FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 19092

FusionGeneSummary for KMT2A_FRYL

check button Fusion gene summary
Fusion gene informationFusion gene name: KMT2A_FRYL
Fusion gene ID: 19092
HgeneTgene
Gene symbol

KMT2A

FRYL

Gene ID

4297

285527

Gene namelysine methyltransferase 2AFRY like transcription coactivator
SynonymsALL-1|CXXC7|HRX|HTRX1|MLL|MLL1|MLL1A|TRX1|WDSTSAF4p12|KIAA0826|MOR2
Cytomap

11q23.3

4p11

Type of geneprotein-codingprotein-coding
Descriptionhistone-lysine N-methyltransferase 2ACXXC-type zinc finger protein 7lysine (K)-specific methyltransferase 2Alysine N-methyltransferase 2Amixed lineage leukemia 1myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila)trithorax-likeprotein furry homolog-likeALL1-fused gene from chromosome 4p12 proteinFRY-likefurry homolog-likefurry-likemor2 cell polarity protein homolog
Modification date2018051920180523
UniProtAcc

Q03164

O94915

Ensembl transtripts involved in fusion geneENST00000534358, ENST00000389506, 
ENST00000354520, ENST00000420751, 
ENST00000503238, ENST00000358350, 
ENST00000537810, ENST00000264319, 
ENST00000507711, ENST00000514783, 
ENST00000507873, ENST00000506685, 
Fusion gene scores* DoF score31 X 72 X 6=133925 X 6 X 2=60
# samples 1299
** MAII scorelog2(129/13392*10)=-3.37592846223973
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(9/60*10)=0.584962500721156
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: KMT2A [Title/Abstract] AND FRYL [Title/Abstract] AND fusion [Title/Abstract]

Prospective tracing of MLL-FRYL clone with low MEIS1 expression from emergence during neuroblastoma treatment to diagnosis of myelodysplastic syndrome (pmid: 18195096)
Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Transcription factor involved fusion gene, inframe and retained DNA-binding domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneKMT2A

GO:0045944

positive regulation of transcription by RNA polymerase II

20861184

HgeneKMT2A

GO:0051568

histone H3-K4 methylation

19556245

HgeneKMT2A

GO:0065003

protein-containing complex assembly

15199122

HgeneKMT2A

GO:0080182

histone H3-K4 trimethylation

20861184


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
ChiTaRS3.1DQ299939KMT2Achr11

118355029

+FRYLchr4

48530355

-
ChiTaRS3.1DQ299937KMT2Achr11

118355029

+FRYLchr4

48530355

-
ChiTaRS3.1DQ299940KMT2Achr11

118355029

+FRYLchr4

48530355

-
ChiTaRS3.1DQ299938KMT2Achr11

118355690

+FRYLchr4

48530355

-
ChiTaRS3.1DQ299935KMT2Achr11

118358019

+FRYLchr4

48531751

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000534358ENST00000503238KMT2Achr11

