSHSQDKHHEKEKKKTKEKDKHKQKHKKQPEPSPALVPSLTVTTEKTTTSTSNNSISGSLKRLEDTTARFTNANF
QEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRN
DSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSLPTAGTKRAQTSGIEEETVKEKKRKGNKQS
KHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGSSPVGSEISMQTRHDGACPTTTFSELLNAI
HNGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPAVATTQANTLSGSSLSQAPSHMTGNRSNSSMAAL
IAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLPPVAASIEQLLERQWSEGQQFLLEQGTPSDILGML
KSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSAQTAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDL
TSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPAVSAVGGIIGALPGNQLAINGIVGALNGVMQTPV

>In-frame_KMT2A_ENST00000354520_chr11_118355029_+_MLLT10_ENST00000446906_chr10_21875216_+_2338aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDTDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRTSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKTAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALTPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKRCELCPHKDGALKRTDNGGWAHVVCALTIPEVQF
ANVSTMEPIVLQSVPHDRTNKTCYICDEQGRESKAATGACMTCNKHGCRQAFHVTCAQFAGLLCEEEGNGADNVQYCGYCKYHFSKLKKS
KRGSNRSTDQSLSDSSSHSQDKHHEKEKKKTKEKDKHKQKHKKQPEPSPALVPSLTVTTEKTTTSTSNNSISGSLKRLEDTTARFTNANF
QEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRN
DSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSLPTAGTKRAQTSGIEEETVKEKKRKGNKQS
KHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGSSPVGSEISMQTRHDGACPTTTFSELLNAI
HNGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPAVATTQANTLSGSSLSQAPSHMTGNRSNSSMAAL
IAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLPPVAASIEQLLERQWSEGQQFLLEQGTPSDILGML
KSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSAQTAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDL
TSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPAVSAVGGIIGALPGNQLAINGIVGALNGVMQTPV

>In-frame_KMT2A_ENST00000354520_chr11_118355029_+_MLLT10_ENST00000377072_chr10_21875216_+_2354aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDTDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRTSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKTAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALTPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKRCELCPHKDGALKRTDNGGWAHVVCALTIPEVQF
ANVSTMEPIVLQSVPHDRTNKTCYICDEQGRESKAATGACMTCNKHGCRQAFHVTCAQFAGLLCEEEGNGADNVQYCGYCKYHFSKLKKS
KRGSNRSTDQSLSDSSSHSQDKHHEKEKKKTKEKDKHKQKHKKQPEPSPALVPSLTVTTEKTTTSTSNNSISGSLKRLEDTTARFTNANF
QEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRN
DSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSLPTAGTKRAQTSGIEEETVKEKKRKGNKQS
KHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGSSPVGSEISMQTRHDGACPTTTFSELLNAI
HNDRGDSSTLTKQELKFIGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPAVATTQANTLSGSSLSQA
PSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLPPVAASIEQLLERQWSEGQ
QFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSAQTAPTTDSLNSSKSPHIG
NSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPAVSAVGGIIGALPGNQLA
INGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNSQQLTPVHRHPHFTQLPPT

>In-frame_KMT2A_ENST00000354520_chr11_118355029_+_MLLT10_ENST00000307729_chr10_21875216_+_2395aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDTDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRTSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKTAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALTPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKRCELCPHKDGALKRTDNGGWAHVVCALTIPEVQF
ANVSTMEPIVLQSVPHDRTNKTCYICDEQGRESKAATGACMTCNKHGCRQAFHVTCAQFAGLLCEEEGNGADNVQYCGYCKYHFSKLKKS
KRGSNRSTDQSLSDSSSHSQDKHHEKEKKKTKEKDKHKQKHKKQPEPSPALVPSLTVTTEKTTTSTSNNSISGSLKRLEDTTARFTNANF
QEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRN
DSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSLPTAGTKRAQTSGIEEETVKEKKRKGNKQS
KHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGSSPVGSEISMQTRHDGACPTTTFSELLNAI
HNGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPAVATTQANTLSGSSLSQAPSHMTGNRSNSSMAAL
IAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLPPVAASIEQLLERQWSEGQQFLLEQGTPSDILGML
KSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSAQTAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDL
TSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPAVSAVGGIIGALPGNQLAINGIVGALNGVMQTPV
TMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNSQQLTPEQHQAFLTQLMQHHHQQHHQPELQQLQIP

>In-frame_KMT2A_ENST00000354520_chr11_118355029_+_MLLT10_ENST00000377059_chr10_21875216_+_2338aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDTDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRTSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKTAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALTPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKRCELCPHKDGALKRTDNGGWAHVVCALTIPEVQF
ANVSTMEPIVLQSVPHDRTNKTCYICDEQGRESKAATGACMTCNKHGCRQAFHVTCAQFAGLLCEEEGNGADNVQYCGYCKYHFSKLKKS
KRGSNRSTDQSLSDSSSHSQDKHHEKEKKKTKEKDKHKQKHKKQPEPSPALVPSLTVTTEKTTTSTSNNSISGSLKRLEDTTARFTNANF
QEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRN
DSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSLPTAGTKRAQTSGIEEETVKEKKRKGNKQS
KHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGSSPVGSEISMQTRHDGACPTTTFSELLNAI
HNGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPAVATTQANTLSGSSLSQAPSHMTGNRSNSSMAAL
IAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLPPVAASIEQLLERQWSEGQQFLLEQGTPSDILGML
KSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSAQTAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDL
TSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPAVSAVGGIIGALPGNQLAINGIVGALNGVMQTPV

>In-frame_KMT2A_ENST00000534358_chr11_118355690_+_MLLT10_ENST00000446906_chr10_21959376_+_2191aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDTDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRTSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKTAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALTPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKEDCEAENVWEMGGLGILTSVPITPRVVCFLCASS
GHVETTTSTSNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQG
SFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLG
NSSLPTAGTKRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSL
SVGSSPVGSEISMQTRHDGACPTTTFSELLNAIHNGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPA
VATTQANTLSGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLPP
VAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSAQ
TAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPA
VSAVGGIIGALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNSQ

>In-frame_KMT2A_ENST00000534358_chr11_118355690_+_MLLT10_ENST00000377072_chr10_21959376_+_2207aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDTDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRTSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKTAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALTPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKEDCEAENVWEMGGLGILTSVPITPRVVCFLCASS
GHVETTTSTSNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQG
SFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLG
NSSLPTAGTKRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSL
SVGSSPVGSEISMQTRHDGACPTTTFSELLNAIHNDRGDSSTLTKQELKFIGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQ
QVGALSPSAVSSAAPAVATTQANTLSGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQ
IRTDQPGNSSLENLPPVAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTI
TANPSPSHQIHTFSAQTAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTV
GALASGMQPVTSTIPAVSAVGGIIGALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQR

>In-frame_KMT2A_ENST00000534358_chr11_118355690_+_MLLT10_ENST00000307729_chr10_21959376_+_2248aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDTDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRTSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKTAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALTPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKEDCEAENVWEMGGLGILTSVPITPRVVCFLCASS
GHVETTTSTSNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQG
SFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLG
NSSLPTAGTKRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSL
SVGSSPVGSEISMQTRHDGACPTTTFSELLNAIHNGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPA
VATTQANTLSGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLPP
VAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSAQ
TAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPA
VSAVGGIIGALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNSQ

>In-frame_KMT2A_ENST00000534358_chr11_118355690_+_MLLT10_ENST00000377059_chr10_21959376_+_2191aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDTDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRTSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKTAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALTPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKEDCEAENVWEMGGLGILTSVPITPRVVCFLCASS
GHVETTTSTSNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQG
SFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLG
NSSLPTAGTKRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSL
SVGSSPVGSEISMQTRHDGACPTTTFSELLNAIHNGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPA
VATTQANTLSGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLPP
VAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSAQ
TAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPA
VSAVGGIIGALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNSQ

>In-frame_KMT2A_ENST00000389506_chr11_118355690_+_MLLT10_ENST00000446906_chr10_21959376_+_2191aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDTDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRTSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKTAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALTPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKEDCEAENVWEMGGLGILTSVPITPRVVCFLCASS
GHVETTTSTSNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQG
SFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLG
NSSLPTAGTKRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSL
SVGSSPVGSEISMQTRHDGACPTTTFSELLNAIHNGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPA
VATTQANTLSGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLPP
VAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSAQ
TAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPA
VSAVGGIIGALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNSQ

>In-frame_KMT2A_ENST00000389506_chr11_118355690_+_MLLT10_ENST00000377072_chr10_21959376_+_2207aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDTDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRTSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKTAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALTPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKEDCEAENVWEMGGLGILTSVPITPRVVCFLCASS
GHVETTTSTSNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQG
SFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLG
NSSLPTAGTKRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSL
SVGSSPVGSEISMQTRHDGACPTTTFSELLNAIHNDRGDSSTLTKQELKFIGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQ
QVGALSPSAVSSAAPAVATTQANTLSGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQ
IRTDQPGNSSLENLPPVAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTI
TANPSPSHQIHTFSAQTAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTV
GALASGMQPVTSTIPAVSAVGGIIGALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQR

>In-frame_KMT2A_ENST00000389506_chr11_118355690_+_MLLT10_ENST00000307729_chr10_21959376_+_2248aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDTDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRTSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKTAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALTPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKEDCEAENVWEMGGLGILTSVPITPRVVCFLCASS
GHVETTTSTSNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQG
SFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLG
NSSLPTAGTKRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSL
SVGSSPVGSEISMQTRHDGACPTTTFSELLNAIHNGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPA
VATTQANTLSGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLPP
VAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSAQ
TAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPA
VSAVGGIIGALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNSQ

>In-frame_KMT2A_ENST00000389506_chr11_118355690_+_MLLT10_ENST00000377059_chr10_21959376_+_2191aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDTDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRTSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKTAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALTPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKEDCEAENVWEMGGLGILTSVPITPRVVCFLCASS
GHVETTTSTSNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQG
SFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLG
NSSLPTAGTKRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSL
SVGSSPVGSEISMQTRHDGACPTTTFSELLNAIHNGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPA
VATTQANTLSGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLPP
VAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSAQ
TAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPA
VSAVGGIIGALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNSQ


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_KMT2A_ENST00000534358_chr11_118355690_+_MLLT10_ENST00000446906_chr10_21959376_+_6573nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGGAGGATTGTGAA
GCAGAAAATGTGTGGGAGATGGGAGGCTTAGGAATCTTGACTTCTGTTCCTATAACACCCAGGGTGGTTTGCTTTCTCTGTGCCAGTAGT
GGGCATGTAGAGACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAAT
GCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCA
GCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGC
AGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGAT
CTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTA
AATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGT
AATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAAT
AAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACA
TCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTC
AGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTG
AATGCAATACACAACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTC
TCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCT
GTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATG
GCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCC
CGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCA
GTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTA
GGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTT
CAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAG
ACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAAT
CAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGC
TCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCC
GTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAG
ACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACT
AACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAA
CAGCTCACACCAGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCATGGAGATAATGCAAGTCAGAAAG

>In-frame_KMT2A_ENST00000534358_chr11_118355690_+_MLLT10_ENST00000377072_chr10_21959376_+_6621nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGGAGGATTGTGAA
GCAGAAAATGTGTGGGAGATGGGAGGCTTAGGAATCTTGACTTCTGTTCCTATAACACCCAGGGTGGTTTGCTTTCTCTGTGCCAGTAGT
GGGCATGTAGAGACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAAT
GCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCA
GCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGC
AGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGAT
CTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTA
AATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGT
AATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAAT
AAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACA
TCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTC
AGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTG
AATGCAATACACAACGACAGAGGTGACAGTTCTACACTAACAAAGCAAGAACTTAAATTCATAGGTATTTATAACAGCAATGATGTAGCA
GTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAA
CAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTC
AGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAA
GATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAG
ATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGT
GAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGA
AGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATA
ACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCT
CATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCA
GCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTG
GGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAAC
CAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCAC
ACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGA
CAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTACACAGGCACCCCCACTTCACACAGCTA

>In-frame_KMT2A_ENST00000534358_chr11_118355690_+_MLLT10_ENST00000307729_chr10_21959376_+_6744nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGGAGGATTGTGAA
GCAGAAAATGTGTGGGAGATGGGAGGCTTAGGAATCTTGACTTCTGTTCCTATAACACCCAGGGTGGTTTGCTTTCTCTGTGCCAGTAGT
GGGCATGTAGAGACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAAT
GCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCA
GCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGC
AGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGAT
CTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTA
AATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGT
AATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAAT
AAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACA
TCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTC
AGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTG
AATGCAATACACAACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTC
TCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCT
GTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATG
GCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCC
CGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCA
GTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTA
GGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTT
CAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAG
ACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAAT
CAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGC
TCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCC
GTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAG
ACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACT
AACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAA
CAGCTCACACCAGAACAACATCAAGCCTTTTTGTATCAGTTAATGCAACATCACCACCAGCAGCACCACCAACCTGAACTTCAGCAGCTG
CAGATCCCTGGACCAACACAAATACCCATAAACAACCTTCTTGCAGGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTT

>In-frame_KMT2A_ENST00000534358_chr11_118355690_+_MLLT10_ENST00000377059_chr10_21959376_+_6573nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGGAGGATTGTGAA
GCAGAAAATGTGTGGGAGATGGGAGGCTTAGGAATCTTGACTTCTGTTCCTATAACACCCAGGGTGGTTTGCTTTCTCTGTGCCAGTAGT
GGGCATGTAGAGACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAAT
GCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCA
GCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGC
AGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGAT
CTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTA
AATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGT
AATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAAT
AAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACA
TCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTC
AGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTG
AATGCAATACACAACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTC
TCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCT
GTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATG
GCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCC
CGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCA
GTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTA
GGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTT
CAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAG
ACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAAT
CAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGC
TCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCC
GTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAG
ACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACT
AACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAA
CAGCTCACACCAGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCATGGAGATAATGCAAGTCAGAAAG

>In-frame_KMT2A_ENST00000389506_chr11_118355690_+_MLLT10_ENST00000446906_chr10_21959376_+_6573nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGGAGGATTGTGAA
GCAGAAAATGTGTGGGAGATGGGAGGCTTAGGAATCTTGACTTCTGTTCCTATAACACCCAGGGTGGTTTGCTTTCTCTGTGCCAGTAGT
GGGCATGTAGAGACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAAT
GCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCA
GCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGC
AGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGAT
CTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTA
AATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGT
AATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAAT
AAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACA
TCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTC
AGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTG
AATGCAATACACAACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTC
TCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCT
GTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATG
GCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCC
CGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCA
GTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTA
GGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTT
CAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAG
ACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAAT
CAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGC
TCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCC
GTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAG
ACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACT
AACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAA
CAGCTCACACCAGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCATGGAGATAATGCAAGTCAGAAAG

>In-frame_KMT2A_ENST00000389506_chr11_118355690_+_MLLT10_ENST00000377072_chr10_21959376_+_6621nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGGAGGATTGTGAA
GCAGAAAATGTGTGGGAGATGGGAGGCTTAGGAATCTTGACTTCTGTTCCTATAACACCCAGGGTGGTTTGCTTTCTCTGTGCCAGTAGT
GGGCATGTAGAGACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAAT
GCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCA
GCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGC
AGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGAT
CTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTA
AATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGT
AATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAAT
AAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACA
TCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTC
AGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTG
AATGCAATACACAACGACAGAGGTGACAGTTCTACACTAACAAAGCAAGAACTTAAATTCATAGGTATTTATAACAGCAATGATGTAGCA
GTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAA
CAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTC
AGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAA
GATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAG
ATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGT
GAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGA
AGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATA
ACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCT
CATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCA
GCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTG
GGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAAC
CAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCAC
ACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGA
CAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTACACAGGCACCCCCACTTCACACAGCTA

>In-frame_KMT2A_ENST00000389506_chr11_118355690_+_MLLT10_ENST00000307729_chr10_21959376_+_6744nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGGAGGATTGTGAA
GCAGAAAATGTGTGGGAGATGGGAGGCTTAGGAATCTTGACTTCTGTTCCTATAACACCCAGGGTGGTTTGCTTTCTCTGTGCCAGTAGT
GGGCATGTAGAGACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAAT
GCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCA
GCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGC
AGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGAT
CTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTA
AATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGT
AATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAAT
AAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACA
TCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTC
AGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTG
AATGCAATACACAACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTC
TCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCT
GTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATG
GCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCC
CGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCA
GTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTA
GGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTT
CAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAG
ACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAAT
CAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGC
TCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCC
GTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAG
ACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACT
AACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAA
CAGCTCACACCAGAACAACATCAAGCCTTTTTGTATCAGTTAATGCAACATCACCACCAGCAGCACCACCAACCTGAACTTCAGCAGCTG
CAGATCCCTGGACCAACACAAATACCCATAAACAACCTTCTTGCAGGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTT

>In-frame_KMT2A_ENST00000389506_chr11_118355690_+_MLLT10_ENST00000377059_chr10_21959376_+_6573nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGGAGGATTGTGAA
GCAGAAAATGTGTGGGAGATGGGAGGCTTAGGAATCTTGACTTCTGTTCCTATAACACCCAGGGTGGTTTGCTTTCTCTGTGCCAGTAGT
GGGCATGTAGAGACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAAT
GCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCA
GCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGC
AGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGAT
CTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTA
AATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGT
AATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAAT
AAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACA
TCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTC
AGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTG
AATGCAATACACAACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTC
TCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCT
GTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATG
GCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCC
CGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCA
GTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTA
GGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTT
CAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAG
ACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAAT
CAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGC
TCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCC
GTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAG
ACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACT
AACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAA
CAGCTCACACCAGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCATGGAGATAATGCAAGTCAGAAAG

>In-frame_KMT2A_ENST00000534358_chr11_118355029_+_MLLT10_ENST00000446906_chr10_21959376_+_6459nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGACTTATACAAGC
ACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCA
CACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGA
AGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGT
GTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCAC
TCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGC
CTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGA
TATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGC
AGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGA
AGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGT
TCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGGTATTTAT
AACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAG
TCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACT
CTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAA
AACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCC
CCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTT
TTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAA
CTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCA
GTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTG
AACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAA
AGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAG
GTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATT
GGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAAC
CCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTA
CTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTACACAGGCAC

>In-frame_KMT2A_ENST00000534358_chr11_118355029_+_MLLT10_ENST00000377072_chr10_21959376_+_6507nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGACTTATACAAGC
ACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCA
CACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGA
AGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGT
GTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCAC
TCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGC
CTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGA
TATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGC
AGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGA
AGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGT
TCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGACAGAGGT
GACAGTTCTACACTAACAAAGCAAGAACTTAAATTCATAGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCT
GGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCA
GCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTAT
GGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAAC
CTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAAC
AGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAA
CAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAAC
TTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCAT
CAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCT
GATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCT
GGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAG
CCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTA
GGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACA
CATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAG
TTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCC

>In-frame_KMT2A_ENST00000534358_chr11_118355029_+_MLLT10_ENST00000307729_chr10_21959376_+_6630nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGACTTATACAAGC
ACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCA
CACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGA
AGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGT
GTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCAC
TCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGC
CTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGA
TATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGC
AGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGA
AGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGT
TCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGGTATTTAT
AACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAG
TCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACT
CTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAA
AACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCC
CCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTT
TTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAA
CTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCA
GTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTG
AACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAA
AGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAG
GTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATT
GGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAAC
CCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTA
CTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGAACAACATCAA
GCCTTTTTGTATCAGTTAATGCAACATCACCACCAGCAGCACCACCAACCTGAACTTCAGCAGCTGCAGATCCCTGGACCAACACAAATA
CCCATAAACAACCTTCTTGCAGGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCATGGAGATAATGCA

>In-frame_KMT2A_ENST00000534358_chr11_118355029_+_MLLT10_ENST00000377059_chr10_21959376_+_6459nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGACTTATACAAGC
ACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCA
CACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGA
AGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGT
GTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCAC
TCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGC
CTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGA
TATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGC
AGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGA
AGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGT
TCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGGTATTTAT
AACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAG
TCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACT
CTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAA
AACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCC
CCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTT
TTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAA
CTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCA
GTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTG
AACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAA
AGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAG
GTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATT
GGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAAC
CCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTA
CTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTACACAGGCAC

>In-frame_KMT2A_ENST00000389506_chr11_118355029_+_MLLT10_ENST00000446906_chr10_21959376_+_6459nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGACTTATACAAGC
ACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCA
CACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGA
AGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGT
GTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCAC
TCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGC
CTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGA
TATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGC
AGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGA
AGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGT
TCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGGTATTTAT
AACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAG
TCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACT
CTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAA
AACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCC
CCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTT
TTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAA
CTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCA
GTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTG
AACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAA
AGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAG
GTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATT
GGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAAC
CCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTA
CTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTACACAGGCAC

>In-frame_KMT2A_ENST00000389506_chr11_118355029_+_MLLT10_ENST00000377072_chr10_21959376_+_6507nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGACTTATACAAGC
ACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCA
CACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGA
AGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGT
GTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCAC
TCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGC
CTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGA
TATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGC
AGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGA
AGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGT
TCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGACAGAGGT
GACAGTTCTACACTAACAAAGCAAGAACTTAAATTCATAGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCT
GGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCA
GCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTAT
GGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAAC
CTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAAC
AGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAA
CAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAAC
TTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCAT
CAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCT
GATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCT
GGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAG
CCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTA
GGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACA
CATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAG
TTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCC

>In-frame_KMT2A_ENST00000389506_chr11_118355029_+_MLLT10_ENST00000307729_chr10_21959376_+_6630nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGACTTATACAAGC
ACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCA
CACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGA
AGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGT
GTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCAC
TCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGC
CTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGA
TATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGC
AGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGA
AGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGT
TCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGGTATTTAT
AACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAG
TCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACT
CTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAA
AACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCC
CCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTT
TTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAA
CTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCA
GTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTG
AACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAA
AGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAG
GTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATT
GGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAAC
CCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTA
CTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGAACAACATCAA
GCCTTTTTGTATCAGTTAATGCAACATCACCACCAGCAGCACCACCAACCTGAACTTCAGCAGCTGCAGATCCCTGGACCAACACAAATA
CCCATAAACAACCTTCTTGCAGGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCATGGAGATAATGCA

>In-frame_KMT2A_ENST00000389506_chr11_118355029_+_MLLT10_ENST00000377059_chr10_21959376_+_6459nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGACTTATACAAGC
ACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCA
CACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGA
AGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGT
GTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCAC
TCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGC
CTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGA
TATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGC
AGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGA
AGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGT
TCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGGTATTTAT
AACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAG
TCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACT
CTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAA
AACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCC
CCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTT
TTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAA
CTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCA
GTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTG
AACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAA
AGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAG
GTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATT
GGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAAC
CCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTA
CTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTACACAGGCAC

>In-frame_KMT2A_ENST00000354520_chr11_118355029_+_MLLT10_ENST00000446906_chr10_21959376_+_6459nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGACTTATACAAGC
ACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCA
CACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGA
AGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGT
GTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCAC
TCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGC
CTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGA
TATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGC
AGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGA
AGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGT
TCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGGTATTTAT
AACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAG
TCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACT
CTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAA
AACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCC
CCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTT
TTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAA
CTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCA
GTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTG
AACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAA
AGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAG
GTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATT
GGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAAC
CCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTA
CTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTACACAGGCAC

>In-frame_KMT2A_ENST00000354520_chr11_118355029_+_MLLT10_ENST00000377072_chr10_21959376_+_6507nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGACTTATACAAGC
ACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCA
CACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGA
AGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGT
GTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCAC
TCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGC
CTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGA
TATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGC
AGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGA
AGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGT
TCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGACAGAGGT
GACAGTTCTACACTAACAAAGCAAGAACTTAAATTCATAGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCT
GGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCA
GCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTAT
GGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAAC
CTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAAC
AGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAA
CAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAAC
TTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCAT
CAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCT
GATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCT
GGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAG
CCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTA
GGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACA
CATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAG
TTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCC

>In-frame_KMT2A_ENST00000354520_chr11_118355029_+_MLLT10_ENST00000307729_chr10_21959376_+_6630nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGACTTATACAAGC
ACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCA
CACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGA
AGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGT
GTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCAC
TCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGC
CTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGA
TATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGC
AGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGA
AGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGT
TCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGGTATTTAT
AACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAG
TCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACT
CTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAA
AACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCC
CCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTT
TTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAA
CTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCA
GTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTG
AACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAA
AGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAG
GTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATT
GGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAAC
CCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTA
CTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGAACAACATCAA
GCCTTTTTGTATCAGTTAATGCAACATCACCACCAGCAGCACCACCAACCTGAACTTCAGCAGCTGCAGATCCCTGGACCAACACAAATA
CCCATAAACAACCTTCTTGCAGGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCATGGAGATAATGCA

>In-frame_KMT2A_ENST00000354520_chr11_118355029_+_MLLT10_ENST00000377059_chr10_21959376_+_6459nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGACTTATACAAGC
ACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCA
CACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGA
AGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGT
GTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCAC
TCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGC
CTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGA
TATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGC
AGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGA
AGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGT
TCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGGTATTTAT
AACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAG
TCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACT
CTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAA
AACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCC
CCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTT
TTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAA
CTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCA
GTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTG
AACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAA
AGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAG
GTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATT
GGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAAC
CCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTA
CTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTACACAGGCAC

>In-frame_KMT2A_ENST00000534358_chr11_118355029_+_MLLT10_ENST00000446906_chr10_21875216_+_7014nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGAGATGTGAACTT
TGTCCCCATAAGGATGGAGCTTTAAAAAGAACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCAGAGGTACAATTT
GCCAATGTTTCCACAATGGAACCAATTGTTTTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACATTTGTGATGAACAAGGA
AGAGAAAGCAAAGCAGCCACTGGTGCTTGCATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAACATGCGCTCAGTTTGCC
GGACTGCTTTGTGAAGAAGAAGGTAATGGTGCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAGCTGAAAAAGAGC
AAACGGGGATCTAATAGGTCATATGATCAAAGTTTAAGTGATTCTTCCTCTCACTCTCAGGATAAACATCATGAGAAAGAGAAAAAAAAA
TATAAAGAGAAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAA
AAAACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTC
CAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGC
TCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCA
GGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAAT
GACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTT
AGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGC
CTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGT
AAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTA
GCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGC
TCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATA
CACAACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCT
CACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACA
ACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTT
ATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGT
CTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCC
AGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTG
AAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTG
AATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCT
ACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTA
ACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTG
AGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCA
GTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTC
ACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCC
TCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACA

>In-frame_KMT2A_ENST00000534358_chr11_118355029_+_MLLT10_ENST00000377072_chr10_21875216_+_7062nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGAGATGTGAACTT
TGTCCCCATAAGGATGGAGCTTTAAAAAGAACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCAGAGGTACAATTT
GCCAATGTTTCCACAATGGAACCAATTGTTTTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACATTTGTGATGAACAAGGA
AGAGAAAGCAAAGCAGCCACTGGTGCTTGCATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAACATGCGCTCAGTTTGCC
GGACTGCTTTGTGAAGAAGAAGGTAATGGTGCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAGCTGAAAAAGAGC
AAACGGGGATCTAATAGGTCATATGATCAAAGTTTAAGTGATTCTTCCTCTCACTCTCAGGATAAACATCATGAGAAAGAGAAAAAAAAA
TATAAAGAGAAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAA
AAAACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTC
CAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGC
TCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCA
GGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAAT
GACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTT
AGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGC
CTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGT
AAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTA
GCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGC
TCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATA
CACAACGACAGAGGTGACAGTTCTACACTAACAAAGCAAGAACTTAAATTCATAGGTATTTATAACAGCAATGATGTAGCAGTATCGTTT
CCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGA
GCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCA
CCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGA
GACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTAT
GATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAG
CAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAG
GAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAAT
CCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGA
AACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCT
ACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTA
GCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCA
ATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTA
CCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTT
ATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTACACAGGCACCCCCACTTCACACAGCTACCACCAACC

>In-frame_KMT2A_ENST00000534358_chr11_118355029_+_MLLT10_ENST00000307729_chr10_21875216_+_7185nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGAGATGTGAACTT
TGTCCCCATAAGGATGGAGCTTTAAAAAGAACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCAGAGGTACAATTT
GCCAATGTTTCCACAATGGAACCAATTGTTTTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACATTTGTGATGAACAAGGA
AGAGAAAGCAAAGCAGCCACTGGTGCTTGCATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAACATGCGCTCAGTTTGCC
GGACTGCTTTGTGAAGAAGAAGGTAATGGTGCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAGCTGAAAAAGAGC
AAACGGGGATCTAATAGGTCATATGATCAAAGTTTAAGTGATTCTTCCTCTCACTCTCAGGATAAACATCATGAGAAAGAGAAAAAAAAA
TATAAAGAGAAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAA
AAAACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTC
CAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGC
TCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCA
GGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAAT
GACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTT
AGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGC
CTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGT
AAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTA
GCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGC
TCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATA
CACAACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCT
CACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACA
ACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTT
ATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGT
CTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCC
AGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTG
AAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTG
AATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCT
ACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTA
ACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTG
AGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCA
GTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTC
ACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCC
TCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACA
CCAGAACAACATCAAGCCTTTTTGTATCAGTTAATGCAACATCACCACCAGCAGCACCACCAACCTGAACTTCAGCAGCTGCAGATCCCT
GGACCAACACAAATACCCATAAACAACCTTCTTGCAGGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATC

>In-frame_KMT2A_ENST00000534358_chr11_118355029_+_MLLT10_ENST00000377059_chr10_21875216_+_7014nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGAGATGTGAACTT
TGTCCCCATAAGGATGGAGCTTTAAAAAGAACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCAGAGGTACAATTT
GCCAATGTTTCCACAATGGAACCAATTGTTTTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACATTTGTGATGAACAAGGA
AGAGAAAGCAAAGCAGCCACTGGTGCTTGCATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAACATGCGCTCAGTTTGCC
GGACTGCTTTGTGAAGAAGAAGGTAATGGTGCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAGCTGAAAAAGAGC
AAACGGGGATCTAATAGGTCATATGATCAAAGTTTAAGTGATTCTTCCTCTCACTCTCAGGATAAACATCATGAGAAAGAGAAAAAAAAA
TATAAAGAGAAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAA
AAAACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTC
CAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGC
TCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCA
GGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAAT
GACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTT
AGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGC
CTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGT
AAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTA
GCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGC
TCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATA
CACAACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCT
CACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACA
ACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTT
ATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGT
CTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCC
AGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTG
AAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTG
AATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCT
ACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTA
ACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTG
AGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCA
GTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTC
ACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCC
TCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACA

>In-frame_KMT2A_ENST00000389506_chr11_118355029_+_MLLT10_ENST00000446906_chr10_21875216_+_7014nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGAGATGTGAACTT
TGTCCCCATAAGGATGGAGCTTTAAAAAGAACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCAGAGGTACAATTT
GCCAATGTTTCCACAATGGAACCAATTGTTTTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACATTTGTGATGAACAAGGA
AGAGAAAGCAAAGCAGCCACTGGTGCTTGCATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAACATGCGCTCAGTTTGCC
GGACTGCTTTGTGAAGAAGAAGGTAATGGTGCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAGCTGAAAAAGAGC
AAACGGGGATCTAATAGGTCATATGATCAAAGTTTAAGTGATTCTTCCTCTCACTCTCAGGATAAACATCATGAGAAAGAGAAAAAAAAA
TATAAAGAGAAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAA
AAAACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTC
CAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGC
TCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCA
GGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAAT
GACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTT
AGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGC
CTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGT
AAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTA
GCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGC
TCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATA
CACAACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCT
CACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACA
ACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTT
ATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGT
CTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCC
AGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTG
AAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTG
AATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCT
ACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTA
ACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTG
AGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCA
GTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTC
ACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCC
TCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACA

>In-frame_KMT2A_ENST00000389506_chr11_118355029_+_MLLT10_ENST00000377072_chr10_21875216_+_7062nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGAGATGTGAACTT
TGTCCCCATAAGGATGGAGCTTTAAAAAGAACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCAGAGGTACAATTT
GCCAATGTTTCCACAATGGAACCAATTGTTTTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACATTTGTGATGAACAAGGA
AGAGAAAGCAAAGCAGCCACTGGTGCTTGCATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAACATGCGCTCAGTTTGCC
GGACTGCTTTGTGAAGAAGAAGGTAATGGTGCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAGCTGAAAAAGAGC
AAACGGGGATCTAATAGGTCATATGATCAAAGTTTAAGTGATTCTTCCTCTCACTCTCAGGATAAACATCATGAGAAAGAGAAAAAAAAA
TATAAAGAGAAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAA
AAAACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTC
CAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGC
TCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCA
GGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAAT
GACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTT
AGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGC
CTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGT
AAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTA
GCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGC
TCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATA
CACAACGACAGAGGTGACAGTTCTACACTAACAAAGCAAGAACTTAAATTCATAGGTATTTATAACAGCAATGATGTAGCAGTATCGTTT
CCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGA
GCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCA
CCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGA
GACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTAT
GATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAG
CAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAG
GAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAAT
CCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGA
AACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCT
ACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTA
GCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCA
ATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTA
CCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTT
ATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTACACAGGCACCCCCACTTCACACAGCTACCACCAACC

>In-frame_KMT2A_ENST00000389506_chr11_118355029_+_MLLT10_ENST00000307729_chr10_21875216_+_7185nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGAGATGTGAACTT
TGTCCCCATAAGGATGGAGCTTTAAAAAGAACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCAGAGGTACAATTT
GCCAATGTTTCCACAATGGAACCAATTGTTTTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACATTTGTGATGAACAAGGA
AGAGAAAGCAAAGCAGCCACTGGTGCTTGCATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAACATGCGCTCAGTTTGCC
GGACTGCTTTGTGAAGAAGAAGGTAATGGTGCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAGCTGAAAAAGAGC
AAACGGGGATCTAATAGGTCATATGATCAAAGTTTAAGTGATTCTTCCTCTCACTCTCAGGATAAACATCATGAGAAAGAGAAAAAAAAA
TATAAAGAGAAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAA
AAAACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTC
CAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGC
TCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCA
GGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAAT
GACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTT
AGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGC
CTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGT
AAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTA
GCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGC
TCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATA
CACAACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCT
CACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACA
ACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTT
ATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGT
CTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCC
AGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTG
AAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTG
AATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCT
ACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTA
ACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTG
AGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCA
GTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTC
ACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCC
TCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACA
CCAGAACAACATCAAGCCTTTTTGTATCAGTTAATGCAACATCACCACCAGCAGCACCACCAACCTGAACTTCAGCAGCTGCAGATCCCT
GGACCAACACAAATACCCATAAACAACCTTCTTGCAGGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATC

>In-frame_KMT2A_ENST00000389506_chr11_118355029_+_MLLT10_ENST00000377059_chr10_21875216_+_7014nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGAGATGTGAACTT
TGTCCCCATAAGGATGGAGCTTTAAAAAGAACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCAGAGGTACAATTT
GCCAATGTTTCCACAATGGAACCAATTGTTTTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACATTTGTGATGAACAAGGA
AGAGAAAGCAAAGCAGCCACTGGTGCTTGCATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAACATGCGCTCAGTTTGCC
GGACTGCTTTGTGAAGAAGAAGGTAATGGTGCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAGCTGAAAAAGAGC
AAACGGGGATCTAATAGGTCATATGATCAAAGTTTAAGTGATTCTTCCTCTCACTCTCAGGATAAACATCATGAGAAAGAGAAAAAAAAA
TATAAAGAGAAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAA
AAAACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTC
CAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGC
TCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCA
GGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAAT
GACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTT
AGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGC
CTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGT
AAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTA
GCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGC
TCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATA
CACAACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCT
CACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACA
ACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTT
ATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGT
CTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCC
AGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTG
AAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTG
AATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCT
ACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTA
ACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTG
AGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCA
GTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTC
ACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCC
TCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACA

>In-frame_KMT2A_ENST00000354520_chr11_118355029_+_MLLT10_ENST00000446906_chr10_21875216_+_7014nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGAGATGTGAACTT
TGTCCCCATAAGGATGGAGCTTTAAAAAGAACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCAGAGGTACAATTT
GCCAATGTTTCCACAATGGAACCAATTGTTTTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACATTTGTGATGAACAAGGA
AGAGAAAGCAAAGCAGCCACTGGTGCTTGCATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAACATGCGCTCAGTTTGCC
GGACTGCTTTGTGAAGAAGAAGGTAATGGTGCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAGCTGAAAAAGAGC
AAACGGGGATCTAATAGGTCATATGATCAAAGTTTAAGTGATTCTTCCTCTCACTCTCAGGATAAACATCATGAGAAAGAGAAAAAAAAA
TATAAAGAGAAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAA
AAAACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTC
CAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGC
TCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCA
GGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAAT
GACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTT
AGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGC
CTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGT
AAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTA
GCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGC
TCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATA
CACAACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCT
CACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACA
ACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTT
ATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGT
CTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCC
AGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTG
AAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTG
AATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCT
ACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTA
ACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTG
AGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCA
GTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTC
ACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCC
TCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACA

>In-frame_KMT2A_ENST00000354520_chr11_118355029_+_MLLT10_ENST00000377072_chr10_21875216_+_7062nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGAGATGTGAACTT
TGTCCCCATAAGGATGGAGCTTTAAAAAGAACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCAGAGGTACAATTT
GCCAATGTTTCCACAATGGAACCAATTGTTTTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACATTTGTGATGAACAAGGA
AGAGAAAGCAAAGCAGCCACTGGTGCTTGCATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAACATGCGCTCAGTTTGCC
GGACTGCTTTGTGAAGAAGAAGGTAATGGTGCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAGCTGAAAAAGAGC
AAACGGGGATCTAATAGGTCATATGATCAAAGTTTAAGTGATTCTTCCTCTCACTCTCAGGATAAACATCATGAGAAAGAGAAAAAAAAA
TATAAAGAGAAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAA
AAAACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTC
CAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGC
TCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCA
GGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAAT
GACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTT
AGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGC
CTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGT
AAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTA
GCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGC
TCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATA
CACAACGACAGAGGTGACAGTTCTACACTAACAAAGCAAGAACTTAAATTCATAGGTATTTATAACAGCAATGATGTAGCAGTATCGTTT
CCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGA
GCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCA
CCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGA
GACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTAT
GATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAG
CAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAG
GAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAAT
CCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGA
AACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCT
ACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTA
GCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCA
ATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTA
CCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTT
ATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTACACAGGCACCCCCACTTCACACAGCTACCACCAACC

>In-frame_KMT2A_ENST00000354520_chr11_118355029_+_MLLT10_ENST00000307729_chr10_21875216_+_7185nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGAGATGTGAACTT
TGTCCCCATAAGGATGGAGCTTTAAAAAGAACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCAGAGGTACAATTT
GCCAATGTTTCCACAATGGAACCAATTGTTTTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACATTTGTGATGAACAAGGA
AGAGAAAGCAAAGCAGCCACTGGTGCTTGCATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAACATGCGCTCAGTTTGCC
GGACTGCTTTGTGAAGAAGAAGGTAATGGTGCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAGCTGAAAAAGAGC
AAACGGGGATCTAATAGGTCATATGATCAAAGTTTAAGTGATTCTTCCTCTCACTCTCAGGATAAACATCATGAGAAAGAGAAAAAAAAA
TATAAAGAGAAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAA
AAAACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTC
CAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGC
TCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCA
GGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAAT
GACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTT
AGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGC
CTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGT
AAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTA
GCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGC
TCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATA
CACAACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCT
CACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACA
ACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTT
ATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGT
CTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCC
AGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTG
AAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTG
AATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCT
ACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTA
ACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTG
AGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCA
GTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTC
ACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCC
TCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACA
CCAGAACAACATCAAGCCTTTTTGTATCAGTTAATGCAACATCACCACCAGCAGCACCACCAACCTGAACTTCAGCAGCTGCAGATCCCT
GGACCAACACAAATACCCATAAACAACCTTCTTGCAGGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATC

>In-frame_KMT2A_ENST00000354520_chr11_118355029_+_MLLT10_ENST00000377059_chr10_21875216_+_7014nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGAGATGTGAACTT
TGTCCCCATAAGGATGGAGCTTTAAAAAGAACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCAGAGGTACAATTT
GCCAATGTTTCCACAATGGAACCAATTGTTTTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACATTTGTGATGAACAAGGA
AGAGAAAGCAAAGCAGCCACTGGTGCTTGCATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAACATGCGCTCAGTTTGCC
GGACTGCTTTGTGAAGAAGAAGGTAATGGTGCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAGCTGAAAAAGAGC
AAACGGGGATCTAATAGGTCATATGATCAAAGTTTAAGTGATTCTTCCTCTCACTCTCAGGATAAACATCATGAGAAAGAGAAAAAAAAA
TATAAAGAGAAGGACAAACACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAA
AAAACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTC
CAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGC
TCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCA
GGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAAT
GACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTT
AGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGC
CTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGT
AAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTA
GCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGC
TCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATA
CACAACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCT
CACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACA
ACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTT
ATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGT
CTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCC
AGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTG
AAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTG
AATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCT
ACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTA
ACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTG
AGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCA
GTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTC
ACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCC
TCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACA

>In-frame_KMT2A_ENST00000534358_chr11_118355690_+_MLLT10_ENST00000446906_chr10_21959376_+_6573nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGGAGGATTGTGAA
GCAGAAAATGTGTGGGAGATGGGAGGCTTAGGAATCTTGACTTCTGTTCCTATAACACCCAGGGTGGTTTGCTTTCTCTGTGCCAGTAGT
GGGCATGTAGAGACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAAT
GCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCA
GCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGC
AGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGAT
CTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTA
AATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGT
AATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAAT
AAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACA
TCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTC
AGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTG
AATGCAATACACAACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTC
TCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCT
GTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATG
GCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCC
CGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCA
GTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTA
GGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTT
CAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAG
ACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAAT
CAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGC
TCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCC
GTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAG
ACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACT
AACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAA
CAGCTCACACCAGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCATGGAGATAATGCAAGTCAGAAAG

>In-frame_KMT2A_ENST00000534358_chr11_118355690_+_MLLT10_ENST00000377072_chr10_21959376_+_6621nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGGAGGATTGTGAA
GCAGAAAATGTGTGGGAGATGGGAGGCTTAGGAATCTTGACTTCTGTTCCTATAACACCCAGGGTGGTTTGCTTTCTCTGTGCCAGTAGT
GGGCATGTAGAGACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAAT
GCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCA
GCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGC
AGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGAT
CTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTA
AATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGT
AATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAAT
AAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACA
TCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTC
AGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTG
AATGCAATACACAACGACAGAGGTGACAGTTCTACACTAACAAAGCAAGAACTTAAATTCATAGGTATTTATAACAGCAATGATGTAGCA
GTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAA
CAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTC
AGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAA
GATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAG
ATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGT
GAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGA
AGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATA
ACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCT
CATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCA
GCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTG
GGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAAC
CAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCAC
ACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGA
CAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTACACAGGCACCCCCACTTCACACAGCTA

>In-frame_KMT2A_ENST00000534358_chr11_118355690_+_MLLT10_ENST00000307729_chr10_21959376_+_6744nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGGAGGATTGTGAA
GCAGAAAATGTGTGGGAGATGGGAGGCTTAGGAATCTTGACTTCTGTTCCTATAACACCCAGGGTGGTTTGCTTTCTCTGTGCCAGTAGT
GGGCATGTAGAGACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAAT
GCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCA
GCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGC
AGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGAT
CTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTA
AATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGT
AATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAAT
AAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACA
TCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTC
AGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTG
AATGCAATACACAACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTC
TCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCT
GTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATG
GCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCC
CGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCA
GTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTA
GGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTT
CAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAG
ACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAAT
CAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGC
TCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCC
GTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAG
ACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACT
AACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAA
CAGCTCACACCAGAACAACATCAAGCCTTTTTGTATCAGTTAATGCAACATCACCACCAGCAGCACCACCAACCTGAACTTCAGCAGCTG
CAGATCCCTGGACCAACACAAATACCCATAAACAACCTTCTTGCAGGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTT

>In-frame_KMT2A_ENST00000534358_chr11_118355690_+_MLLT10_ENST00000377059_chr10_21959376_+_6573nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGGAGGATTGTGAA
GCAGAAAATGTGTGGGAGATGGGAGGCTTAGGAATCTTGACTTCTGTTCCTATAACACCCAGGGTGGTTTGCTTTCTCTGTGCCAGTAGT
GGGCATGTAGAGACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAAT
GCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCA
GCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGC
AGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGAT
CTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTA
AATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGT
AATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAAT
AAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACA
TCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTC
AGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTG
AATGCAATACACAACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTC
TCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCT
GTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATG
GCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCC
CGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCA
GTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTA
GGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTT
CAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAG
ACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAAT
CAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGC
TCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCC
GTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAG
ACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACT
AACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAA
CAGCTCACACCAGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCATGGAGATAATGCAAGTCAGAAAG

>In-frame_KMT2A_ENST00000389506_chr11_118355690_+_MLLT10_ENST00000446906_chr10_21959376_+_6573nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGGAGGATTGTGAA
GCAGAAAATGTGTGGGAGATGGGAGGCTTAGGAATCTTGACTTCTGTTCCTATAACACCCAGGGTGGTTTGCTTTCTCTGTGCCAGTAGT
GGGCATGTAGAGACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAAT
GCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCA
GCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGC
AGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGAT
CTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTA
AATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGT
AATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAAT
AAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACA
TCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTC
AGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTG
AATGCAATACACAACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTC
TCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCT
GTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATG
GCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCC
CGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCA
GTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTA
GGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTT
CAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAG
ACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAAT
CAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGC
TCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCC
GTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAG
ACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACT
AACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAA
CAGCTCACACCAGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCATGGAGATAATGCAAGTCAGAAAG

>In-frame_KMT2A_ENST00000389506_chr11_118355690_+_MLLT10_ENST00000377072_chr10_21959376_+_6621nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGGAGGATTGTGAA
GCAGAAAATGTGTGGGAGATGGGAGGCTTAGGAATCTTGACTTCTGTTCCTATAACACCCAGGGTGGTTTGCTTTCTCTGTGCCAGTAGT
GGGCATGTAGAGACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAAT
GCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCA
GCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGC
AGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGAT
CTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTA
AATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGT
AATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAAT
AAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACA
TCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTC
AGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTG
AATGCAATACACAACGACAGAGGTGACAGTTCTACACTAACAAAGCAAGAACTTAAATTCATAGGTATTTATAACAGCAATGATGTAGCA
GTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAA
CAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTC
AGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAA
GATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAG
ATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGT
GAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGA
AGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATA
ACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCT
CATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCA
GCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTG
GGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAAC
CAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCAC
ACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGA
CAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTACACAGGCACCCCCACTTCACACAGCTA

>In-frame_KMT2A_ENST00000389506_chr11_118355690_+_MLLT10_ENST00000307729_chr10_21959376_+_6744nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGGAGGATTGTGAA
GCAGAAAATGTGTGGGAGATGGGAGGCTTAGGAATCTTGACTTCTGTTCCTATAACACCCAGGGTGGTTTGCTTTCTCTGTGCCAGTAGT
GGGCATGTAGAGACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAAT
GCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCA
GCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGC
AGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGAT
CTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTA
AATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGT
AATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAAT
AAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACA
TCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTC
AGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTG
AATGCAATACACAACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTC
TCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCT
GTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATG
GCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCC
CGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCA
GTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTA
GGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTT
CAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAG
ACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAAT
CAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGC
TCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCC
GTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAG
ACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACT
AACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAA
CAGCTCACACCAGAACAACATCAAGCCTTTTTGTATCAGTTAATGCAACATCACCACCAGCAGCACCACCAACCTGAACTTCAGCAGCTG
CAGATCCCTGGACCAACACAAATACCCATAAACAACCTTCTTGCAGGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTT

>In-frame_KMT2A_ENST00000389506_chr11_118355690_+_MLLT10_ENST00000377059_chr10_21959376_+_6573nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGGAGGATTGTGAA
GCAGAAAATGTGTGGGAGATGGGAGGCTTAGGAATCTTGACTTCTGTTCCTATAACACCCAGGGTGGTTTGCTTTCTCTGTGCCAGTAGT
GGGCATGTAGAGACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAAT
GCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCA
GCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGC
AGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGAT
CTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTA
AATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGT
AATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAAT
AAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACA
TCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTC
AGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTG
AATGCAATACACAACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTC
TCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCT
GTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATG
GCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCC
CGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCA
GTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTA
GGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTT
CAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAG
ACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAAT
CAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGC
TCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCC
GTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAG
ACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACT
AACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAA
CAGCTCACACCAGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCATGGAGATAATGCAAGTCAGAAAG


* Fusion transcript sequences (Full-length transcript).
>In-frame_KMT2A_ENST00000534358_chr11_118355690_+_MLLT10_ENST00000446906_chr10_21959376_+_8285nt
CTGCTTCACTTCACGGGGCGAACATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGG
GGCGCCGGGGCCTAGGGGGCGCCCCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGG
CGCCCCCCTCCCCCCCGGCTGTGGCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAG
CAGCCTCCTCGTCGTCCGCCTCGTCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCG
ACGCGGCGCTGCAGGTCTCGGCCGCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCG
GAGAGGATGAGCAATTCTTAGGTTTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTC
GAAAACCTCGTGGGAGACCTAGAAGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAG
AGACCAAATCTGGAGATAAGATCAAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAA
TCAAAATAACACATGGAAAGGACATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTA
CGTTTCAGCAAGCCACAAAGATTAAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAG
GAAGGAAGGGGGTACAAATTGTACGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTG
AACTGGAAAAGCCCCAGAAAGTCCGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTC
GAAGGATTAAGCCAGTTAGGATTATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGG
CTCAAAAGAAAATTGAAAAAGAAGCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTG
TTGTCAGTGCTATCTCCTCGCGGATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGAT
TAGAGTCTACACCGAATAGTAGATTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGT
CTTCAGACTCCTCTCGATCTAGTAGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGC
GGAGCGATACCCCTGAAGTTCATCCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAG
TGTCGGAGAGAAGTTTTGGATCTAGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTC
CACCTCTGCTGACTCCACCGCCACCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAG
CATCACCATTTTTGCCTGCTTCCACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAA
AGCATTCTAGGTCAGAGCCACAATACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGAC
CCCCTCCACTAACTCCCGAGGACGTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCC
ATTCTGGAACAAGGTTTGATATGCACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTG
AGTCTGTAACCTTGCCTAGTAATCGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTC
CTATTCGATCTGAACCAAGATCTCCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCC
CGTCTTCTGTCTCTTCCTCGTTAAGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCC
TGACTCAGTCTGGGGAATCTGCAGAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTA
CTCCTCTCTTCCCTTGGTTTACCCCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAG
ATGCTGACAAGAGCGTGGAGAAGGACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAA
GGAAAAAGGGATCAGAAATTCAGAGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCA
CTTCATCTTCTGCCAAAAAAGCAACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATA
CAACAGCTGTCAAAACCAAAATACTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCC
TGGAGAAGGAGAAAACCCTCTGCCTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGG
CAGACAAGCTTCCAATGACTGACAAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTC
TTAAACAAACCGACCAGCCCAAAGCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCA
GAAGAGCAGCTGTTGCCCTTGGCCGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAA
AGATTTTGTCTTCCATGGGGAATGATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTA
AACCTGTCACTAGAAACAAGGCACCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGG
TGCCTGAGGACTGTGGTGTTTGTACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAA
AATGTCAGAATCTACAATGGATGCCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCA
GTGAAAAGAAAGACAGCAAAGAGAGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTG
CCCCAAAGAAAAGCAGTAGTGAGCCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAAT
CCAAACAGGCCACCACTCCAGCTTCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAG
GACCGCCAAGAAAAGAAGTTCCCAAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCA
AACAGAAAAAAGTGGCTCCCCGCCCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGA
ATGCAGGCACTTTGAACATCCTCAGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAG
TGGACTTTAAGGAGGATTGTGAAGCAGAAAATGTGTGGGAGATGGGAGGCTTAGGAATCTTGACTTCTGTTCCTATAACACCCAGGGTGG
TTTGCTTTCTCTGTGCCAGTAGTGGGCATGTAGAGACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAG
ATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAG
AGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAG
CAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATT
TCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGT
CTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTG
AAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAA
AGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCT
CAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCA
GGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAA
CAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTG
GCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAG
CTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATG
GCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACC
TAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACA
GCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAAC
AGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACT
TGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATC
AAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTG
ATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTG
GGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGC
CTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAG
GAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACAC
ATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGT
TTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCA
TGGAGATAATGCAAGTCAGAAAGTAGCAAGACTTAGTGATAAAACTGGGCCTGTAGCTCAAGAGAAAAGTTGACACCTGAGAAACATCTA
GAAATTGCCTATCCTGCTGTTCTAGCACTTCATCTGGCTGCCTTTGCAGTCCTTTTACTACAGCTATGAAGAAACGCAACAAGAAACTCA
ATGCACAACAAAGGATTAATTGCTGCAAGGACATTCTTGTAAGGCTTTGATTAGTTTTCTTGTTGCTTTGTTGCACTGAAATGGAATTCC
CATGCCCCTACCCCTTACCCCAGTTTTTTGAACATGGAAAGAAAATTTAATAACTTTTTAAAGTGACATAATTTACATGCAATATGTTTA
TCAACTCAAGAATTTAATATAGTTGGTACACAACTAGTTTTGTTTATAAATTGGAGATGCAAATAGCAAAACTAAATACTTGCTCCATTT
ACAAACTACTTGATTTTATTGTACAAGTTGAAATATGCTCTTTTGTTTGGGTTACAGTATGCTTGCTCTAAGTCAAATTCCAAGGAACTA
ATTTCTTCTCCTGGAGTTGCATTGATTCAGTATTACAAATATATAGCACATCACCTGGGACTTGGCAATCTTTGTTAAAAAAAAATTTCC
TTTCTAATGGGATTTGGCCAATTTTGGTAATGAAGTTAGGATGGTAATGTCTGCATCTGCTAAAGGTAATTTTCTTTTGAGAATTGCTTT
CTTTAGTGTTAAGACCTACTCATATTTTGAAGAAATCTTGAGTTAAGTGAGTTCTGAGGCTGCTGGGGGAACCAGATCAATTCAAAGCTA
AATACTTCTTTCAGAAAGGGGCCACTGTGGAAAGTGCTGGTGGGGTTTGCCCTTGATCAAGTGCCTCCATTGTGCTGCAAGGGCTGTAGA
CAGCAGGGTGGGACAGTCAGTCCTCCGAGCAGCAGGAATCATCCCGTCACCTGCAGCCTTCCCATGCTTCCGCCTTTATTCAGAACTTTC
TGTGCCACTGTAGATAGCTCAGGCAAAACTATTACCTGGGTATTTATCCACTAATGAGTCACAAGAAAAGGAGTGGATTTGGTAAGAATA
GAGATTTGTTTTATTTAAACCACTTCCCATTACTGACCATTAAAAGCTCACCACTAGAGTTCCTGAAACAGGTGAAACCTGTATGACAGC
CCTTCCACTTTGGGGAGCCACGCTTTTGATGTGACAGTACCGCAGAGTGATTCCCCCACTGAGGATGTCATCATCAAACTCTTCTTTGGT
GTGTGAATTATTAGTGGAAAAGACCCAGCTGTAATTAGACCTCCACTGTGTACTTAGCTGGAAGAACATGTTAATTCTGCAATATGTTTC
TTGGTTAAACATTGCACAGTTCTTACCTCATTTCTGTAAATAAAGTTTTGTGAATCTGTTTTGTATTGTGACAAATTCATAAGATAACAT
TGATATTTTGATTTGTAATATTTCTAATTGGTAGATTTAATTGAAAAGTAAAATTAATTTATTTTTATATGTTCAGGGGAATTTTAAAGT
CAAATCTTTTGTAGATAATTTAAAAAATCAGTGTGGTTTATTTTACTTATTTAACCCACTGGTTGTTATTCTGTAACAGTTTGTATAAAT
GGTAAATTTTGAATGTGTTGTTATTTTACCTAGATGTAAAATTCCACATGTATTAAAATGTACAAAATGTTTTGTTAATAAAATTTAATA