118355029

+FRYLchr4

48530355

-
In-frameENST00000534358ENST00000358350KMT2Achr11

118355029

+FRYLchr4

48530355

-
In-frameENST00000534358ENST00000537810KMT2Achr11

118355029

+FRYLchr4

48530355

-
5CDS-5UTRENST00000534358ENST00000264319KMT2Achr11

118355029

+FRYLchr4

48530355

-
5CDS-intronENST00000534358ENST00000507711KMT2Achr11

118355029

+FRYLchr4

48530355

-
5CDS-intronENST00000534358ENST00000514783KMT2Achr11

118355029

+FRYLchr4

48530355

-
5CDS-5UTRENST00000534358ENST00000507873KMT2Achr11

118355029

+FRYLchr4

48530355

-
5CDS-intronENST00000534358ENST00000506685KMT2Achr11

118355029

+FRYLchr4

48530355

-
In-frameENST00000389506ENST00000503238KMT2Achr11

118355029

+FRYLchr4

48530355

-
In-frameENST00000389506ENST00000358350KMT2Achr11

118355029

+FRYLchr4

48530355

-
In-frameENST00000389506ENST00000537810KMT2Achr11

118355029

+FRYLchr4

48530355

-
5CDS-5UTRENST00000389506ENST00000264319KMT2Achr11

118355029

+FRYLchr4

48530355

-
5CDS-intronENST00000389506ENST00000507711KMT2Achr11

118355029

+FRYLchr4

48530355

-
5CDS-intronENST00000389506ENST00000514783KMT2Achr11

118355029

+FRYLchr4

48530355

-
5CDS-5UTRENST00000389506ENST00000507873KMT2Achr11

118355029

+FRYLchr4

48530355

-
5CDS-intronENST00000389506ENST00000506685KMT2Achr11

118355029

+FRYLchr4

48530355

-
In-frameENST00000354520ENST00000503238KMT2Achr11

118355029

+FRYLchr4

48530355

-
In-frameENST00000354520ENST00000358350KMT2Achr11

118355029

+FRYLchr4

48530355

-
In-frameENST00000354520ENST00000537810KMT2Achr11

118355029

+FRYLchr4

48530355

-
5CDS-5UTRENST00000354520ENST00000264319KMT2Achr11

118355029

+FRYLchr4

48530355

-
5CDS-intronENST00000354520ENST00000507711KMT2Achr11

118355029

+FRYLchr4

48530355

-
5CDS-intronENST00000354520ENST00000514783KMT2Achr11

118355029

+FRYLchr4

48530355

-
5CDS-5UTRENST00000354520ENST00000507873KMT2Achr11

118355029

+FRYLchr4

48530355

-
5CDS-intronENST00000354520ENST00000506685KMT2Achr11

118355029

+FRYLchr4

48530355

-
3UTR-3CDSENST00000420751ENST00000503238KMT2Achr11

118355029

+FRYLchr4

48530355

-
3UTR-3CDSENST00000420751ENST00000358350KMT2Achr11

118355029

+FRYLchr4

48530355

-
3UTR-3CDSENST00000420751ENST00000537810KMT2Achr11

118355029

+FRYLchr4

48530355

-
3UTR-5UTRENST00000420751ENST00000264319KMT2Achr11

118355029

+FRYLchr4

48530355

-
3UTR-intronENST00000420751ENST00000507711KMT2Achr11

118355029

+FRYLchr4

48530355

-
3UTR-intronENST00000420751ENST00000514783KMT2Achr11

118355029

+FRYLchr4

48530355

-
3UTR-5UTRENST00000420751ENST00000507873KMT2Achr11

118355029

+FRYLchr4

48530355

-
3UTR-intronENST00000420751ENST00000506685KMT2Achr11

118355029

+FRYLchr4

48530355

-
In-frameENST00000534358ENST00000503238KMT2Achr11

118355690

+FRYLchr4

48530355

-
In-frameENST00000534358ENST00000358350KMT2Achr11

118355690

+FRYLchr4

48530355

-
In-frameENST00000534358ENST00000537810KMT2Achr11

118355690

+FRYLchr4

48530355

-
5CDS-5UTRENST00000534358ENST00000264319KMT2Achr11

118355690

+FRYLchr4

48530355

-
5CDS-intronENST00000534358ENST00000507711KMT2Achr11

118355690

+FRYLchr4

48530355

-
5CDS-intronENST00000534358ENST00000514783KMT2Achr11

118355690

+FRYLchr4

48530355

-
5CDS-5UTRENST00000534358ENST00000507873KMT2Achr11

118355690

+FRYLchr4

48530355

-
5CDS-intronENST00000534358ENST00000506685KMT2Achr11

118355690

+FRYLchr4

48530355

-
In-frameENST00000389506ENST00000503238KMT2Achr11

118355690

+FRYLchr4

48530355

-
In-frameENST00000389506ENST00000358350KMT2Achr11

118355690

+FRYLchr4

48530355

-
In-frameENST00000389506ENST00000537810KMT2Achr11

118355690

+FRYLchr4

48530355

-
5CDS-5UTRENST00000389506ENST00000264319KMT2Achr11

118355690

+FRYLchr4

48530355

-
5CDS-intronENST00000389506ENST00000507711KMT2Achr11

118355690

+FRYLchr4

48530355

-
5CDS-intronENST00000389506ENST00000514783KMT2Achr11

118355690

+FRYLchr4

48530355

-
5CDS-5UTRENST00000389506ENST00000507873KMT2Achr11

118355690

+FRYLchr4

48530355

-
5CDS-intronENST00000389506ENST00000506685KMT2Achr11

118355690

+FRYLchr4

48530355

-
intron-3CDSENST00000354520ENST00000503238KMT2Achr11

118355690

+FRYLchr4

48530355

-
intron-3CDSENST00000354520ENST00000358350KMT2Achr11

118355690

+FRYLchr4

48530355

-
intron-3CDSENST00000354520ENST00000537810KMT2Achr11

118355690

+FRYLchr4

48530355

-
intron-5UTRENST00000354520ENST00000264319KMT2Achr11

118355690

+FRYLchr4

48530355

-
intron-intronENST00000354520ENST00000507711KMT2Achr11

118355690

+FRYLchr4

48530355

-
intron-intronENST00000354520ENST00000514783KMT2Achr11

118355690

+FRYLchr4

48530355

-
intron-5UTRENST00000354520ENST00000507873KMT2Achr11

118355690

+FRYLchr4

48530355

-
intron-intronENST00000354520ENST00000506685KMT2Achr11

118355690

+FRYLchr4

48530355

-
intron-3CDSENST00000420751ENST00000503238KMT2Achr11

118355690

+FRYLchr4

48530355

-
intron-3CDSENST00000420751ENST00000358350KMT2Achr11

118355690

+FRYLchr4

48530355

-
intron-3CDSENST00000420751ENST00000537810KMT2Achr11

118355690

+FRYLchr4

48530355

-
intron-5UTRENST00000420751ENST00000264319KMT2Achr11

118355690

+FRYLchr4

48530355

-
intron-intronENST00000420751ENST00000507711KMT2Achr11

118355690

+FRYLchr4

48530355

-
intron-intronENST00000420751ENST00000514783KMT2Achr11

118355690

+FRYLchr4

48530355

-
intron-5UTRENST00000420751ENST00000507873KMT2Achr11

118355690

+FRYLchr4

48530355

-
intron-intronENST00000420751ENST00000506685KMT2Achr11

118355690

+FRYLchr4

48530355

-
intron-intronENST00000534358ENST00000503238KMT2Achr11

118358019

+FRYLchr4

48531751

-
intron-intronENST00000534358ENST00000358350KMT2Achr11

118358019

+FRYLchr4

48531751

-
intron-intronENST00000534358ENST00000537810KMT2Achr11

118358019

+FRYLchr4

48531751

-
intron-intronENST00000534358ENST00000264319KMT2Achr11

118358019

+FRYLchr4

48531751

-
intron-intronENST00000534358ENST00000507711KMT2Achr11

118358019

+FRYLchr4

48531751

-
intron-intronENST00000534358ENST00000514783KMT2Achr11

118358019

+FRYLchr4

48531751

-
intron-intronENST00000534358ENST00000507873KMT2Achr11

118358019

+FRYLchr4

48531751

-
intron-intronENST00000534358ENST00000506685KMT2Achr11

118358019

+FRYLchr4

48531751

-
intron-intronENST00000389506ENST00000503238KMT2Achr11

118358019

+FRYLchr4

48531751

-
intron-intronENST00000389506ENST00000358350KMT2Achr11

118358019

+FRYLchr4

48531751

-
intron-intronENST00000389506ENST00000537810KMT2Achr11

118358019

+FRYLchr4

48531751

-
intron-intronENST00000389506ENST00000264319KMT2Achr11

118358019

+FRYLchr4

48531751

-
intron-intronENST00000389506ENST00000507711KMT2Achr11

118358019

+FRYLchr4

48531751

-
intron-intronENST00000389506ENST00000514783KMT2Achr11

118358019

+FRYLchr4

48531751

-
intron-intronENST00000389506ENST00000507873KMT2Achr11

118358019

+FRYLchr4

48531751

-
intron-intronENST00000389506ENST00000506685KMT2Achr11

118358019

+FRYLchr4

48531751

-
intron-intronENST00000354520ENST00000503238KMT2Achr11

118358019

+FRYLchr4

48531751

-
intron-intronENST00000354520ENST00000358350KMT2Achr11

118358019

+FRYLchr4

48531751

-
intron-intronENST00000354520ENST00000537810KMT2Achr11

118358019

+FRYLchr4

48531751

-
intron-intronENST00000354520ENST00000264319KMT2Achr11

118358019

+FRYLchr4

48531751

-
intron-intronENST00000354520ENST00000507711KMT2Achr11

118358019

+FRYLchr4

48531751

-
intron-intronENST00000354520ENST00000514783KMT2Achr11

118358019

+FRYLchr4

48531751

-
intron-intronENST00000354520ENST00000507873KMT2Achr11

118358019

+FRYLchr4

48531751

-
intron-intronENST00000354520ENST00000506685KMT2Achr11

118358019

+FRYLchr4

48531751

-
intron-intronENST00000420751ENST00000503238KMT2Achr11

118358019

+FRYLchr4

48531751

-
intron-intronENST00000420751ENST00000358350KMT2Achr11

118358019

+FRYLchr4

48531751

-
intron-intronENST00000420751ENST00000537810KMT2Achr11

118358019

+FRYLchr4

48531751

-
intron-intronENST00000420751ENST00000264319KMT2Achr11

118358019

+FRYLchr4

48531751

-
intron-intronENST00000420751ENST00000507711KMT2Achr11

118358019

+FRYLchr4

48531751

-
intron-intronENST00000420751ENST00000514783KMT2Achr11

118358019

+FRYLchr4

48531751

-
intron-intronENST00000420751ENST00000507873KMT2Achr11

118358019

+FRYLchr4

48531751

-
intron-intronENST00000420751ENST00000506685KMT2Achr11

118358019

+FRYLchr4

48531751

-

Top

FusionProtFeatures for KMT2A_FRYL


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
KMT2A

Q03164

FRYL

O94915