>In-frame_KMT2A_ENST00000534358_chr11_118355690_+_MLLT10_ENST00000377072_chr10_21959376_+_8338nt
CTGCTTCACTTCACGGGGCGAACATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGG
GGCGCCGGGGCCTAGGGGGCGCCCCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGG
CGCCCCCCTCCCCCCCGGCTGTGGCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAG
CAGCCTCCTCGTCGTCCGCCTCGTCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCG
ACGCGGCGCTGCAGGTCTCGGCCGCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCG
GAGAGGATGAGCAATTCTTAGGTTTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTC
GAAAACCTCGTGGGAGACCTAGAAGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAG
AGACCAAATCTGGAGATAAGATCAAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAA
TCAAAATAACACATGGAAAGGACATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTA
CGTTTCAGCAAGCCACAAAGATTAAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAG
GAAGGAAGGGGGTACAAATTGTACGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTG
AACTGGAAAAGCCCCAGAAAGTCCGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTC
GAAGGATTAAGCCAGTTAGGATTATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGG
CTCAAAAGAAAATTGAAAAAGAAGCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTG
TTGTCAGTGCTATCTCCTCGCGGATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGAT
TAGAGTCTACACCGAATAGTAGATTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGT
CTTCAGACTCCTCTCGATCTAGTAGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGC
GGAGCGATACCCCTGAAGTTCATCCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAG
TGTCGGAGAGAAGTTTTGGATCTAGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTC
CACCTCTGCTGACTCCACCGCCACCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAG
CATCACCATTTTTGCCTGCTTCCACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAA
AGCATTCTAGGTCAGAGCCACAATACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGAC
CCCCTCCACTAACTCCCGAGGACGTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCC
ATTCTGGAACAAGGTTTGATATGCACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTG
AGTCTGTAACCTTGCCTAGTAATCGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTC
CTATTCGATCTGAACCAAGATCTCCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCC
CGTCTTCTGTCTCTTCCTCGTTAAGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCC
TGACTCAGTCTGGGGAATCTGCAGAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTA
CTCCTCTCTTCCCTTGGTTTACCCCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAG
ATGCTGACAAGAGCGTGGAGAAGGACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAA
GGAAAAAGGGATCAGAAATTCAGAGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCA
CTTCATCTTCTGCCAAAAAAGCAACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATA
CAACAGCTGTCAAAACCAAAATACTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCC
TGGAGAAGGAGAAAACCCTCTGCCTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGG
CAGACAAGCTTCCAATGACTGACAAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTC
TTAAACAAACCGACCAGCCCAAAGCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCA
GAAGAGCAGCTGTTGCCCTTGGCCGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAA
AGATTTTGTCTTCCATGGGGAATGATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTA
AACCTGTCACTAGAAACAAGGCACCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGG
TGCCTGAGGACTGTGGTGTTTGTACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAA
AATGTCAGAATCTACAATGGATGCCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCA
GTGAAAAGAAAGACAGCAAAGAGAGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTG
CCCCAAAGAAAAGCAGTAGTGAGCCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAAT
CCAAACAGGCCACCACTCCAGCTTCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAG
GACCGCCAAGAAAAGAAGTTCCCAAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCA
AACAGAAAAAAGTGGCTCCCCGCCCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGA
ATGCAGGCACTTTGAACATCCTCAGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAG
TGGACTTTAAGGAGGATTGTGAAGCAGAAAATGTGTGGGAGATGGGAGGCTTAGGAATCTTGACTTCTGTTCCTATAACACCCAGGGTGG
TTTGCTTTCTCTGTGCCAGTAGTGGGCATGTAGAGACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAG
ATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAG
AGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAG
CAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATT
TCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGT
CTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTG
AAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAA
AGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCT
CAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCA
GGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAA
CAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGACAGAGGTGACAGTTCTACACTAACAAAGCAAGAACTTAAATTCATAGGTA
TTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTC
AGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAA
ATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGT
CTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCAC
GATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAAC
AGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTAC
ACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGC
TTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATT
CCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTG
GACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTC
AGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAA
TAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCC
AGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAG
GATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTACACA
GGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCATGGAGATAATGCAAGTCAGAAAGTAGCAAGACTTAGTGATAA
AACTGGGCCTGTAGCTCAAGAGAAAAGTTGACACCTGAGAAACATCTAGAAATTGCCTATCCTGCTGTTCTAGCACTTCATCTGGCTGCC
TTTGCAGTCCTTTTACTACAGCTATGAAGAAACGCAACAAGAAACTCAATGCACAACAAAGGATTAATTGCTGCAAGGACATTCTTGTAA
GGCTTTGATTAGTTTTCTTGTTGCTTTGTTGCACTGAAATGGAATTCCCATGCCCCTACCCCTTACCCCAGTTTTTTGAACATGGAAAGA
AAATTTAATAACTTTTTAAAGTGACATAATTTACATGCAATATGTTTATCAACTCAAGAATTTAATATAGTTGGTACACAACTAGTTTTG
TTTATAAATTGGAGATGCAAATAGCAAAACTAAATACTTGCTCCATTTACAAACTACTTGATTTTATTGTACAAGTTGAAATATGCTCTT
TTGTTTGGGTTACAGTATGCTTGCTCTAAGTCAAATTCCAAGGAACTAATTTCTTCTCCTGGAGTTGCATTGATTCAGTATTACAAATAT
ATAGCACATCACCTGGGACTTGGCAATCTTTGTTAAAAAAAAATTTCCTTTCTAATGGGATTTGGCCAATTTTGGTAATGAAGTTAGGAT
GGTAATGTCTGCATCTGCTAAAGGTAATTTTCTTTTGAGAATTGCTTTCTTTAGTGTTAAGACCTACTCATATTTTGAAGAAATCTTGAG
TTAAGTGAGTTCTGAGGCTGCTGGGGGAACCAGATCAATTCAAAGCTAAATACTTCTTTCAGAAAGGGGCCACTGTGGAAAGTGCTGGTG
GGGTTTGCCCTTGATCAAGTGCCTCCATTGTGCTGCAAGGGCTGTAGACAGCAGGGTGGGACAGTCAGTCCTCCGAGCAGCAGGAATCAT
CCCGTCACCTGCAGCCTTCCCATGCTTCCGCCTTTATTCAGAACTTTCTGTGCCACTGTAGATAGCTCAGGCAAAACTATTACCTGGGTA
TTTATCCACTAATGAGTCACAAGAAAAGGAGTGGATTTGGTAAGAATAGAGATTTGTTTTATTTAAACCACTTCCCATTACTGACCATTA
AAAGCTCACCACTAGAGTTCCTGAAACAGGTGAAACCTGTATGACAGCCCTTCCACTTTGGGGAGCCACGCTTTTGATGTGACAGTACCG
CAGAGTGATTCCCCCACTGAGGATGTCATCATCAAACTCTTCTTTGGTGTGTGAATTATTAGTGGAAAAGACCCAGCTGTAATTAGACCT
CCACTGTGTACTTAGCTGGAAGAACATGTTAATTCTGCAATATGTTTCTTGGTTAAACATTGCACAGTTCTTACCTCATTTCTGTAAATA
AAGTTTTGTGAATCTGTTTTGTATTGTGACAAATTCATAAGATAACATTGATATTTTGATTTGTAATATTTCTAATTGGTAGATTTAATT
GAAAAGTAAAATTAATTTATTTTTATATGTTCAGGGGAATTTTAAAGTCAAATCTTTTGTAGATAATTTAAAAAATCAGTGTGGTTTATT
TTACTTATTTAACCCACTGGTTGTTATTCTGTAACAGTTTGTATAAATGGTAAATTTTGAATGTGTTGTTATTTTACCTAGATGTAAAAT

>In-frame_KMT2A_ENST00000534358_chr11_118355690_+_MLLT10_ENST00000307729_chr10_21959376_+_8414nt
CTGCTTCACTTCACGGGGCGAACATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGG
GGCGCCGGGGCCTAGGGGGCGCCCCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGG
CGCCCCCCTCCCCCCCGGCTGTGGCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAG
CAGCCTCCTCGTCGTCCGCCTCGTCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCG
ACGCGGCGCTGCAGGTCTCGGCCGCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCG
GAGAGGATGAGCAATTCTTAGGTTTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTC
GAAAACCTCGTGGGAGACCTAGAAGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAG
AGACCAAATCTGGAGATAAGATCAAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAA
TCAAAATAACACATGGAAAGGACATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTA
CGTTTCAGCAAGCCACAAAGATTAAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAG
GAAGGAAGGGGGTACAAATTGTACGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTG
AACTGGAAAAGCCCCAGAAAGTCCGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTC
GAAGGATTAAGCCAGTTAGGATTATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGG
CTCAAAAGAAAATTGAAAAAGAAGCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTG
TTGTCAGTGCTATCTCCTCGCGGATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGAT
TAGAGTCTACACCGAATAGTAGATTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGT
CTTCAGACTCCTCTCGATCTAGTAGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGC
GGAGCGATACCCCTGAAGTTCATCCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAG
TGTCGGAGAGAAGTTTTGGATCTAGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTC
CACCTCTGCTGACTCCACCGCCACCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAG
CATCACCATTTTTGCCTGCTTCCACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAA
AGCATTCTAGGTCAGAGCCACAATACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGAC
CCCCTCCACTAACTCCCGAGGACGTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCC
ATTCTGGAACAAGGTTTGATATGCACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTG
AGTCTGTAACCTTGCCTAGTAATCGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTC
CTATTCGATCTGAACCAAGATCTCCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCC
CGTCTTCTGTCTCTTCCTCGTTAAGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCC
TGACTCAGTCTGGGGAATCTGCAGAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTA
CTCCTCTCTTCCCTTGGTTTACCCCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAG
ATGCTGACAAGAGCGTGGAGAAGGACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAA
GGAAAAAGGGATCAGAAATTCAGAGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCA
CTTCATCTTCTGCCAAAAAAGCAACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATA
CAACAGCTGTCAAAACCAAAATACTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCC
TGGAGAAGGAGAAAACCCTCTGCCTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGG
CAGACAAGCTTCCAATGACTGACAAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTC
TTAAACAAACCGACCAGCCCAAAGCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCA
GAAGAGCAGCTGTTGCCCTTGGCCGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAA
AGATTTTGTCTTCCATGGGGAATGATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTA
AACCTGTCACTAGAAACAAGGCACCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGG
TGCCTGAGGACTGTGGTGTTTGTACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAA
AATGTCAGAATCTACAATGGATGCCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCA
GTGAAAAGAAAGACAGCAAAGAGAGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTG
CCCCAAAGAAAAGCAGTAGTGAGCCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAAT
CCAAACAGGCCACCACTCCAGCTTCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAG
GACCGCCAAGAAAAGAAGTTCCCAAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCA
AACAGAAAAAAGTGGCTCCCCGCCCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGA
ATGCAGGCACTTTGAACATCCTCAGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAG
TGGACTTTAAGGAGGATTGTGAAGCAGAAAATGTGTGGGAGATGGGAGGCTTAGGAATCTTGACTTCTGTTCCTATAACACCCAGGGTGG
TTTGCTTTCTCTGTGCCAGTAGTGGGCATGTAGAGACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAG
ATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAG
AGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAG
CAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATT
TCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGT
CTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTG
AAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAA
AGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCT
CAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCA
GGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAA
CAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTG
GCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAG
CTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATG
GCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACC
TAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACA
GCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAAC
AGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACT
TGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATC
AAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTG
ATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTG
GGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGC
CTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAG
GAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACAC
ATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGT
TTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGAACAACATCAAGCCTTTTTGTATCAGTTAATGCAACATCACCACCAGCAGCACC
ACCAACCTGAACTTCAGCAGCTGCAGATCCCTGGACCAACACAAATACCCATAAACAACCTTCTTGCAGGTACACAGGCACCCCCACTTC
ACACAGCTACCACCAACCCATTTCTCACCATCCATGGAGATAATGCAAGTCAGAAAGTAGCAAGACTTAGTGATAAAACTGGGCCTGTAG
CTCAAGAGAAAAGTTGACACCTGAGAAACATCTAGAAATTGCCTATCCTGCTGTTCTAGCACTTCATCTGGCTGCCTTTGCAGTCCTTTT
ACTACAGCTATGAAGAAACGCAACAAGAAACTCAATGCACAACAAAGGATTAATTGCTGCAAGGACATTCTTGTAAGGCTTTGATTAGTT
TTCTTGTTGCTTTGTTGCACTGAAATGGAATTCCCATGCCCCTACCCCTTACCCCAGTTTTTTGAACATGGAAAGAAAATTTAATAACTT
TTTAAAGTGACATAATTTACATGCAATATGTTTATCAACTCAAGAATTTAATATAGTTGGTACACAACTAGTTTTGTTTATAAATTGGAG
ATGCAAATAGCAAAACTAAATACTTGCTCCATTTACAAACTACTTGATTTTATTGTACAAGTTGAAATATGCTCTTTTGTTTGGGTTACA
GTATGCTTGCTCTAAGTCAAATTCCAAGGAACTAATTTCTTCTCCTGGAGTTGCATTGATTCAGTATTACAAATATATAGCACATCACCT
GGGACTTGGCAATCTTTGTTAAAAAAAAATTTCCTTTCTAATGGGATTTGGCCAATTTTGGTAATGAAGTTAGGATGGTAATGTCTGCAT
CTGCTAAAGGTAATTTTCTTTTGAGAATTGCTTTCTTTAGTGTTAAGACCTACTCATATTTTGAAGAAATCTTGAGTTAAGTGAGTTCTG
AGGCTGCTGGGGGAACCAGATCAATTCAAAGCTAAATACTTCTTTCAGAAAGGGGCCACTGTGGAAAGTGCTGGTGGGGTTTGCCCTTGA
TCAAGTGCCTCCATTGTGCTGCAAGGGCTGTAGACAGCAGGGTGGGACAGTCAGTCCTCCGAGCAGCAGGAATCATCCCGTCACCTGCAG
CCTTCCCATGCTTCCGCCTTTATTCAGAACTTTCTGTGCCACTGTAGATAGCTCAGGCAAAACTATTACCTGGGTATTTATCCACTAATG
AGTCACAAGAAAAGGAGTGGATTTGGTAAGAATAGAGATTTGTTTTATTTAAACCACTTCCCATTACTGACCATTAAAAGCTCACCACTA
GAGTTCCTGAAACAGGTGAAACCTGTATGACAGCCCTTCCACTTTGGGGAGCCACGCTTTTGATGTGACAGTACCGCAGAGTGATTCCCC
CACTGAGGATGTCATCATCAAACTCTTCTTTGGTGTGTGAATTATTAGTGGAAAAGACCCAGCTGTAATTAGACCTCCACTGTGTACTTA
GCTGGAAGAACATGTTAATTCTGCAATATGTTTCTTGGTTAAACATTGCACAGTTCTTACCTCATTTCTGTAAATAAAGTTTTGTGAATC
TGTTTTGTATTGTGACAAATTCATAAGATAACATTGATATTTTGATTTGTAATATTTCTAATTGGTAGATTTAATTGAAAAGTAAAATTA
ATTTATTTTTATATGTTCAGGGGAATTTTAAAGTCAAATCTTTTGTAGATAATTTAAAAAATCAGTGTGGTTTATTTTACTTATTTAACC
CACTGGTTGTTATTCTGTAACAGTTTGTATAAATGGTAAATTTTGAATGTGTTGTTATTTTACCTAGATGTAAAATTCCACATGTATTAA