Plays a key role in maintaining the integrity ofpolarized cell extensions during morphogenesis, regulates theactin cytoskeleton and plays a key role in patterning sensoryneuron dendritic fields by promoting avoidance between homologousdendrites as well as by limiting dendritic branching (Bysimilarity). May function as a transcriptional activator.{ECO:0000250, ECO:0000269|PubMed:16061630}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneKMT2Achr11:118355029chr4:48530355ENST00000354520+935137_14314063932Compositional biasNote=Poly-Gly
HgeneKMT2Achr11:118355029chr4:48530355ENST00000354520+93517_10214063932Compositional biasNote=Ala/Gly/Ser-rich
HgeneKMT2Achr11:118355029chr4:48530355ENST00000354520+935561_56414063932Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118355029chr4:48530355ENST00000354520+935568_57114063932Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118355029chr4:48530355ENST00000389506+936137_14314063970Compositional biasNote=Poly-Gly
HgeneKMT2Achr11:118355029chr4:48530355ENST00000389506+93617_10214063970Compositional biasNote=Ala/Gly/Ser-rich
HgeneKMT2Achr11:118355029chr4:48530355ENST00000389506+936561_56414063970Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118355029chr4:48530355ENST00000389506+936568_57114063970Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118355029chr4:48530355ENST00000534358+936137_14314063973Compositional biasNote=Poly-Gly
HgeneKMT2Achr11:118355029chr4:48530355ENST00000534358+93617_10214063973Compositional biasNote=Ala/Gly/Ser-rich
HgeneKMT2Achr11:118355029chr4:48530355ENST00000534358+936561_56414063973Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118355029chr4:48530355ENST00000534358+936568_57114063973Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118355690chr4:48530355ENST00000389506+1036137_14314443970Compositional biasNote=Poly-Gly
HgeneKMT2Achr11:118355690chr4:48530355ENST00000389506+103617_10214443970Compositional biasNote=Ala/Gly/Ser-rich
HgeneKMT2Achr11:118355690chr4:48530355ENST00000389506+1036561_56414443970Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118355690chr4:48530355ENST00000389506+1036568_57114443970Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118355690chr4:48530355ENST00000534358+1036137_14314443973Compositional biasNote=Poly-Gly
HgeneKMT2Achr11:118355690chr4:48530355ENST00000534358+103617_10214443973Compositional biasNote=Ala/Gly/Ser-rich
HgeneKMT2Achr11:118355690chr4:48530355ENST00000534358+1036561_56414443973Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118355690chr4:48530355ENST00000534358+1036568_57114443973Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118355029chr4:48530355ENST00000354520+935169_18014063932DNA bindingNote=A.T hook 1
HgeneKMT2Achr11:118355029chr4:48530355ENST00000354520+935217_22714063932DNA bindingNote=A.T hook 2
HgeneKMT2Achr11:118355029chr4:48530355ENST00000354520+935301_30914063932DNA bindingNote=A.T hook 3
HgeneKMT2Achr11:118355029chr4:48530355ENST00000389506+936169_18014063970DNA bindingNote=A.T hook 1
HgeneKMT2Achr11:118355029chr4:48530355ENST00000389506+936217_22714063970DNA bindingNote=A.T hook 2
HgeneKMT2Achr11:118355029chr4:48530355ENST00000389506+936301_30914063970DNA bindingNote=A.T hook 3
HgeneKMT2Achr11:118355029chr4:48530355ENST00000534358+936169_18014063973DNA bindingNote=A.T hook 1
HgeneKMT2Achr11:118355029chr4:48530355ENST00000534358+936217_22714063973DNA bindingNote=A.T hook 2
HgeneKMT2Achr11:118355029chr4:48530355ENST00000534358+936301_30914063973DNA bindingNote=A.T hook 3
HgeneKMT2Achr11:118355690chr4:48530355ENST00000389506+1036169_18014443970DNA bindingNote=A.T hook 1
HgeneKMT2Achr11:118355690chr4:48530355ENST00000389506+1036217_22714443970DNA bindingNote=A.T hook 2
HgeneKMT2Achr11:118355690chr4:48530355ENST00000389506+1036301_30914443970DNA bindingNote=A.T hook 3
HgeneKMT2Achr11:118355690chr4:48530355ENST00000534358+1036169_18014443973DNA bindingNote=A.T hook 1
HgeneKMT2Achr11:118355690chr4:48530355ENST00000534358+1036217_22714443973DNA bindingNote=A.T hook 2
HgeneKMT2Achr11:118355690chr4:48530355ENST00000534358+1036301_30914443973DNA bindingNote=A.T hook 3
HgeneKMT2Achr11:118355029chr4:48530355ENST00000354520+9351147_119514063932Zinc fingerCXXC-type
HgeneKMT2Achr11:118355029chr4:48530355ENST00000389506+9361147_119514063970Zinc fingerCXXC-type
HgeneKMT2Achr11:118355029chr4:48530355ENST00000534358+9361147_119514063973Zinc fingerCXXC-type
HgeneKMT2Achr11:118355690chr4:48530355ENST00000389506+10361147_119514443970Zinc fingerCXXC-type
HgeneKMT2Achr11:118355690chr4:48530355ENST00000534358+10361147_119514443973Zinc fingerCXXC-type