>In-frame_KMT2A_ENST00000534358_chr11_118355690_+_MLLT10_ENST00000377059_chr10_21959376_+_8285nt
CTGCTTCACTTCACGGGGCGAACATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGG
GGCGCCGGGGCCTAGGGGGCGCCCCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGG
CGCCCCCCTCCCCCCCGGCTGTGGCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAG
CAGCCTCCTCGTCGTCCGCCTCGTCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCG
ACGCGGCGCTGCAGGTCTCGGCCGCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCG
GAGAGGATGAGCAATTCTTAGGTTTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTC
GAAAACCTCGTGGGAGACCTAGAAGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAG
AGACCAAATCTGGAGATAAGATCAAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAA
TCAAAATAACACATGGAAAGGACATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTA
CGTTTCAGCAAGCCACAAAGATTAAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAG
GAAGGAAGGGGGTACAAATTGTACGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTG
AACTGGAAAAGCCCCAGAAAGTCCGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTC
GAAGGATTAAGCCAGTTAGGATTATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGG
CTCAAAAGAAAATTGAAAAAGAAGCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTG
TTGTCAGTGCTATCTCCTCGCGGATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGAT
TAGAGTCTACACCGAATAGTAGATTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGT
CTTCAGACTCCTCTCGATCTAGTAGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGC
GGAGCGATACCCCTGAAGTTCATCCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAG
TGTCGGAGAGAAGTTTTGGATCTAGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTC
CACCTCTGCTGACTCCACCGCCACCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAG
CATCACCATTTTTGCCTGCTTCCACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAA
AGCATTCTAGGTCAGAGCCACAATACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGAC
CCCCTCCACTAACTCCCGAGGACGTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCC
ATTCTGGAACAAGGTTTGATATGCACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTG
AGTCTGTAACCTTGCCTAGTAATCGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTC
CTATTCGATCTGAACCAAGATCTCCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCC
CGTCTTCTGTCTCTTCCTCGTTAAGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCC
TGACTCAGTCTGGGGAATCTGCAGAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTA
CTCCTCTCTTCCCTTGGTTTACCCCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAG
ATGCTGACAAGAGCGTGGAGAAGGACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAA
GGAAAAAGGGATCAGAAATTCAGAGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCA
CTTCATCTTCTGCCAAAAAAGCAACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATA
CAACAGCTGTCAAAACCAAAATACTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCC
TGGAGAAGGAGAAAACCCTCTGCCTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGG
CAGACAAGCTTCCAATGACTGACAAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTC
TTAAACAAACCGACCAGCCCAAAGCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCA
GAAGAGCAGCTGTTGCCCTTGGCCGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAA
AGATTTTGTCTTCCATGGGGAATGATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTA
AACCTGTCACTAGAAACAAGGCACCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGG
TGCCTGAGGACTGTGGTGTTTGTACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAA
AATGTCAGAATCTACAATGGATGCCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCA
GTGAAAAGAAAGACAGCAAAGAGAGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTG
CCCCAAAGAAAAGCAGTAGTGAGCCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAAT
CCAAACAGGCCACCACTCCAGCTTCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAG
GACCGCCAAGAAAAGAAGTTCCCAAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCA
AACAGAAAAAAGTGGCTCCCCGCCCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGA
ATGCAGGCACTTTGAACATCCTCAGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAG
TGGACTTTAAGGAGGATTGTGAAGCAGAAAATGTGTGGGAGATGGGAGGCTTAGGAATCTTGACTTCTGTTCCTATAACACCCAGGGTGG
TTTGCTTTCTCTGTGCCAGTAGTGGGCATGTAGAGACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAG
ATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAG
AGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAG
CAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATT
TCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGT
CTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTG
AAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAA
AGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCT
CAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCA
GGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAA
CAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTG
GCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAG
CTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATG
GCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACC
TAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACA
GCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAAC
AGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACT
TGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATC
AAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTG
ATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTG
GGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGC
CTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAG
GAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACAC
ATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGT
TTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCA
TGGAGATAATGCAAGTCAGAAAGTAGCAAGACTTAGTGATAAAACTGGGCCTGTAGCTCAAGAGAAAAGTTGACACCTGAGAAACATCTA
GAAATTGCCTATCCTGCTGTTCTAGCACTTCATCTGGCTGCCTTTGCAGTCCTTTTACTACAGCTATGAAGAAACGCAACAAGAAACTCA
ATGCACAACAAAGGATTAATTGCTGCAAGGACATTCTTGTAAGGCTTTGATTAGTTTTCTTGTTGCTTTGTTGCACTGAAATGGAATTCC
CATGCCCCTACCCCTTACCCCAGTTTTTTGAACATGGAAAGAAAATTTAATAACTTTTTAAAGTGACATAATTTACATGCAATATGTTTA
TCAACTCAAGAATTTAATATAGTTGGTACACAACTAGTTTTGTTTATAAATTGGAGATGCAAATAGCAAAACTAAATACTTGCTCCATTT
ACAAACTACTTGATTTTATTGTACAAGTTGAAATATGCTCTTTTGTTTGGGTTACAGTATGCTTGCTCTAAGTCAAATTCCAAGGAACTA
ATTTCTTCTCCTGGAGTTGCATTGATTCAGTATTACAAATATATAGCACATCACCTGGGACTTGGCAATCTTTGTTAAAAAAAAATTTCC
TTTCTAATGGGATTTGGCCAATTTTGGTAATGAAGTTAGGATGGTAATGTCTGCATCTGCTAAAGGTAATTTTCTTTTGAGAATTGCTTT
CTTTAGTGTTAAGACCTACTCATATTTTGAAGAAATCTTGAGTTAAGTGAGTTCTGAGGCTGCTGGGGGAACCAGATCAATTCAAAGCTA
AATACTTCTTTCAGAAAGGGGCCACTGTGGAAAGTGCTGGTGGGGTTTGCCCTTGATCAAGTGCCTCCATTGTGCTGCAAGGGCTGTAGA
CAGCAGGGTGGGACAGTCAGTCCTCCGAGCAGCAGGAATCATCCCGTCACCTGCAGCCTTCCCATGCTTCCGCCTTTATTCAGAACTTTC
TGTGCCACTGTAGATAGCTCAGGCAAAACTATTACCTGGGTATTTATCCACTAATGAGTCACAAGAAAAGGAGTGGATTTGGTAAGAATA
GAGATTTGTTTTATTTAAACCACTTCCCATTACTGACCATTAAAAGCTCACCACTAGAGTTCCTGAAACAGGTGAAACCTGTATGACAGC
CCTTCCACTTTGGGGAGCCACGCTTTTGATGTGACAGTACCGCAGAGTGATTCCCCCACTGAGGATGTCATCATCAAACTCTTCTTTGGT
GTGTGAATTATTAGTGGAAAAGACCCAGCTGTAATTAGACCTCCACTGTGTACTTAGCTGGAAGAACATGTTAATTCTGCAATATGTTTC
TTGGTTAAACATTGCACAGTTCTTACCTCATTTCTGTAAATAAAGTTTTGTGAATCTGTTTTGTATTGTGACAAATTCATAAGATAACAT
TGATATTTTGATTTGTAATATTTCTAATTGGTAGATTTAATTGAAAAGTAAAATTAATTTATTTTTATATGTTCAGGGGAATTTTAAAGT
CAAATCTTTTGTAGATAATTTAAAAAATCAGTGTGGTTTATTTTACTTATTTAACCCACTGGTTGTTATTCTGTAACAGTTTGTATAAAT
GGTAAATTTTGAATGTGTTGTTATTTTACCTAGATGTAAAATTCCACATGTATTAAAATGTACAAAATGTTTTGTTAATAAAATTTAATA

>In-frame_KMT2A_ENST00000389506_chr11_118355690_+_MLLT10_ENST00000446906_chr10_21959376_+_8262nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGGAGGATTGTGAA
GCAGAAAATGTGTGGGAGATGGGAGGCTTAGGAATCTTGACTTCTGTTCCTATAACACCCAGGGTGGTTTGCTTTCTCTGTGCCAGTAGT
GGGCATGTAGAGACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAAT
GCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCA
GCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGC
AGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGAT
CTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTA
AATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGT
AATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAAT
AAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACA
TCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTC
AGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTG
AATGCAATACACAACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTC
TCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCT
GTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATG
GCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCC
CGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCA
GTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTA
GGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTT
CAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAG
ACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAAT
CAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGC
TCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCC
GTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAG
ACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACT
AACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAA
CAGCTCACACCAGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCATGGAGATAATGCAAGTCAGAAAG
TAGCAAGACTTAGTGATAAAACTGGGCCTGTAGCTCAAGAGAAAAGTTGACACCTGAGAAACATCTAGAAATTGCCTATCCTGCTGTTCT
AGCACTTCATCTGGCTGCCTTTGCAGTCCTTTTACTACAGCTATGAAGAAACGCAACAAGAAACTCAATGCACAACAAAGGATTAATTGC
TGCAAGGACATTCTTGTAAGGCTTTGATTAGTTTTCTTGTTGCTTTGTTGCACTGAAATGGAATTCCCATGCCCCTACCCCTTACCCCAG
TTTTTTGAACATGGAAAGAAAATTTAATAACTTTTTAAAGTGACATAATTTACATGCAATATGTTTATCAACTCAAGAATTTAATATAGT
TGGTACACAACTAGTTTTGTTTATAAATTGGAGATGCAAATAGCAAAACTAAATACTTGCTCCATTTACAAACTACTTGATTTTATTGTA
CAAGTTGAAATATGCTCTTTTGTTTGGGTTACAGTATGCTTGCTCTAAGTCAAATTCCAAGGAACTAATTTCTTCTCCTGGAGTTGCATT
GATTCAGTATTACAAATATATAGCACATCACCTGGGACTTGGCAATCTTTGTTAAAAAAAAATTTCCTTTCTAATGGGATTTGGCCAATT
TTGGTAATGAAGTTAGGATGGTAATGTCTGCATCTGCTAAAGGTAATTTTCTTTTGAGAATTGCTTTCTTTAGTGTTAAGACCTACTCAT
ATTTTGAAGAAATCTTGAGTTAAGTGAGTTCTGAGGCTGCTGGGGGAACCAGATCAATTCAAAGCTAAATACTTCTTTCAGAAAGGGGCC
ACTGTGGAAAGTGCTGGTGGGGTTTGCCCTTGATCAAGTGCCTCCATTGTGCTGCAAGGGCTGTAGACAGCAGGGTGGGACAGTCAGTCC
TCCGAGCAGCAGGAATCATCCCGTCACCTGCAGCCTTCCCATGCTTCCGCCTTTATTCAGAACTTTCTGTGCCACTGTAGATAGCTCAGG
CAAAACTATTACCTGGGTATTTATCCACTAATGAGTCACAAGAAAAGGAGTGGATTTGGTAAGAATAGAGATTTGTTTTATTTAAACCAC
TTCCCATTACTGACCATTAAAAGCTCACCACTAGAGTTCCTGAAACAGGTGAAACCTGTATGACAGCCCTTCCACTTTGGGGAGCCACGC
TTTTGATGTGACAGTACCGCAGAGTGATTCCCCCACTGAGGATGTCATCATCAAACTCTTCTTTGGTGTGTGAATTATTAGTGGAAAAGA
CCCAGCTGTAATTAGACCTCCACTGTGTACTTAGCTGGAAGAACATGTTAATTCTGCAATATGTTTCTTGGTTAAACATTGCACAGTTCT
TACCTCATTTCTGTAAATAAAGTTTTGTGAATCTGTTTTGTATTGTGACAAATTCATAAGATAACATTGATATTTTGATTTGTAATATTT
CTAATTGGTAGATTTAATTGAAAAGTAAAATTAATTTATTTTTATATGTTCAGGGGAATTTTAAAGTCAAATCTTTTGTAGATAATTTAA
AAAATCAGTGTGGTTTATTTTACTTATTTAACCCACTGGTTGTTATTCTGTAACAGTTTGTATAAATGGTAAATTTTGAATGTGTTGTTA

>In-frame_KMT2A_ENST00000389506_chr11_118355690_+_MLLT10_ENST00000377072_chr10_21959376_+_8315nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGGAGGATTGTGAA
GCAGAAAATGTGTGGGAGATGGGAGGCTTAGGAATCTTGACTTCTGTTCCTATAACACCCAGGGTGGTTTGCTTTCTCTGTGCCAGTAGT
GGGCATGTAGAGACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAAT
GCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCA
GCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGC
AGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGAT
CTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTA
AATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGT
AATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAAT
AAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACA
TCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTC
AGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTG
AATGCAATACACAACGACAGAGGTGACAGTTCTACACTAACAAAGCAAGAACTTAAATTCATAGGTATTTATAACAGCAATGATGTAGCA
GTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAA
CAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTC
AGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAA
GATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAG
ATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGT
GAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGA
AGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATA
ACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCT
CATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCA
GCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTG
GGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAAC
CAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCAC
ACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGA
CAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTACACAGGCACCCCCACTTCACACAGCTA
CCACCAACCCATTTCTCACCATCCATGGAGATAATGCAAGTCAGAAAGTAGCAAGACTTAGTGATAAAACTGGGCCTGTAGCTCAAGAGA
AAAGTTGACACCTGAGAAACATCTAGAAATTGCCTATCCTGCTGTTCTAGCACTTCATCTGGCTGCCTTTGCAGTCCTTTTACTACAGCT
ATGAAGAAACGCAACAAGAAACTCAATGCACAACAAAGGATTAATTGCTGCAAGGACATTCTTGTAAGGCTTTGATTAGTTTTCTTGTTG
CTTTGTTGCACTGAAATGGAATTCCCATGCCCCTACCCCTTACCCCAGTTTTTTGAACATGGAAAGAAAATTTAATAACTTTTTAAAGTG
ACATAATTTACATGCAATATGTTTATCAACTCAAGAATTTAATATAGTTGGTACACAACTAGTTTTGTTTATAAATTGGAGATGCAAATA
GCAAAACTAAATACTTGCTCCATTTACAAACTACTTGATTTTATTGTACAAGTTGAAATATGCTCTTTTGTTTGGGTTACAGTATGCTTG
CTCTAAGTCAAATTCCAAGGAACTAATTTCTTCTCCTGGAGTTGCATTGATTCAGTATTACAAATATATAGCACATCACCTGGGACTTGG
CAATCTTTGTTAAAAAAAAATTTCCTTTCTAATGGGATTTGGCCAATTTTGGTAATGAAGTTAGGATGGTAATGTCTGCATCTGCTAAAG
GTAATTTTCTTTTGAGAATTGCTTTCTTTAGTGTTAAGACCTACTCATATTTTGAAGAAATCTTGAGTTAAGTGAGTTCTGAGGCTGCTG
GGGGAACCAGATCAATTCAAAGCTAAATACTTCTTTCAGAAAGGGGCCACTGTGGAAAGTGCTGGTGGGGTTTGCCCTTGATCAAGTGCC
TCCATTGTGCTGCAAGGGCTGTAGACAGCAGGGTGGGACAGTCAGTCCTCCGAGCAGCAGGAATCATCCCGTCACCTGCAGCCTTCCCAT
GCTTCCGCCTTTATTCAGAACTTTCTGTGCCACTGTAGATAGCTCAGGCAAAACTATTACCTGGGTATTTATCCACTAATGAGTCACAAG
AAAAGGAGTGGATTTGGTAAGAATAGAGATTTGTTTTATTTAAACCACTTCCCATTACTGACCATTAAAAGCTCACCACTAGAGTTCCTG
AAACAGGTGAAACCTGTATGACAGCCCTTCCACTTTGGGGAGCCACGCTTTTGATGTGACAGTACCGCAGAGTGATTCCCCCACTGAGGA
TGTCATCATCAAACTCTTCTTTGGTGTGTGAATTATTAGTGGAAAAGACCCAGCTGTAATTAGACCTCCACTGTGTACTTAGCTGGAAGA
ACATGTTAATTCTGCAATATGTTTCTTGGTTAAACATTGCACAGTTCTTACCTCATTTCTGTAAATAAAGTTTTGTGAATCTGTTTTGTA
TTGTGACAAATTCATAAGATAACATTGATATTTTGATTTGTAATATTTCTAATTGGTAGATTTAATTGAAAAGTAAAATTAATTTATTTT
TATATGTTCAGGGGAATTTTAAAGTCAAATCTTTTGTAGATAATTTAAAAAATCAGTGTGGTTTATTTTACTTATTTAACCCACTGGTTG
TTATTCTGTAACAGTTTGTATAAATGGTAAATTTTGAATGTGTTGTTATTTTACCTAGATGTAAAATTCCACATGTATTAAAATGTACAA