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneKMT2Achr11:118355690chr4:48530355ENST00000354520+135137_14303932Compositional biasNote=Poly-Gly
HgeneKMT2Achr11:118355690chr4:48530355ENST00000354520+13517_10203932Compositional biasNote=Ala/Gly/Ser-rich
HgeneKMT2Achr11:118355690chr4:48530355ENST00000354520+135561_56403932Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118355690chr4:48530355ENST00000354520+135568_57103932Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118355690chr4:48530355ENST00000354520+135169_18003932DNA bindingNote=A.T hook 1
HgeneKMT2Achr11:118355690chr4:48530355ENST00000354520+135217_22703932DNA bindingNote=A.T hook 2
HgeneKMT2Achr11:118355690chr4:48530355ENST00000354520+135301_30903932DNA bindingNote=A.T hook 3
HgeneKMT2Achr11:118355029chr4:48530355ENST00000354520+9351703_174814063932DomainBromo%3B divergent
HgeneKMT2Achr11:118355029chr4:48530355ENST00000354520+9352018_207414063932DomainFYR N-terminal
HgeneKMT2Achr11:118355029chr4:48530355ENST00000354520+9353666_374714063932DomainFYR C-terminal
HgeneKMT2Achr11:118355029chr4:48530355ENST00000354520+9353829_394514063932DomainSET
HgeneKMT2Achr11:118355029chr4:48530355ENST00000354520+9353953_396914063932DomainPost-SET
HgeneKMT2Achr11:118355029chr4:48530355ENST00000389506+9361703_174814063970DomainBromo%3B divergent
HgeneKMT2Achr11:118355029chr4:48530355ENST00000389506+9362018_207414063970DomainFYR N-terminal
HgeneKMT2Achr11:118355029chr4:48530355ENST00000389506+9363666_374714063970DomainFYR C-terminal
HgeneKMT2Achr11:118355029chr4:48530355ENST00000389506+9363829_394514063970DomainSET
HgeneKMT2Achr11:118355029chr4:48530355ENST00000389506+9363953_396914063970DomainPost-SET
HgeneKMT2Achr11:118355029chr4:48530355ENST00000534358+9361703_174814063973DomainBromo%3B divergent
HgeneKMT2Achr11:118355029chr4:48530355ENST00000534358+9362018_207414063973DomainFYR N-terminal
HgeneKMT2Achr11:118355029chr4:48530355ENST00000534358+9363666_374714063973DomainFYR C-terminal
HgeneKMT2Achr11:118355029chr4:48530355ENST00000534358+9363829_394514063973DomainSET
HgeneKMT2Achr11:118355029chr4:48530355ENST00000534358+9363953_396914063973DomainPost-SET
HgeneKMT2Achr11:118355690chr4:48530355ENST00000354520+1351703_174803932DomainBromo%3B divergent
HgeneKMT2Achr11:118355690chr4:48530355ENST00000354520+1352018_207403932DomainFYR N-terminal
HgeneKMT2Achr11:118355690chr4:48530355ENST00000354520+1353666_374703932DomainFYR C-terminal
HgeneKMT2Achr11:118355690chr4:48530355ENST00000354520+1353829_394503932DomainSET
HgeneKMT2Achr11:118355690chr4:48530355ENST00000354520+1353953_396903932DomainPost-SET
HgeneKMT2Achr11:118355690chr4:48530355ENST00000389506+10361703_174814443970DomainBromo%3B divergent
HgeneKMT2Achr11:118355690chr4:48530355ENST00000389506+10362018_207414443970DomainFYR N-terminal
HgeneKMT2Achr11:118355690chr4:48530355ENST00000389506+10363666_374714443970DomainFYR C-terminal
HgeneKMT2Achr11:118355690chr4:48530355ENST00000389506+10363829_394514443970DomainSET
HgeneKMT2Achr11:118355690chr4:48530355ENST00000389506+10363953_396914443970DomainPost-SET
HgeneKMT2Achr11:118355690chr4:48530355ENST00000534358+10361703_174814443973DomainBromo%3B divergent
HgeneKMT2Achr11:118355690chr4:48530355ENST00000534358+10362018_207414443973DomainFYR N-terminal
HgeneKMT2Achr11:118355690chr4:48530355ENST00000534358+10363666_374714443973DomainFYR C-terminal
HgeneKMT2Achr11:118355690chr4:48530355ENST00000534358+10363829_394514443973DomainSET
HgeneKMT2Achr11:118355690chr4:48530355ENST00000534358+10363953_396914443973DomainPost-SET
HgeneKMT2Achr11:118355029chr4:48530355ENST00000354520+9353906_390714063932RegionS-adenosyl-L-methionine binding
HgeneKMT2Achr11:118355029chr4:48530355ENST00000389506+9363906_390714063970RegionS-adenosyl-L-methionine binding
HgeneKMT2Achr11:118355029chr4:48530355ENST00000534358+9363906_390714063973RegionS-adenosyl-L-methionine binding
HgeneKMT2Achr11:118355690chr4:48530355ENST00000354520+1353906_390703932RegionS-adenosyl-L-methionine binding
HgeneKMT2Achr11:118355690chr4:48530355ENST00000389506+10363906_390714443970RegionS-adenosyl-L-methionine binding
HgeneKMT2Achr11:118355690chr4:48530355ENST00000534358+10363906_390714443973RegionS-adenosyl-L-methionine binding
HgeneKMT2Achr11:118355029chr4:48530355ENST00000354520+9351431_148214063932Zinc fingerPHD-type 1
HgeneKMT2Achr11:118355029chr4:48530355ENST00000354520+9351479_153314063932Zinc fingerPHD-type 2
HgeneKMT2Achr11:118355029chr4:48530355ENST00000354520+9351566_162714063932Zinc fingerPHD-type 3
HgeneKMT2Achr11:118355029chr4:48530355ENST00000354520+9351870_191014063932Zinc fingerC2HC pre-PHD-type
HgeneKMT2Achr11:118355029chr4:48530355ENST00000354520+9351931_197814063932Zinc fingerPHD-type 4
HgeneKMT2Achr11:118355029chr4:48530355ENST00000389506+9361431_148214063970Zinc fingerPHD-type 1
HgeneKMT2Achr11:118355029chr4:48530355ENST00000389506+9361479_153314063970Zinc fingerPHD-type 2
HgeneKMT2Achr11:118355029chr4:48530355ENST00000389506+9361566_162714063970Zinc fingerPHD-type 3
HgeneKMT2Achr11:118355029chr4:48530355ENST00000389506+9361870_191014063970Zinc fingerC2HC pre-PHD-type
HgeneKMT2Achr11:118355029chr4:48530355ENST00000389506+9361931_197814063970Zinc fingerPHD-type 4
HgeneKMT2Achr11:118355029chr4:48530355ENST00000534358+9361431_148214063973Zinc fingerPHD-type 1
HgeneKMT2Achr11:118355029chr4:48530355ENST00000534358+9361479_153314063973Zinc fingerPHD-type 2
HgeneKMT2Achr11:118355029chr4:48530355ENST00000534358+9361566_162714063973Zinc fingerPHD-type 3
HgeneKMT2Achr11:118355029chr4:48530355ENST00000534358+9361870_191014063973Zinc fingerC2HC pre-PHD-type
HgeneKMT2Achr11:118355029chr4:48530355ENST00000534358+9361931_197814063973Zinc fingerPHD-type 4
HgeneKMT2Achr11:118355690chr4:48530355ENST00000354520+1351147_119503932Zinc fingerCXXC-type
HgeneKMT2Achr11:118355690chr4:48530355ENST00000354520+1351431_148203932Zinc fingerPHD-type 1
HgeneKMT2Achr11:118355690chr4:48530355ENST00000354520+1351479_153303932Zinc fingerPHD-type 2
HgeneKMT2Achr11:118355690chr4:48530355ENST00000354520+1351566_162703932Zinc fingerPHD-type 3
HgeneKMT2Achr11:118355690chr4:48530355ENST00000354520+1351870_191003932Zinc fingerC2HC pre-PHD-type
HgeneKMT2Achr11:118355690chr4:48530355ENST00000354520+1351931_197803932Zinc fingerPHD-type 4
HgeneKMT2Achr11:118355690chr4:48530355ENST00000389506+10361431_148214443970Zinc fingerPHD-type 1
HgeneKMT2Achr11:118355690chr4:48530355ENST00000389506+10361479_153314443970Zinc fingerPHD-type 2
HgeneKMT2Achr11:118355690chr4:48530355ENST00000389506+10361566_162714443970Zinc fingerPHD-type 3
HgeneKMT2Achr11:118355690chr4:48530355ENST00000389506+10361870_191014443970Zinc fingerC2HC pre-PHD-type
HgeneKMT2Achr11:118355690chr4:48530355ENST00000389506+10361931_197814443970Zinc fingerPHD-type 4
HgeneKMT2Achr11:118355690chr4:48530355ENST00000534358+10361431_148214443973Zinc fingerPHD-type 1
HgeneKMT2Achr11:118355690chr4:48530355ENST00000534358+10361479_153314443973Zinc fingerPHD-type 2
HgeneKMT2Achr11:118355690chr4:48530355ENST00000534358+10361566_162714443973Zinc fingerPHD-type 3
HgeneKMT2Achr11:118355690chr4:48530355ENST00000534358+10361870_191014443973Zinc fingerC2HC pre-PHD-type
HgeneKMT2Achr11:118355690chr4:48530355ENST00000534358+10361931_197814443973Zinc fingerPHD-type 4