>In-frame_KMT2A_ENST00000389506_chr11_118355690_+_MLLT10_ENST00000307729_chr10_21959376_+_8391nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGGAGGATTGTGAA
GCAGAAAATGTGTGGGAGATGGGAGGCTTAGGAATCTTGACTTCTGTTCCTATAACACCCAGGGTGGTTTGCTTTCTCTGTGCCAGTAGT
GGGCATGTAGAGACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAAT
GCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCA
GCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGC
AGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGAT
CTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTA
AATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGT
AATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAAT
AAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACA
TCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTC
AGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTG
AATGCAATACACAACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTC
TCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCT
GTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATG
GCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCC
CGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCA
GTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTA
GGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTT
CAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAG
ACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAAT
CAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGC
TCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCC
GTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAG
ACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACT
AACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAA
CAGCTCACACCAGAACAACATCAAGCCTTTTTGTATCAGTTAATGCAACATCACCACCAGCAGCACCACCAACCTGAACTTCAGCAGCTG
CAGATCCCTGGACCAACACAAATACCCATAAACAACCTTCTTGCAGGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTT
CTCACCATCCATGGAGATAATGCAAGTCAGAAAGTAGCAAGACTTAGTGATAAAACTGGGCCTGTAGCTCAAGAGAAAAGTTGACACCTG
AGAAACATCTAGAAATTGCCTATCCTGCTGTTCTAGCACTTCATCTGGCTGCCTTTGCAGTCCTTTTACTACAGCTATGAAGAAACGCAA
CAAGAAACTCAATGCACAACAAAGGATTAATTGCTGCAAGGACATTCTTGTAAGGCTTTGATTAGTTTTCTTGTTGCTTTGTTGCACTGA
AATGGAATTCCCATGCCCCTACCCCTTACCCCAGTTTTTTGAACATGGAAAGAAAATTTAATAACTTTTTAAAGTGACATAATTTACATG
CAATATGTTTATCAACTCAAGAATTTAATATAGTTGGTACACAACTAGTTTTGTTTATAAATTGGAGATGCAAATAGCAAAACTAAATAC
TTGCTCCATTTACAAACTACTTGATTTTATTGTACAAGTTGAAATATGCTCTTTTGTTTGGGTTACAGTATGCTTGCTCTAAGTCAAATT
CCAAGGAACTAATTTCTTCTCCTGGAGTTGCATTGATTCAGTATTACAAATATATAGCACATCACCTGGGACTTGGCAATCTTTGTTAAA
AAAAAATTTCCTTTCTAATGGGATTTGGCCAATTTTGGTAATGAAGTTAGGATGGTAATGTCTGCATCTGCTAAAGGTAATTTTCTTTTG
AGAATTGCTTTCTTTAGTGTTAAGACCTACTCATATTTTGAAGAAATCTTGAGTTAAGTGAGTTCTGAGGCTGCTGGGGGAACCAGATCA
ATTCAAAGCTAAATACTTCTTTCAGAAAGGGGCCACTGTGGAAAGTGCTGGTGGGGTTTGCCCTTGATCAAGTGCCTCCATTGTGCTGCA
AGGGCTGTAGACAGCAGGGTGGGACAGTCAGTCCTCCGAGCAGCAGGAATCATCCCGTCACCTGCAGCCTTCCCATGCTTCCGCCTTTAT
TCAGAACTTTCTGTGCCACTGTAGATAGCTCAGGCAAAACTATTACCTGGGTATTTATCCACTAATGAGTCACAAGAAAAGGAGTGGATT
TGGTAAGAATAGAGATTTGTTTTATTTAAACCACTTCCCATTACTGACCATTAAAAGCTCACCACTAGAGTTCCTGAAACAGGTGAAACC
TGTATGACAGCCCTTCCACTTTGGGGAGCCACGCTTTTGATGTGACAGTACCGCAGAGTGATTCCCCCACTGAGGATGTCATCATCAAAC
TCTTCTTTGGTGTGTGAATTATTAGTGGAAAAGACCCAGCTGTAATTAGACCTCCACTGTGTACTTAGCTGGAAGAACATGTTAATTCTG
CAATATGTTTCTTGGTTAAACATTGCACAGTTCTTACCTCATTTCTGTAAATAAAGTTTTGTGAATCTGTTTTGTATTGTGACAAATTCA
TAAGATAACATTGATATTTTGATTTGTAATATTTCTAATTGGTAGATTTAATTGAAAAGTAAAATTAATTTATTTTTATATGTTCAGGGG
AATTTTAAAGTCAAATCTTTTGTAGATAATTTAAAAAATCAGTGTGGTTTATTTTACTTATTTAACCCACTGGTTGTTATTCTGTAACAG
TTTGTATAAATGGTAAATTTTGAATGTGTTGTTATTTTACCTAGATGTAAAATTCCACATGTATTAAAATGTACAAAATGTTTTGTTAAT

>In-frame_KMT2A_ENST00000389506_chr11_118355690_+_MLLT10_ENST00000377059_chr10_21959376_+_8262nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGGAGGATTGTGAA
GCAGAAAATGTGTGGGAGATGGGAGGCTTAGGAATCTTGACTTCTGTTCCTATAACACCCAGGGTGGTTTGCTTTCTCTGTGCCAGTAGT
GGGCATGTAGAGACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAAT
GCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCA
GCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGC
AGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGAT
CTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTA
AATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGT
AATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAAT
AAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACA
TCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTC
AGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTG
AATGCAATACACAACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTC
TCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCT
GTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATG
GCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCC
CGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCA
GTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTA
GGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTT
CAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAG
ACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAAT
CAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGC
TCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCC
GTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAG
ACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACT
AACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAA
CAGCTCACACCAGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCATGGAGATAATGCAAGTCAGAAAG
TAGCAAGACTTAGTGATAAAACTGGGCCTGTAGCTCAAGAGAAAAGTTGACACCTGAGAAACATCTAGAAATTGCCTATCCTGCTGTTCT
AGCACTTCATCTGGCTGCCTTTGCAGTCCTTTTACTACAGCTATGAAGAAACGCAACAAGAAACTCAATGCACAACAAAGGATTAATTGC
TGCAAGGACATTCTTGTAAGGCTTTGATTAGTTTTCTTGTTGCTTTGTTGCACTGAAATGGAATTCCCATGCCCCTACCCCTTACCCCAG
TTTTTTGAACATGGAAAGAAAATTTAATAACTTTTTAAAGTGACATAATTTACATGCAATATGTTTATCAACTCAAGAATTTAATATAGT
TGGTACACAACTAGTTTTGTTTATAAATTGGAGATGCAAATAGCAAAACTAAATACTTGCTCCATTTACAAACTACTTGATTTTATTGTA
CAAGTTGAAATATGCTCTTTTGTTTGGGTTACAGTATGCTTGCTCTAAGTCAAATTCCAAGGAACTAATTTCTTCTCCTGGAGTTGCATT
GATTCAGTATTACAAATATATAGCACATCACCTGGGACTTGGCAATCTTTGTTAAAAAAAAATTTCCTTTCTAATGGGATTTGGCCAATT
TTGGTAATGAAGTTAGGATGGTAATGTCTGCATCTGCTAAAGGTAATTTTCTTTTGAGAATTGCTTTCTTTAGTGTTAAGACCTACTCAT
ATTTTGAAGAAATCTTGAGTTAAGTGAGTTCTGAGGCTGCTGGGGGAACCAGATCAATTCAAAGCTAAATACTTCTTTCAGAAAGGGGCC
ACTGTGGAAAGTGCTGGTGGGGTTTGCCCTTGATCAAGTGCCTCCATTGTGCTGCAAGGGCTGTAGACAGCAGGGTGGGACAGTCAGTCC
TCCGAGCAGCAGGAATCATCCCGTCACCTGCAGCCTTCCCATGCTTCCGCCTTTATTCAGAACTTTCTGTGCCACTGTAGATAGCTCAGG
CAAAACTATTACCTGGGTATTTATCCACTAATGAGTCACAAGAAAAGGAGTGGATTTGGTAAGAATAGAGATTTGTTTTATTTAAACCAC
TTCCCATTACTGACCATTAAAAGCTCACCACTAGAGTTCCTGAAACAGGTGAAACCTGTATGACAGCCCTTCCACTTTGGGGAGCCACGC
TTTTGATGTGACAGTACCGCAGAGTGATTCCCCCACTGAGGATGTCATCATCAAACTCTTCTTTGGTGTGTGAATTATTAGTGGAAAAGA
CCCAGCTGTAATTAGACCTCCACTGTGTACTTAGCTGGAAGAACATGTTAATTCTGCAATATGTTTCTTGGTTAAACATTGCACAGTTCT
TACCTCATTTCTGTAAATAAAGTTTTGTGAATCTGTTTTGTATTGTGACAAATTCATAAGATAACATTGATATTTTGATTTGTAATATTT
CTAATTGGTAGATTTAATTGAAAAGTAAAATTAATTTATTTTTATATGTTCAGGGGAATTTTAAAGTCAAATCTTTTGTAGATAATTTAA
AAAATCAGTGTGGTTTATTTTACTTATTTAACCCACTGGTTGTTATTCTGTAACAGTTTGTATAAATGGTAAATTTTGAATGTGTTGTTA

>In-frame_KMT2A_ENST00000534358_chr11_118355029_+_MLLT10_ENST00000446906_chr10_21959376_+_8171nt
CTGCTTCACTTCACGGGGCGAACATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGG
GGCGCCGGGGCCTAGGGGGCGCCCCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGG
CGCCCCCCTCCCCCCCGGCTGTGGCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAG
CAGCCTCCTCGTCGTCCGCCTCGTCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCG
ACGCGGCGCTGCAGGTCTCGGCCGCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCG
GAGAGGATGAGCAATTCTTAGGTTTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTC
GAAAACCTCGTGGGAGACCTAGAAGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAG
AGACCAAATCTGGAGATAAGATCAAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAA
TCAAAATAACACATGGAAAGGACATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTA
CGTTTCAGCAAGCCACAAAGATTAAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAG
GAAGGAAGGGGGTACAAATTGTACGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTG
AACTGGAAAAGCCCCAGAAAGTCCGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTC
GAAGGATTAAGCCAGTTAGGATTATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGG
CTCAAAAGAAAATTGAAAAAGAAGCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTG
TTGTCAGTGCTATCTCCTCGCGGATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGAT
TAGAGTCTACACCGAATAGTAGATTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGT
CTTCAGACTCCTCTCGATCTAGTAGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGC
GGAGCGATACCCCTGAAGTTCATCCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAG
TGTCGGAGAGAAGTTTTGGATCTAGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTC
CACCTCTGCTGACTCCACCGCCACCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAG
CATCACCATTTTTGCCTGCTTCCACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAA
AGCATTCTAGGTCAGAGCCACAATACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGAC
CCCCTCCACTAACTCCCGAGGACGTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCC
ATTCTGGAACAAGGTTTGATATGCACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTG
AGTCTGTAACCTTGCCTAGTAATCGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTC
CTATTCGATCTGAACCAAGATCTCCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCC
CGTCTTCTGTCTCTTCCTCGTTAAGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCC
TGACTCAGTCTGGGGAATCTGCAGAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTA
CTCCTCTCTTCCCTTGGTTTACCCCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAG
ATGCTGACAAGAGCGTGGAGAAGGACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAA
GGAAAAAGGGATCAGAAATTCAGAGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCA
CTTCATCTTCTGCCAAAAAAGCAACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATA
CAACAGCTGTCAAAACCAAAATACTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCC
TGGAGAAGGAGAAAACCCTCTGCCTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGG
CAGACAAGCTTCCAATGACTGACAAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTC
TTAAACAAACCGACCAGCCCAAAGCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCA
GAAGAGCAGCTGTTGCCCTTGGCCGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAA
AGATTTTGTCTTCCATGGGGAATGATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTA
AACCTGTCACTAGAAACAAGGCACCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGG
TGCCTGAGGACTGTGGTGTTTGTACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAA
AATGTCAGAATCTACAATGGATGCCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCA
GTGAAAAGAAAGACAGCAAAGAGAGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTG
CCCCAAAGAAAAGCAGTAGTGAGCCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAAT
CCAAACAGGCCACCACTCCAGCTTCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAG
GACCGCCAAGAAAAGAAGTTCCCAAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCA
AACAGAAAAAAGTGGCTCCCCGCCCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGA
ATGCAGGCACTTTGAACATCCTCAGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAG
TGGACTTTAAGACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATG
CAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAG
CTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCA
GTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATC
TGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAA
ATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTA
ATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATA
AACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACAT
CATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCA
GTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGA
ATGCAATACACAACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCT
CCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTG
TTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGG
CAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCC
GAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAG
TAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAG
GAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTC
AGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGA
CTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATC
AGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCT
CAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCG
TGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGA
CTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTA
ACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAAC
AGCTCACACCAGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCATGGAGATAATGCAAGTCAGAAAGT
AGCAAGACTTAGTGATAAAACTGGGCCTGTAGCTCAAGAGAAAAGTTGACACCTGAGAAACATCTAGAAATTGCCTATCCTGCTGTTCTA
GCACTTCATCTGGCTGCCTTTGCAGTCCTTTTACTACAGCTATGAAGAAACGCAACAAGAAACTCAATGCACAACAAAGGATTAATTGCT
GCAAGGACATTCTTGTAAGGCTTTGATTAGTTTTCTTGTTGCTTTGTTGCACTGAAATGGAATTCCCATGCCCCTACCCCTTACCCCAGT
TTTTTGAACATGGAAAGAAAATTTAATAACTTTTTAAAGTGACATAATTTACATGCAATATGTTTATCAACTCAAGAATTTAATATAGTT
GGTACACAACTAGTTTTGTTTATAAATTGGAGATGCAAATAGCAAAACTAAATACTTGCTCCATTTACAAACTACTTGATTTTATTGTAC
AAGTTGAAATATGCTCTTTTGTTTGGGTTACAGTATGCTTGCTCTAAGTCAAATTCCAAGGAACTAATTTCTTCTCCTGGAGTTGCATTG
ATTCAGTATTACAAATATATAGCACATCACCTGGGACTTGGCAATCTTTGTTAAAAAAAAATTTCCTTTCTAATGGGATTTGGCCAATTT
TGGTAATGAAGTTAGGATGGTAATGTCTGCATCTGCTAAAGGTAATTTTCTTTTGAGAATTGCTTTCTTTAGTGTTAAGACCTACTCATA
TTTTGAAGAAATCTTGAGTTAAGTGAGTTCTGAGGCTGCTGGGGGAACCAGATCAATTCAAAGCTAAATACTTCTTTCAGAAAGGGGCCA
CTGTGGAAAGTGCTGGTGGGGTTTGCCCTTGATCAAGTGCCTCCATTGTGCTGCAAGGGCTGTAGACAGCAGGGTGGGACAGTCAGTCCT
CCGAGCAGCAGGAATCATCCCGTCACCTGCAGCCTTCCCATGCTTCCGCCTTTATTCAGAACTTTCTGTGCCACTGTAGATAGCTCAGGC
AAAACTATTACCTGGGTATTTATCCACTAATGAGTCACAAGAAAAGGAGTGGATTTGGTAAGAATAGAGATTTGTTTTATTTAAACCACT
TCCCATTACTGACCATTAAAAGCTCACCACTAGAGTTCCTGAAACAGGTGAAACCTGTATGACAGCCCTTCCACTTTGGGGAGCCACGCT
TTTGATGTGACAGTACCGCAGAGTGATTCCCCCACTGAGGATGTCATCATCAAACTCTTCTTTGGTGTGTGAATTATTAGTGGAAAAGAC
CCAGCTGTAATTAGACCTCCACTGTGTACTTAGCTGGAAGAACATGTTAATTCTGCAATATGTTTCTTGGTTAAACATTGCACAGTTCTT
ACCTCATTTCTGTAAATAAAGTTTTGTGAATCTGTTTTGTATTGTGACAAATTCATAAGATAACATTGATATTTTGATTTGTAATATTTC
TAATTGGTAGATTTAATTGAAAAGTAAAATTAATTTATTTTTATATGTTCAGGGGAATTTTAAAGTCAAATCTTTTGTAGATAATTTAAA
AAATCAGTGTGGTTTATTTTACTTATTTAACCCACTGGTTGTTATTCTGTAACAGTTTGTATAAATGGTAAATTTTGAATGTGTTGTTAT