Top

FusionGeneSequence for KMT2A_FRYL


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_KMT2A_ENST00000534358_chr11_118355029_+_FRYL_ENST00000503238_chr4_48530355_-_2119aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDYDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRYSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKYAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALYPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKTPIIGNKYGDQHSAAGRNGKPKVIAVTRSTSSTS
SGSNSNALVPVSWKRPQLSQRRTREKLMNVLSLCGPESGLPKNPSVVFSSNEDLEVGDQQTSLISTTEDINQEEEVAVEDNSSEQQFGVF
KDFDFLDVELEDAEGESMDNFNWGVRRRSLDSIDKGDTPSLQEYQCSSSTPSLNLTNQEDTDESSEEEAALTASQILSRTQMLNSDSATD
ETIPDHPDLLLQSEDSTGSITTEEVLQIRDETPTLEASLDNANSRLPEDTTSVLKEEHVTTFEDEGSYIIQEQQESLVCQGILDLEETEM
PEPLAPESYPESVCEEDVTLALKELDERCEEEEADFSGLSSQDEEEQDGFPEVQTSPLPSPFLSAIIAAFQPVAYDDEEEAWRCHVNQML
SDTDGSSAVFTFHVFSRLFQTIQRKFGEITNEAVSFLGDSLQRIGTKFKSSLEVMMLCSECPTVFVDAETLMSCGLLETLKFGVLELQEH
LDTYNVKREAAEQWLDDCKRTFGAKEDMYRINTDAQQMEILAELELCRRLYKLHFQLLLLFQAYCKLINQVNTIKNEAEVINMSEELAQL
ESILKEAESASENEEIDISKAAQTTIETAIHSLIETLKNKEFISAVAQVKAFRSLWPSDIFGSCEDDPVQTLLHIYFHHQTLGQTGSFAV

>In-frame_KMT2A_ENST00000534358_chr11_118355029_+_FRYL_ENST00000358350_chr4_48530355_-_2119aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDYDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRYSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKYAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALYPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKTPIIGNKYGDQHSAAGRNGKPKVIAVTRSTSSTS
SGSNSNALVPVSWKRPQLSQRRTREKLMNVLSLCGPESGLPKNPSVVFSSNEDLEVGDQQTSLISTTEDINQEEEVAVEDNSSEQQFGVF
KDFDFLDVELEDAEGESMDNFNWGVRRRSLDSIDKGDTPSLQEYQCSSSTPSLNLTNQEDTDESSEEEAALTASQILSRTQMLNSDSATD
ETIPDHPDLLLQSEDSTGSITTEEVLQIRDETPTLEASLDNANSRLPEDTTSVLKEEHVTTFEDEGSYIIQEQQESLVCQGILDLEETEM
PEPLAPESYPESVCEEDVTLALKELDERCEEEEADFSGLSSQDEEEQDGFPEVQTSPLPSPFLSAIIAAFQPVAYDDEEEAWRCHVNQML
SDTDGSSAVFTFHVFSRLFQTIQRKFGEITNEAVSFLGDSLQRIGTKFKSSLEVMMLCSECPTVFVDAETLMSCGLLETLKFGVLELQEH
LDTYNVKREAAEQWLDDCKRTFGAKEDMYRINTDAQQMEILAELELCRRLYKLHFQLLLLFQAYCKLINQVNTIKNEAEVINMSEELAQL
ESILKEAESASENEEIDISKAAQTTIETAIHSLIETLKNKEFISAVAQVKAFRSLWPSDIFGSCEDDPVQTLLHIYFHHQTLGQTGSFAV

>In-frame_KMT2A_ENST00000534358_chr11_118355029_+_FRYL_ENST00000537810_chr4_48530355_-_2119aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDYDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRYSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKYAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALYPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKTPIIGNKYGDQHSAAGRNGKPKVIAVTRSTSSTS
SGSNSNALVPVSWKRPQLSQRRTREKLMNVLSLCGPESGLPKNPSVVFSSNEDLEVGDQQTSLISTTEDINQEEEVAVEDNSSEQQFGVF
KDFDFLDVELEDAEGESMDNFNWGVRRRSLDSIDKGDTPSLQEYQCSSSTPSLNLTNQEDTDESSEEEAALTASQILSRTQMLNSDSATD
ETIPDHPDLLLQSEDSTGSITTEEVLQIRDETPTLEASLDNANSRLPEDTTSVLKEEHVTTFEDEGSYIIQEQQESLVCQGILDLEETEM
PEPLAPESYPESVCEEDVTLALKELDERCEEEEADFSGLSSQDEEEQDGFPEVQTSPLPSPFLSAIIAAFQPVAYDDEEEAWRCHVNQML
SDTDGSSAVFTFHVFSRLFQTIQRKFGEITNEAVSFLGDSLQRIGTKFKSSLEVMMLCSECPTVFVDAETLMSCGLLETLKFGVLELQEH
LDTYNVKREAAEQWLDDCKRTFGAKEDMYRINTDAQLNEILVELELCRRLYKLHFQLLLLFQAYCKLINQVNTIKNEAEVINMSEELAQL
ESILKEAESASENEEIDISKAAQTTIETAIHSLIETLKNKEFISAVAQVKAFRSLWPSDIFGSCEDDPVQTLLHIYFHHQTLGQTGSFAV

>In-frame_KMT2A_ENST00000389506_chr11_118355029_+_FRYL_ENST00000503238_chr4_48530355_-_2119aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDYDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRYSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKYAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALYPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKTPIIGNKYGDQHSAAGRNGKPKVIAVTRSTSSTS
SGSNSNALVPVSWKRPQLSQRRTREKLMNVLSLCGPESGLPKNPSVVFSSNEDLEVGDQQTSLISTTEDINQEEEVAVEDNSSEQQFGVF
KDFDFLDVELEDAEGESMDNFNWGVRRRSLDSIDKGDTPSLQEYQCSSSTPSLNLTNQEDTDESSEEEAALTASQILSRTQMLNSDSATD
ETIPDHPDLLLQSEDSTGSITTEEVLQIRDETPTLEASLDNANSRLPEDTTSVLKEEHVTTFEDEGSYIIQEQQESLVCQGILDLEETEM
PEPLAPESYPESVCEEDVTLALKELDERCEEEEADFSGLSSQDEEEQDGFPEVQTSPLPSPFLSAIIAAFQPVAYDDEEEAWRCHVNQML
SDTDGSSAVFTFHVFSRLFQTIQRKFGEITNEAVSFLGDSLQRIGTKFKSSLEVMMLCSECPTVFVDAETLMSCGLLETLKFGVLELQEH
LDTYNVKREAAEQWLDDCKRTFGAKEDMYRINTDAQQMEILAELELCRRLYKLHFQLLLLFQAYCKLINQVNTIKNEAEVINMSEELAQL
ESILKEAESASENEEIDISKAAQTTIETAIHSLIETLKNKEFISAVAQVKAFRSLWPSDIFGSCEDDPVQTLLHIYFHHQTLGQTGSFAV