>In-frame_KMT2A_ENST00000534358_chr11_118355029_+_MLLT10_ENST00000377072_chr10_21959376_+_8224nt
CTGCTTCACTTCACGGGGCGAACATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGG
GGCGCCGGGGCCTAGGGGGCGCCCCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGG
CGCCCCCCTCCCCCCCGGCTGTGGCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAG
CAGCCTCCTCGTCGTCCGCCTCGTCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCG
ACGCGGCGCTGCAGGTCTCGGCCGCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCG
GAGAGGATGAGCAATTCTTAGGTTTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTC
GAAAACCTCGTGGGAGACCTAGAAGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAG
AGACCAAATCTGGAGATAAGATCAAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAA
TCAAAATAACACATGGAAAGGACATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTA
CGTTTCAGCAAGCCACAAAGATTAAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAG
GAAGGAAGGGGGTACAAATTGTACGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTG
AACTGGAAAAGCCCCAGAAAGTCCGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTC
GAAGGATTAAGCCAGTTAGGATTATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGG
CTCAAAAGAAAATTGAAAAAGAAGCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTG
TTGTCAGTGCTATCTCCTCGCGGATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGAT
TAGAGTCTACACCGAATAGTAGATTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGT
CTTCAGACTCCTCTCGATCTAGTAGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGC
GGAGCGATACCCCTGAAGTTCATCCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAG
TGTCGGAGAGAAGTTTTGGATCTAGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTC
CACCTCTGCTGACTCCACCGCCACCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAG
CATCACCATTTTTGCCTGCTTCCACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAA
AGCATTCTAGGTCAGAGCCACAATACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGAC
CCCCTCCACTAACTCCCGAGGACGTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCC
ATTCTGGAACAAGGTTTGATATGCACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTG
AGTCTGTAACCTTGCCTAGTAATCGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTC
CTATTCGATCTGAACCAAGATCTCCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCC
CGTCTTCTGTCTCTTCCTCGTTAAGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCC
TGACTCAGTCTGGGGAATCTGCAGAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTA
CTCCTCTCTTCCCTTGGTTTACCCCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAG
ATGCTGACAAGAGCGTGGAGAAGGACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAA
GGAAAAAGGGATCAGAAATTCAGAGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCA
CTTCATCTTCTGCCAAAAAAGCAACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATA
CAACAGCTGTCAAAACCAAAATACTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCC
TGGAGAAGGAGAAAACCCTCTGCCTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGG
CAGACAAGCTTCCAATGACTGACAAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTC
TTAAACAAACCGACCAGCCCAAAGCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCA
GAAGAGCAGCTGTTGCCCTTGGCCGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAA
AGATTTTGTCTTCCATGGGGAATGATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTA
AACCTGTCACTAGAAACAAGGCACCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGG
TGCCTGAGGACTGTGGTGTTTGTACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAA
AATGTCAGAATCTACAATGGATGCCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCA
GTGAAAAGAAAGACAGCAAAGAGAGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTG
CCCCAAAGAAAAGCAGTAGTGAGCCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAAT
CCAAACAGGCCACCACTCCAGCTTCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAG
GACCGCCAAGAAAAGAAGTTCCCAAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCA
AACAGAAAAAAGTGGCTCCCCGCCCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGA
ATGCAGGCACTTTGAACATCCTCAGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAG
TGGACTTTAAGACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATG
CAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAG
CTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCA
GTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATC
TGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAA
ATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTA
ATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATA
AACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACAT
CATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCA
GTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGA
ATGCAATACACAACGACAGAGGTGACAGTTCTACACTAACAAAGCAAGAACTTAAATTCATAGGTATTTATAACAGCAATGATGTAGCAG
TATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAAC
AAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCA
GTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAG
ATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGA
TTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTG
AAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAA
GATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAA
CAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTC
ATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAG
CTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGG
GGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACC
AACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACA
CAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGAC
AAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTACACAGGCACCCCCACTTCACACAGCTAC
CACCAACCCATTTCTCACCATCCATGGAGATAATGCAAGTCAGAAAGTAGCAAGACTTAGTGATAAAACTGGGCCTGTAGCTCAAGAGAA
AAGTTGACACCTGAGAAACATCTAGAAATTGCCTATCCTGCTGTTCTAGCACTTCATCTGGCTGCCTTTGCAGTCCTTTTACTACAGCTA
TGAAGAAACGCAACAAGAAACTCAATGCACAACAAAGGATTAATTGCTGCAAGGACATTCTTGTAAGGCTTTGATTAGTTTTCTTGTTGC
TTTGTTGCACTGAAATGGAATTCCCATGCCCCTACCCCTTACCCCAGTTTTTTGAACATGGAAAGAAAATTTAATAACTTTTTAAAGTGA
CATAATTTACATGCAATATGTTTATCAACTCAAGAATTTAATATAGTTGGTACACAACTAGTTTTGTTTATAAATTGGAGATGCAAATAG
CAAAACTAAATACTTGCTCCATTTACAAACTACTTGATTTTATTGTACAAGTTGAAATATGCTCTTTTGTTTGGGTTACAGTATGCTTGC
TCTAAGTCAAATTCCAAGGAACTAATTTCTTCTCCTGGAGTTGCATTGATTCAGTATTACAAATATATAGCACATCACCTGGGACTTGGC
AATCTTTGTTAAAAAAAAATTTCCTTTCTAATGGGATTTGGCCAATTTTGGTAATGAAGTTAGGATGGTAATGTCTGCATCTGCTAAAGG
TAATTTTCTTTTGAGAATTGCTTTCTTTAGTGTTAAGACCTACTCATATTTTGAAGAAATCTTGAGTTAAGTGAGTTCTGAGGCTGCTGG
GGGAACCAGATCAATTCAAAGCTAAATACTTCTTTCAGAAAGGGGCCACTGTGGAAAGTGCTGGTGGGGTTTGCCCTTGATCAAGTGCCT
CCATTGTGCTGCAAGGGCTGTAGACAGCAGGGTGGGACAGTCAGTCCTCCGAGCAGCAGGAATCATCCCGTCACCTGCAGCCTTCCCATG
CTTCCGCCTTTATTCAGAACTTTCTGTGCCACTGTAGATAGCTCAGGCAAAACTATTACCTGGGTATTTATCCACTAATGAGTCACAAGA
AAAGGAGTGGATTTGGTAAGAATAGAGATTTGTTTTATTTAAACCACTTCCCATTACTGACCATTAAAAGCTCACCACTAGAGTTCCTGA
AACAGGTGAAACCTGTATGACAGCCCTTCCACTTTGGGGAGCCACGCTTTTGATGTGACAGTACCGCAGAGTGATTCCCCCACTGAGGAT
GTCATCATCAAACTCTTCTTTGGTGTGTGAATTATTAGTGGAAAAGACCCAGCTGTAATTAGACCTCCACTGTGTACTTAGCTGGAAGAA
CATGTTAATTCTGCAATATGTTTCTTGGTTAAACATTGCACAGTTCTTACCTCATTTCTGTAAATAAAGTTTTGTGAATCTGTTTTGTAT
TGTGACAAATTCATAAGATAACATTGATATTTTGATTTGTAATATTTCTAATTGGTAGATTTAATTGAAAAGTAAAATTAATTTATTTTT
ATATGTTCAGGGGAATTTTAAAGTCAAATCTTTTGTAGATAATTTAAAAAATCAGTGTGGTTTATTTTACTTATTTAACCCACTGGTTGT
TATTCTGTAACAGTTTGTATAAATGGTAAATTTTGAATGTGTTGTTATTTTACCTAGATGTAAAATTCCACATGTATTAAAATGTACAAA

>In-frame_KMT2A_ENST00000534358_chr11_118355029_+_MLLT10_ENST00000307729_chr10_21959376_+_8300nt
CTGCTTCACTTCACGGGGCGAACATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGG
GGCGCCGGGGCCTAGGGGGCGCCCCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGG
CGCCCCCCTCCCCCCCGGCTGTGGCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAG
CAGCCTCCTCGTCGTCCGCCTCGTCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCG
ACGCGGCGCTGCAGGTCTCGGCCGCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCG
GAGAGGATGAGCAATTCTTAGGTTTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTC
GAAAACCTCGTGGGAGACCTAGAAGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAG
AGACCAAATCTGGAGATAAGATCAAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAA
TCAAAATAACACATGGAAAGGACATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTA
CGTTTCAGCAAGCCACAAAGATTAAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAG
GAAGGAAGGGGGTACAAATTGTACGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTG
AACTGGAAAAGCCCCAGAAAGTCCGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTC
GAAGGATTAAGCCAGTTAGGATTATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGG
CTCAAAAGAAAATTGAAAAAGAAGCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTG
TTGTCAGTGCTATCTCCTCGCGGATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGAT
TAGAGTCTACACCGAATAGTAGATTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGT
CTTCAGACTCCTCTCGATCTAGTAGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGC
GGAGCGATACCCCTGAAGTTCATCCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAG
TGTCGGAGAGAAGTTTTGGATCTAGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTC
CACCTCTGCTGACTCCACCGCCACCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAG
CATCACCATTTTTGCCTGCTTCCACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAA
AGCATTCTAGGTCAGAGCCACAATACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGAC
CCCCTCCACTAACTCCCGAGGACGTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCC
ATTCTGGAACAAGGTTTGATATGCACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTG
AGTCTGTAACCTTGCCTAGTAATCGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTC
CTATTCGATCTGAACCAAGATCTCCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCC
CGTCTTCTGTCTCTTCCTCGTTAAGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCC
TGACTCAGTCTGGGGAATCTGCAGAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTA
CTCCTCTCTTCCCTTGGTTTACCCCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAG
ATGCTGACAAGAGCGTGGAGAAGGACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAA
GGAAAAAGGGATCAGAAATTCAGAGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCA
CTTCATCTTCTGCCAAAAAAGCAACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATA
CAACAGCTGTCAAAACCAAAATACTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCC
TGGAGAAGGAGAAAACCCTCTGCCTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGG
CAGACAAGCTTCCAATGACTGACAAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTC
TTAAACAAACCGACCAGCCCAAAGCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCA
GAAGAGCAGCTGTTGCCCTTGGCCGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAA
AGATTTTGTCTTCCATGGGGAATGATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTA
AACCTGTCACTAGAAACAAGGCACCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGG
TGCCTGAGGACTGTGGTGTTTGTACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAA
AATGTCAGAATCTACAATGGATGCCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCA
GTGAAAAGAAAGACAGCAAAGAGAGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTG
CCCCAAAGAAAAGCAGTAGTGAGCCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAAT
CCAAACAGGCCACCACTCCAGCTTCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAG
GACCGCCAAGAAAAGAAGTTCCCAAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCA
AACAGAAAAAAGTGGCTCCCCGCCCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGA
ATGCAGGCACTTTGAACATCCTCAGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAG
TGGACTTTAAGACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATG
CAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAG
CTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCA
GTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATC
TGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAA
ATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTA
ATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATA
AACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACAT
CATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCA
GTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGA
ATGCAATACACAACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCT
CCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTG
TTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGG
CAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCC
GAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAG
TAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAG
GAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTC
AGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGA
CTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATC
AGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCT
CAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCG
TGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGA
CTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTA
ACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAAC
AGCTCACACCAGAACAACATCAAGCCTTTTTGTATCAGTTAATGCAACATCACCACCAGCAGCACCACCAACCTGAACTTCAGCAGCTGC
AGATCCCTGGACCAACACAAATACCCATAAACAACCTTCTTGCAGGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTC
TCACCATCCATGGAGATAATGCAAGTCAGAAAGTAGCAAGACTTAGTGATAAAACTGGGCCTGTAGCTCAAGAGAAAAGTTGACACCTGA
GAAACATCTAGAAATTGCCTATCCTGCTGTTCTAGCACTTCATCTGGCTGCCTTTGCAGTCCTTTTACTACAGCTATGAAGAAACGCAAC
AAGAAACTCAATGCACAACAAAGGATTAATTGCTGCAAGGACATTCTTGTAAGGCTTTGATTAGTTTTCTTGTTGCTTTGTTGCACTGAA
ATGGAATTCCCATGCCCCTACCCCTTACCCCAGTTTTTTGAACATGGAAAGAAAATTTAATAACTTTTTAAAGTGACATAATTTACATGC
AATATGTTTATCAACTCAAGAATTTAATATAGTTGGTACACAACTAGTTTTGTTTATAAATTGGAGATGCAAATAGCAAAACTAAATACT
TGCTCCATTTACAAACTACTTGATTTTATTGTACAAGTTGAAATATGCTCTTTTGTTTGGGTTACAGTATGCTTGCTCTAAGTCAAATTC
CAAGGAACTAATTTCTTCTCCTGGAGTTGCATTGATTCAGTATTACAAATATATAGCACATCACCTGGGACTTGGCAATCTTTGTTAAAA
AAAAATTTCCTTTCTAATGGGATTTGGCCAATTTTGGTAATGAAGTTAGGATGGTAATGTCTGCATCTGCTAAAGGTAATTTTCTTTTGA
GAATTGCTTTCTTTAGTGTTAAGACCTACTCATATTTTGAAGAAATCTTGAGTTAAGTGAGTTCTGAGGCTGCTGGGGGAACCAGATCAA
TTCAAAGCTAAATACTTCTTTCAGAAAGGGGCCACTGTGGAAAGTGCTGGTGGGGTTTGCCCTTGATCAAGTGCCTCCATTGTGCTGCAA
GGGCTGTAGACAGCAGGGTGGGACAGTCAGTCCTCCGAGCAGCAGGAATCATCCCGTCACCTGCAGCCTTCCCATGCTTCCGCCTTTATT
CAGAACTTTCTGTGCCACTGTAGATAGCTCAGGCAAAACTATTACCTGGGTATTTATCCACTAATGAGTCACAAGAAAAGGAGTGGATTT
GGTAAGAATAGAGATTTGTTTTATTTAAACCACTTCCCATTACTGACCATTAAAAGCTCACCACTAGAGTTCCTGAAACAGGTGAAACCT
GTATGACAGCCCTTCCACTTTGGGGAGCCACGCTTTTGATGTGACAGTACCGCAGAGTGATTCCCCCACTGAGGATGTCATCATCAAACT
CTTCTTTGGTGTGTGAATTATTAGTGGAAAAGACCCAGCTGTAATTAGACCTCCACTGTGTACTTAGCTGGAAGAACATGTTAATTCTGC
AATATGTTTCTTGGTTAAACATTGCACAGTTCTTACCTCATTTCTGTAAATAAAGTTTTGTGAATCTGTTTTGTATTGTGACAAATTCAT
AAGATAACATTGATATTTTGATTTGTAATATTTCTAATTGGTAGATTTAATTGAAAAGTAAAATTAATTTATTTTTATATGTTCAGGGGA
ATTTTAAAGTCAAATCTTTTGTAGATAATTTAAAAAATCAGTGTGGTTTATTTTACTTATTTAACCCACTGGTTGTTATTCTGTAACAGT
TTGTATAAATGGTAAATTTTGAATGTGTTGTTATTTTACCTAGATGTAAAATTCCACATGTATTAAAATGTACAAAATGTTTTGTTAATA

>In-frame_KMT2A_ENST00000534358_chr11_118355029_+_MLLT10_ENST00000377059_chr10_21959376_+_8171nt
CTGCTTCACTTCACGGGGCGAACATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGG
GGCGCCGGGGCCTAGGGGGCGCCCCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGG
CGCCCCCCTCCCCCCCGGCTGTGGCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAG
CAGCCTCCTCGTCGTCCGCCTCGTCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCG
ACGCGGCGCTGCAGGTCTCGGCCGCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCG
GAGAGGATGAGCAATTCTTAGGTTTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTC
GAAAACCTCGTGGGAGACCTAGAAGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAG
AGACCAAATCTGGAGATAAGATCAAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAA
TCAAAATAACACATGGAAAGGACATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTA
CGTTTCAGCAAGCCACAAAGATTAAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAG
GAAGGAAGGGGGTACAAATTGTACGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTG
AACTGGAAAAGCCCCAGAAAGTCCGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTC
GAAGGATTAAGCCAGTTAGGATTATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGG
CTCAAAAGAAAATTGAAAAAGAAGCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTG
TTGTCAGTGCTATCTCCTCGCGGATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGAT
TAGAGTCTACACCGAATAGTAGATTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGT
CTTCAGACTCCTCTCGATCTAGTAGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGC
GGAGCGATACCCCTGAAGTTCATCCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAG
TGTCGGAGAGAAGTTTTGGATCTAGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTC
CACCTCTGCTGACTCCACCGCCACCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAG
CATCACCATTTTTGCCTGCTTCCACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAA
AGCATTCTAGGTCAGAGCCACAATACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGAC
CCCCTCCACTAACTCCCGAGGACGTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCC
ATTCTGGAACAAGGTTTGATATGCACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTG
AGTCTGTAACCTTGCCTAGTAATCGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTC
CTATTCGATCTGAACCAAGATCTCCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCC
CGTCTTCTGTCTCTTCCTCGTTAAGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCC
TGACTCAGTCTGGGGAATCTGCAGAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTA
CTCCTCTCTTCCCTTGGTTTACCCCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAG
ATGCTGACAAGAGCGTGGAGAAGGACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAA
GGAAAAAGGGATCAGAAATTCAGAGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCA
CTTCATCTTCTGCCAAAAAAGCAACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATA
CAACAGCTGTCAAAACCAAAATACTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCC
TGGAGAAGGAGAAAACCCTCTGCCTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGG
CAGACAAGCTTCCAATGACTGACAAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTC
TTAAACAAACCGACCAGCCCAAAGCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCA
GAAGAGCAGCTGTTGCCCTTGGCCGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAA
AGATTTTGTCTTCCATGGGGAATGATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTA
AACCTGTCACTAGAAACAAGGCACCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGG
TGCCTGAGGACTGTGGTGTTTGTACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAA
AATGTCAGAATCTACAATGGATGCCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCA
GTGAAAAGAAAGACAGCAAAGAGAGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTG
CCCCAAAGAAAAGCAGTAGTGAGCCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAAT
CCAAACAGGCCACCACTCCAGCTTCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAG
GACCGCCAAGAAAAGAAGTTCCCAAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCA
AACAGAAAAAAGTGGCTCCCCGCCCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGA
ATGCAGGCACTTTGAACATCCTCAGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAG
TGGACTTTAAGACTTATACAAGCACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATG
CAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAG
CTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCA
GTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATC
TGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAA
ATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTA
ATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATA
AACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACAT
CATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCA
GTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGA
ATGCAATACACAACGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCT
CCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTG
TTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGG
CAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCC
GAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAG
TAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAG
GAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTC
AGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGA
CTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATC
AGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCT
CAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCG
TGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGA
CTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTA
ACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAAC
AGCTCACACCAGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCATGGAGATAATGCAAGTCAGAAAGT
AGCAAGACTTAGTGATAAAACTGGGCCTGTAGCTCAAGAGAAAAGTTGACACCTGAGAAACATCTAGAAATTGCCTATCCTGCTGTTCTA
GCACTTCATCTGGCTGCCTTTGCAGTCCTTTTACTACAGCTATGAAGAAACGCAACAAGAAACTCAATGCACAACAAAGGATTAATTGCT
GCAAGGACATTCTTGTAAGGCTTTGATTAGTTTTCTTGTTGCTTTGTTGCACTGAAATGGAATTCCCATGCCCCTACCCCTTACCCCAGT
TTTTTGAACATGGAAAGAAAATTTAATAACTTTTTAAAGTGACATAATTTACATGCAATATGTTTATCAACTCAAGAATTTAATATAGTT
GGTACACAACTAGTTTTGTTTATAAATTGGAGATGCAAATAGCAAAACTAAATACTTGCTCCATTTACAAACTACTTGATTTTATTGTAC
AAGTTGAAATATGCTCTTTTGTTTGGGTTACAGTATGCTTGCTCTAAGTCAAATTCCAAGGAACTAATTTCTTCTCCTGGAGTTGCATTG
ATTCAGTATTACAAATATATAGCACATCACCTGGGACTTGGCAATCTTTGTTAAAAAAAAATTTCCTTTCTAATGGGATTTGGCCAATTT
TGGTAATGAAGTTAGGATGGTAATGTCTGCATCTGCTAAAGGTAATTTTCTTTTGAGAATTGCTTTCTTTAGTGTTAAGACCTACTCATA
TTTTGAAGAAATCTTGAGTTAAGTGAGTTCTGAGGCTGCTGGGGGAACCAGATCAATTCAAAGCTAAATACTTCTTTCAGAAAGGGGCCA
CTGTGGAAAGTGCTGGTGGGGTTTGCCCTTGATCAAGTGCCTCCATTGTGCTGCAAGGGCTGTAGACAGCAGGGTGGGACAGTCAGTCCT
CCGAGCAGCAGGAATCATCCCGTCACCTGCAGCCTTCCCATGCTTCCGCCTTTATTCAGAACTTTCTGTGCCACTGTAGATAGCTCAGGC
AAAACTATTACCTGGGTATTTATCCACTAATGAGTCACAAGAAAAGGAGTGGATTTGGTAAGAATAGAGATTTGTTTTATTTAAACCACT
TCCCATTACTGACCATTAAAAGCTCACCACTAGAGTTCCTGAAACAGGTGAAACCTGTATGACAGCCCTTCCACTTTGGGGAGCCACGCT
TTTGATGTGACAGTACCGCAGAGTGATTCCCCCACTGAGGATGTCATCATCAAACTCTTCTTTGGTGTGTGAATTATTAGTGGAAAAGAC
CCAGCTGTAATTAGACCTCCACTGTGTACTTAGCTGGAAGAACATGTTAATTCTGCAATATGTTTCTTGGTTAAACATTGCACAGTTCTT
ACCTCATTTCTGTAAATAAAGTTTTGTGAATCTGTTTTGTATTGTGACAAATTCATAAGATAACATTGATATTTTGATTTGTAATATTTC
TAATTGGTAGATTTAATTGAAAAGTAAAATTAATTTATTTTTATATGTTCAGGGGAATTTTAAAGTCAAATCTTTTGTAGATAATTTAAA
AAATCAGTGTGGTTTATTTTACTTATTTAACCCACTGGTTGTTATTCTGTAACAGTTTGTATAAATGGTAAATTTTGAATGTGTTGTTAT