>In-frame_KMT2A_ENST00000389506_chr11_118355029_+_FRYL_ENST00000358350_chr4_48530355_-_2119aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDYDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRYSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKYAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALYPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKTPIIGNKYGDQHSAAGRNGKPKVIAVTRSTSSTS
SGSNSNALVPVSWKRPQLSQRRTREKLMNVLSLCGPESGLPKNPSVVFSSNEDLEVGDQQTSLISTTEDINQEEEVAVEDNSSEQQFGVF
KDFDFLDVELEDAEGESMDNFNWGVRRRSLDSIDKGDTPSLQEYQCSSSTPSLNLTNQEDTDESSEEEAALTASQILSRTQMLNSDSATD
ETIPDHPDLLLQSEDSTGSITTEEVLQIRDETPTLEASLDNANSRLPEDTTSVLKEEHVTTFEDEGSYIIQEQQESLVCQGILDLEETEM
PEPLAPESYPESVCEEDVTLALKELDERCEEEEADFSGLSSQDEEEQDGFPEVQTSPLPSPFLSAIIAAFQPVAYDDEEEAWRCHVNQML
SDTDGSSAVFTFHVFSRLFQTIQRKFGEITNEAVSFLGDSLQRIGTKFKSSLEVMMLCSECPTVFVDAETLMSCGLLETLKFGVLELQEH
LDTYNVKREAAEQWLDDCKRTFGAKEDMYRINTDAQQMEILAELELCRRLYKLHFQLLLLFQAYCKLINQVNTIKNEAEVINMSEELAQL
ESILKEAESASENEEIDISKAAQTTIETAIHSLIETLKNKEFISAVAQVKAFRSLWPSDIFGSCEDDPVQTLLHIYFHHQTLGQTGSFAV

>In-frame_KMT2A_ENST00000389506_chr11_118355029_+_FRYL_ENST00000537810_chr4_48530355_-_2119aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDYDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRYSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKYAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALYPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKTPIIGNKYGDQHSAAGRNGKPKVIAVTRSTSSTS
SGSNSNALVPVSWKRPQLSQRRTREKLMNVLSLCGPESGLPKNPSVVFSSNEDLEVGDQQTSLISTTEDINQEEEVAVEDNSSEQQFGVF
KDFDFLDVELEDAEGESMDNFNWGVRRRSLDSIDKGDTPSLQEYQCSSSTPSLNLTNQEDTDESSEEEAALTASQILSRTQMLNSDSATD
ETIPDHPDLLLQSEDSTGSITTEEVLQIRDETPTLEASLDNANSRLPEDTTSVLKEEHVTTFEDEGSYIIQEQQESLVCQGILDLEETEM
PEPLAPESYPESVCEEDVTLALKELDERCEEEEADFSGLSSQDEEEQDGFPEVQTSPLPSPFLSAIIAAFQPVAYDDEEEAWRCHVNQML
SDTDGSSAVFTFHVFSRLFQTIQRKFGEITNEAVSFLGDSLQRIGTKFKSSLEVMMLCSECPTVFVDAETLMSCGLLETLKFGVLELQEH
LDTYNVKREAAEQWLDDCKRTFGAKEDMYRINTDAQLNEILVELELCRRLYKLHFQLLLLFQAYCKLINQVNTIKNEAEVINMSEELAQL
ESILKEAESASENEEIDISKAAQTTIETAIHSLIETLKNKEFISAVAQVKAFRSLWPSDIFGSCEDDPVQTLLHIYFHHQTLGQTGSFAV

>In-frame_KMT2A_ENST00000354520_chr11_118355029_+_FRYL_ENST00000503238_chr4_48530355_-_2119aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDYDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRYSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKYAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALYPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKTPIIGNKYGDQHSAAGRNGKPKVIAVTRSTSSTS
SGSNSNALVPVSWKRPQLSQRRTREKLMNVLSLCGPESGLPKNPSVVFSSNEDLEVGDQQTSLISTTEDINQEEEVAVEDNSSEQQFGVF
KDFDFLDVELEDAEGESMDNFNWGVRRRSLDSIDKGDTPSLQEYQCSSSTPSLNLTNQEDTDESSEEEAALTASQILSRTQMLNSDSATD
ETIPDHPDLLLQSEDSTGSITTEEVLQIRDETPTLEASLDNANSRLPEDTTSVLKEEHVTTFEDEGSYIIQEQQESLVCQGILDLEETEM
PEPLAPESYPESVCEEDVTLALKELDERCEEEEADFSGLSSQDEEEQDGFPEVQTSPLPSPFLSAIIAAFQPVAYDDEEEAWRCHVNQML
SDTDGSSAVFTFHVFSRLFQTIQRKFGEITNEAVSFLGDSLQRIGTKFKSSLEVMMLCSECPTVFVDAETLMSCGLLETLKFGVLELQEH
LDTYNVKREAAEQWLDDCKRTFGAKEDMYRINTDAQQMEILAELELCRRLYKLHFQLLLLFQAYCKLINQVNTIKNEAEVINMSEELAQL
ESILKEAESASENEEIDISKAAQTTIETAIHSLIETLKNKEFISAVAQVKAFRSLWPSDIFGSCEDDPVQTLLHIYFHHQTLGQTGSFAV