>In-frame_KMT2A_ENST00000389506_chr11_118355029_+_MLLT10_ENST00000446906_chr10_21959376_+_8148nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGACTTATACAAGC
ACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCA
CACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGA
AGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGT
GTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCAC
TCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGC
CTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGA
TATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGC
AGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGA
AGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGT
TCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGGTATTTAT
AACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAG
TCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACT
CTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAA
AACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCC
CCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTT
TTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAA
CTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCA
GTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTG
AACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAA
AGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAG
GTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATT
GGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAAC
CCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTA
CTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTACACAGGCAC
CCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCATGGAGATAATGCAAGTCAGAAAGTAGCAAGACTTAGTGATAAAACTG
GGCCTGTAGCTCAAGAGAAAAGTTGACACCTGAGAAACATCTAGAAATTGCCTATCCTGCTGTTCTAGCACTTCATCTGGCTGCCTTTGC
AGTCCTTTTACTACAGCTATGAAGAAACGCAACAAGAAACTCAATGCACAACAAAGGATTAATTGCTGCAAGGACATTCTTGTAAGGCTT
TGATTAGTTTTCTTGTTGCTTTGTTGCACTGAAATGGAATTCCCATGCCCCTACCCCTTACCCCAGTTTTTTGAACATGGAAAGAAAATT
TAATAACTTTTTAAAGTGACATAATTTACATGCAATATGTTTATCAACTCAAGAATTTAATATAGTTGGTACACAACTAGTTTTGTTTAT
AAATTGGAGATGCAAATAGCAAAACTAAATACTTGCTCCATTTACAAACTACTTGATTTTATTGTACAAGTTGAAATATGCTCTTTTGTT
TGGGTTACAGTATGCTTGCTCTAAGTCAAATTCCAAGGAACTAATTTCTTCTCCTGGAGTTGCATTGATTCAGTATTACAAATATATAGC
ACATCACCTGGGACTTGGCAATCTTTGTTAAAAAAAAATTTCCTTTCTAATGGGATTTGGCCAATTTTGGTAATGAAGTTAGGATGGTAA
TGTCTGCATCTGCTAAAGGTAATTTTCTTTTGAGAATTGCTTTCTTTAGTGTTAAGACCTACTCATATTTTGAAGAAATCTTGAGTTAAG
TGAGTTCTGAGGCTGCTGGGGGAACCAGATCAATTCAAAGCTAAATACTTCTTTCAGAAAGGGGCCACTGTGGAAAGTGCTGGTGGGGTT
TGCCCTTGATCAAGTGCCTCCATTGTGCTGCAAGGGCTGTAGACAGCAGGGTGGGACAGTCAGTCCTCCGAGCAGCAGGAATCATCCCGT
CACCTGCAGCCTTCCCATGCTTCCGCCTTTATTCAGAACTTTCTGTGCCACTGTAGATAGCTCAGGCAAAACTATTACCTGGGTATTTAT
CCACTAATGAGTCACAAGAAAAGGAGTGGATTTGGTAAGAATAGAGATTTGTTTTATTTAAACCACTTCCCATTACTGACCATTAAAAGC
TCACCACTAGAGTTCCTGAAACAGGTGAAACCTGTATGACAGCCCTTCCACTTTGGGGAGCCACGCTTTTGATGTGACAGTACCGCAGAG
TGATTCCCCCACTGAGGATGTCATCATCAAACTCTTCTTTGGTGTGTGAATTATTAGTGGAAAAGACCCAGCTGTAATTAGACCTCCACT
GTGTACTTAGCTGGAAGAACATGTTAATTCTGCAATATGTTTCTTGGTTAAACATTGCACAGTTCTTACCTCATTTCTGTAAATAAAGTT
TTGTGAATCTGTTTTGTATTGTGACAAATTCATAAGATAACATTGATATTTTGATTTGTAATATTTCTAATTGGTAGATTTAATTGAAAA
GTAAAATTAATTTATTTTTATATGTTCAGGGGAATTTTAAAGTCAAATCTTTTGTAGATAATTTAAAAAATCAGTGTGGTTTATTTTACT
TATTTAACCCACTGGTTGTTATTCTGTAACAGTTTGTATAAATGGTAAATTTTGAATGTGTTGTTATTTTACCTAGATGTAAAATTCCAC

>In-frame_KMT2A_ENST00000389506_chr11_118355029_+_MLLT10_ENST00000377072_chr10_21959376_+_8201nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGACTTATACAAGC
ACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCA
CACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGA
AGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGT
GTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCAC
TCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGC
CTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGA
TATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGC
AGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGA
AGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGT
TCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGACAGAGGT
GACAGTTCTACACTAACAAAGCAAGAACTTAAATTCATAGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCT
GGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCA
GCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTAT
GGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAAC
CTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAAC
AGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAA
CAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAAC
TTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCAT
CAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCT
GATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCT
GGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAG
CCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTA
GGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACA
CATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAG
TTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCC
ATGGAGATAATGCAAGTCAGAAAGTAGCAAGACTTAGTGATAAAACTGGGCCTGTAGCTCAAGAGAAAAGTTGACACCTGAGAAACATCT
AGAAATTGCCTATCCTGCTGTTCTAGCACTTCATCTGGCTGCCTTTGCAGTCCTTTTACTACAGCTATGAAGAAACGCAACAAGAAACTC
AATGCACAACAAAGGATTAATTGCTGCAAGGACATTCTTGTAAGGCTTTGATTAGTTTTCTTGTTGCTTTGTTGCACTGAAATGGAATTC
CCATGCCCCTACCCCTTACCCCAGTTTTTTGAACATGGAAAGAAAATTTAATAACTTTTTAAAGTGACATAATTTACATGCAATATGTTT
ATCAACTCAAGAATTTAATATAGTTGGTACACAACTAGTTTTGTTTATAAATTGGAGATGCAAATAGCAAAACTAAATACTTGCTCCATT
TACAAACTACTTGATTTTATTGTACAAGTTGAAATATGCTCTTTTGTTTGGGTTACAGTATGCTTGCTCTAAGTCAAATTCCAAGGAACT
AATTTCTTCTCCTGGAGTTGCATTGATTCAGTATTACAAATATATAGCACATCACCTGGGACTTGGCAATCTTTGTTAAAAAAAAATTTC
CTTTCTAATGGGATTTGGCCAATTTTGGTAATGAAGTTAGGATGGTAATGTCTGCATCTGCTAAAGGTAATTTTCTTTTGAGAATTGCTT
TCTTTAGTGTTAAGACCTACTCATATTTTGAAGAAATCTTGAGTTAAGTGAGTTCTGAGGCTGCTGGGGGAACCAGATCAATTCAAAGCT
AAATACTTCTTTCAGAAAGGGGCCACTGTGGAAAGTGCTGGTGGGGTTTGCCCTTGATCAAGTGCCTCCATTGTGCTGCAAGGGCTGTAG
ACAGCAGGGTGGGACAGTCAGTCCTCCGAGCAGCAGGAATCATCCCGTCACCTGCAGCCTTCCCATGCTTCCGCCTTTATTCAGAACTTT
CTGTGCCACTGTAGATAGCTCAGGCAAAACTATTACCTGGGTATTTATCCACTAATGAGTCACAAGAAAAGGAGTGGATTTGGTAAGAAT
AGAGATTTGTTTTATTTAAACCACTTCCCATTACTGACCATTAAAAGCTCACCACTAGAGTTCCTGAAACAGGTGAAACCTGTATGACAG
CCCTTCCACTTTGGGGAGCCACGCTTTTGATGTGACAGTACCGCAGAGTGATTCCCCCACTGAGGATGTCATCATCAAACTCTTCTTTGG
TGTGTGAATTATTAGTGGAAAAGACCCAGCTGTAATTAGACCTCCACTGTGTACTTAGCTGGAAGAACATGTTAATTCTGCAATATGTTT
CTTGGTTAAACATTGCACAGTTCTTACCTCATTTCTGTAAATAAAGTTTTGTGAATCTGTTTTGTATTGTGACAAATTCATAAGATAACA
TTGATATTTTGATTTGTAATATTTCTAATTGGTAGATTTAATTGAAAAGTAAAATTAATTTATTTTTATATGTTCAGGGGAATTTTAAAG
TCAAATCTTTTGTAGATAATTTAAAAAATCAGTGTGGTTTATTTTACTTATTTAACCCACTGGTTGTTATTCTGTAACAGTTTGTATAAA
TGGTAAATTTTGAATGTGTTGTTATTTTACCTAGATGTAAAATTCCACATGTATTAAAATGTACAAAATGTTTTGTTAATAAAATTTAAT

>In-frame_KMT2A_ENST00000389506_chr11_118355029_+_MLLT10_ENST00000307729_chr10_21959376_+_8277nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGACTTATACAAGC
ACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCA
CACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGA
AGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGT
GTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCAC
TCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGC
CTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGA
TATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGC
AGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGA
AGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGT
TCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGGTATTTAT
AACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAG
TCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACT
CTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAA
AACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCC
CCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTT
TTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAA
CTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCA
GTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTG
AACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAA
AGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAG
GTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATT
GGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAAC
CCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTA
CTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGAACAACATCAA
GCCTTTTTGTATCAGTTAATGCAACATCACCACCAGCAGCACCACCAACCTGAACTTCAGCAGCTGCAGATCCCTGGACCAACACAAATA
CCCATAAACAACCTTCTTGCAGGTACACAGGCACCCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCATGGAGATAATGCA
AGTCAGAAAGTAGCAAGACTTAGTGATAAAACTGGGCCTGTAGCTCAAGAGAAAAGTTGACACCTGAGAAACATCTAGAAATTGCCTATC
CTGCTGTTCTAGCACTTCATCTGGCTGCCTTTGCAGTCCTTTTACTACAGCTATGAAGAAACGCAACAAGAAACTCAATGCACAACAAAG
GATTAATTGCTGCAAGGACATTCTTGTAAGGCTTTGATTAGTTTTCTTGTTGCTTTGTTGCACTGAAATGGAATTCCCATGCCCCTACCC
CTTACCCCAGTTTTTTGAACATGGAAAGAAAATTTAATAACTTTTTAAAGTGACATAATTTACATGCAATATGTTTATCAACTCAAGAAT
TTAATATAGTTGGTACACAACTAGTTTTGTTTATAAATTGGAGATGCAAATAGCAAAACTAAATACTTGCTCCATTTACAAACTACTTGA
TTTTATTGTACAAGTTGAAATATGCTCTTTTGTTTGGGTTACAGTATGCTTGCTCTAAGTCAAATTCCAAGGAACTAATTTCTTCTCCTG
GAGTTGCATTGATTCAGTATTACAAATATATAGCACATCACCTGGGACTTGGCAATCTTTGTTAAAAAAAAATTTCCTTTCTAATGGGAT
TTGGCCAATTTTGGTAATGAAGTTAGGATGGTAATGTCTGCATCTGCTAAAGGTAATTTTCTTTTGAGAATTGCTTTCTTTAGTGTTAAG
ACCTACTCATATTTTGAAGAAATCTTGAGTTAAGTGAGTTCTGAGGCTGCTGGGGGAACCAGATCAATTCAAAGCTAAATACTTCTTTCA
GAAAGGGGCCACTGTGGAAAGTGCTGGTGGGGTTTGCCCTTGATCAAGTGCCTCCATTGTGCTGCAAGGGCTGTAGACAGCAGGGTGGGA
CAGTCAGTCCTCCGAGCAGCAGGAATCATCCCGTCACCTGCAGCCTTCCCATGCTTCCGCCTTTATTCAGAACTTTCTGTGCCACTGTAG
ATAGCTCAGGCAAAACTATTACCTGGGTATTTATCCACTAATGAGTCACAAGAAAAGGAGTGGATTTGGTAAGAATAGAGATTTGTTTTA
TTTAAACCACTTCCCATTACTGACCATTAAAAGCTCACCACTAGAGTTCCTGAAACAGGTGAAACCTGTATGACAGCCCTTCCACTTTGG
GGAGCCACGCTTTTGATGTGACAGTACCGCAGAGTGATTCCCCCACTGAGGATGTCATCATCAAACTCTTCTTTGGTGTGTGAATTATTA
GTGGAAAAGACCCAGCTGTAATTAGACCTCCACTGTGTACTTAGCTGGAAGAACATGTTAATTCTGCAATATGTTTCTTGGTTAAACATT
GCACAGTTCTTACCTCATTTCTGTAAATAAAGTTTTGTGAATCTGTTTTGTATTGTGACAAATTCATAAGATAACATTGATATTTTGATT
TGTAATATTTCTAATTGGTAGATTTAATTGAAAAGTAAAATTAATTTATTTTTATATGTTCAGGGGAATTTTAAAGTCAAATCTTTTGTA
GATAATTTAAAAAATCAGTGTGGTTTATTTTACTTATTTAACCCACTGGTTGTTATTCTGTAACAGTTTGTATAAATGGTAAATTTTGAA

>In-frame_KMT2A_ENST00000389506_chr11_118355029_+_MLLT10_ENST00000377059_chr10_21959376_+_8148nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGACTTATACAAGC
ACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCA
CACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGA
AGAAAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGT
GTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCAC
TCCCAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGC
CTCCCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGA
TATAAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGC
AGACCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGA
AGCATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGT
TCAGAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGGTATTTAT
AACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAG
TCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACT
CTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAA
AACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCC
CCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTT
TTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAA
CTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCA
GTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTG
AACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAA
AGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAG
GTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATT
GGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAAC
CCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTA
CTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTACACAGGCAC
CCCCACTTCACACAGCTACCACCAACCCATTTCTCACCATCCATGGAGATAATGCAAGTCAGAAAGTAGCAAGACTTAGTGATAAAACTG
GGCCTGTAGCTCAAGAGAAAAGTTGACACCTGAGAAACATCTAGAAATTGCCTATCCTGCTGTTCTAGCACTTCATCTGGCTGCCTTTGC
AGTCCTTTTACTACAGCTATGAAGAAACGCAACAAGAAACTCAATGCACAACAAAGGATTAATTGCTGCAAGGACATTCTTGTAAGGCTT
TGATTAGTTTTCTTGTTGCTTTGTTGCACTGAAATGGAATTCCCATGCCCCTACCCCTTACCCCAGTTTTTTGAACATGGAAAGAAAATT
TAATAACTTTTTAAAGTGACATAATTTACATGCAATATGTTTATCAACTCAAGAATTTAATATAGTTGGTACACAACTAGTTTTGTTTAT
AAATTGGAGATGCAAATAGCAAAACTAAATACTTGCTCCATTTACAAACTACTTGATTTTATTGTACAAGTTGAAATATGCTCTTTTGTT
TGGGTTACAGTATGCTTGCTCTAAGTCAAATTCCAAGGAACTAATTTCTTCTCCTGGAGTTGCATTGATTCAGTATTACAAATATATAGC
ACATCACCTGGGACTTGGCAATCTTTGTTAAAAAAAAATTTCCTTTCTAATGGGATTTGGCCAATTTTGGTAATGAAGTTAGGATGGTAA
TGTCTGCATCTGCTAAAGGTAATTTTCTTTTGAGAATTGCTTTCTTTAGTGTTAAGACCTACTCATATTTTGAAGAAATCTTGAGTTAAG
TGAGTTCTGAGGCTGCTGGGGGAACCAGATCAATTCAAAGCTAAATACTTCTTTCAGAAAGGGGCCACTGTGGAAAGTGCTGGTGGGGTT
TGCCCTTGATCAAGTGCCTCCATTGTGCTGCAAGGGCTGTAGACAGCAGGGTGGGACAGTCAGTCCTCCGAGCAGCAGGAATCATCCCGT
CACCTGCAGCCTTCCCATGCTTCCGCCTTTATTCAGAACTTTCTGTGCCACTGTAGATAGCTCAGGCAAAACTATTACCTGGGTATTTAT
CCACTAATGAGTCACAAGAAAAGGAGTGGATTTGGTAAGAATAGAGATTTGTTTTATTTAAACCACTTCCCATTACTGACCATTAAAAGC
TCACCACTAGAGTTCCTGAAACAGGTGAAACCTGTATGACAGCCCTTCCACTTTGGGGAGCCACGCTTTTGATGTGACAGTACCGCAGAG
TGATTCCCCCACTGAGGATGTCATCATCAAACTCTTCTTTGGTGTGTGAATTATTAGTGGAAAAGACCCAGCTGTAATTAGACCTCCACT
GTGTACTTAGCTGGAAGAACATGTTAATTCTGCAATATGTTTCTTGGTTAAACATTGCACAGTTCTTACCTCATTTCTGTAAATAAAGTT
TTGTGAATCTGTTTTGTATTGTGACAAATTCATAAGATAACATTGATATTTTGATTTGTAATATTTCTAATTGGTAGATTTAATTGAAAA
GTAAAATTAATTTATTTTTATATGTTCAGGGGAATTTTAAAGTCAAATCTTTTGTAGATAATTTAAAAAATCAGTGTGGTTTATTTTACT
TATTTAACCCACTGGTTGTTATTCTGTAACAGTTTGTATAAATGGTAAATTTTGAATGTGTTGTTATTTTACCTAGATGTAAAATTCCAC

>In-frame_KMT2A_ENST00000354520_chr11_118355029_+_MLLT10_ENST00000446906_chr10_21959376_+_8148nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGACTTATACAAGC
ACTAGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCA
CACACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGA
AGAAAGCC