>In-frame_KMT2A_ENST00000354520_chr11_118355029_+_FRYL_ENST00000358350_chr4_48530355_-_2119aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDYDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRYSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKYAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALYPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKTPIIGNKYGDQHSAAGRNGKPKVIAVTRSTSSTS
SGSNSNALVPVSWKRPQLSQRRTREKLMNVLSLCGPESGLPKNPSVVFSSNEDLEVGDQQTSLISTTEDINQEEEVAVEDNSSEQQFGVF
KDFDFLDVELEDAEGESMDNFNWGVRRRSLDSIDKGDTPSLQEYQCSSSTPSLNLTNQEDTDESSEEEAALTASQILSRTQMLNSDSATD
ETIPDHPDLLLQSEDSTGSITTEEVLQIRDETPTLEASLDNANSRLPEDTTSVLKEEHVTTFEDEGSYIIQEQQESLVCQGILDLEETEM
PEPLAPESYPESVCEEDVTLALKELDERCEEEEADFSGLSSQDEEEQDGFPEVQTSPLPSPFLSAIIAAFQPVAYDDEEEAWRCHVNQML
SDTDGSSAVFTFHVFSRLFQTIQRKFGEITNEAVSFLGDSLQRIGTKFKSSLEVMMLCSECPTVFVDAETLMSCGLLETLKFGVLELQEH
LDTYNVKREAAEQWLDDCKRTFGAKEDMYRINTDAQQMEILAELELCRRLYKLHFQLLLLFQAYCKLINQVNTIKNEAEVINMSEELAQL
ESILKEAESASENEEIDISKAAQTTIETAIHSLIETLKNKEFISAVAQVKAFRSLWPSDIFGSCEDDPVQTLLHIYFHHQTLGQTGSFAV

>In-frame_KMT2A_ENST00000354520_chr11_118355029_+_FRYL_ENST00000537810_chr4_48530355_-_2119aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDYDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRYSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKYAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALYPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKTPIIGNKYGDQHSAAGRNGKPKVIAVTRSTSSTS
SGSNSNALVPVSWKRPQLSQRRTREKLMNVLSLCGPESGLPKNPSVVFSSNEDLEVGDQQTSLISTTEDINQEEEVAVEDNSSEQQFGVF
KDFDFLDVELEDAEGESMDNFNWGVRRRSLDSIDKGDTPSLQEYQCSSSTPSLNLTNQEDTDESSEEEAALTASQILSRTQMLNSDSATD
ETIPDHPDLLLQSEDSTGSITTEEVLQIRDETPTLEASLDNANSRLPEDTTSVLKEEHVTTFEDEGSYIIQEQQESLVCQGILDLEETEM
PEPLAPESYPESVCEEDVTLALKELDERCEEEEADFSGLSSQDEEEQDGFPEVQTSPLPSPFLSAIIAAFQPVAYDDEEEAWRCHVNQML
SDTDGSSAVFTFHVFSRLFQTIQRKFGEITNEAVSFLGDSLQRIGTKFKSSLEVMMLCSECPTVFVDAETLMSCGLLETLKFGVLELQEH
LDTYNVKREAAEQWLDDCKRTFGAKEDMYRINTDAQLNEILVELELCRRLYKLHFQLLLLFQAYCKLINQVNTIKNEAEVINMSEELAQL
ESILKEAESASENEEIDISKAAQTTIETAIHSLIETLKNKEFISAVAQVKAFRSLWPSDIFGSCEDDPVQTLLHIYFHHQTLGQTGSFAV

>In-frame_KMT2A_ENST00000534358_chr11_118355029_+_FRYL_ENST00000503238_chr4_48530355_-_2119aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDYDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRYSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKYAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALYPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKTPIIGNKYGDQHSAAGRNGKPKVIAVTRSTSSTS
SGSNSNALVPVSWKRPQLSQRRTREKLMNVLSLCGPESGLPKNPSVVFSSNEDLEVGDQQTSLISTTEDINQEEEVAVEDNSSEQQFGVF
KDFDFLDVELEDAEGESMDNFNWGVRRRSLDSIDKGDTPSLQEYQCSSSTPSLNLTNQEDTDESSEEEAALTASQILSRTQMLNSDSATD
ETIPDHPDLLLQSEDSTGSITTEEVLQIRDETPTLEASLDNANSRLPEDTTSVLKEEHVTTFEDEGSYIIQEQQESLVCQGILDLEETEM
PEPLAPESYPESVCEEDVTLALKELDERCEEEEADFSGLSSQDEEEQDGFPEVQTSPLPSPFLSAIIAAFQPVAYDDEEEAWRCHVNQML
SDTDGSSAVFTFHVFSRLFQTIQRKFGEITNEAVSFLGDSLQRIGTKFKSSLEVMMLCSECPTVFVDAETLMSCGLLETLKFGVLELQEH
LDTYNVKREAAEQWLDDCKRTFGAKEDMYRINTDAQQMEILAELELCRRLYKLHFQLLLLFQAYCKLINQVNTIKNEAEVINMSEELAQL
ESILKEAESASENEEIDISKAAQTTIETAIHSLIETLKNKEFISAVAQVKAFRSLWPSDIFGSCEDDPVQTLLHIYFHHQTLGQTGSFAV

>In-frame_KMT2A_ENST00000534358_chr11_118355029_+_FRYL_ENST00000358350_chr4_48530355_-_2119aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDYDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRYSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKYAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALYPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKTPIIGNKYGDQHSAAGRNGKPKVIAVTRSTSSTS
SGSNSNALVPVSWKRPQLSQRRTREKLMNVLSLCGPESGLPKNPSVVFSSNEDLEVGDQQTSLISTTEDINQEEEVAVEDNSSEQQFGVF
KDFDFLDVELEDAEGESMDNFNWGVRRRSLDSIDKGDTPSLQEYQCSSSTPSLNLTNQEDTDESSEEEAALTASQILSRTQMLNSDSATD
ETIPDHPDLLLQSEDSTGSITTEEVLQIRDETPTLEASLDNANSRLPEDTTSVLKEEHVTTFEDEGSYIIQEQQESLVCQGILDLEETEM
PEPLAPESYPESVCEEDVTLALKELDERCEEEEADFSGLSSQDEEEQDGFPEVQTSPLPSPFLSAIIAAFQPVAYDDEEEAWRCHVNQML
SDTDGSSAVFTFHVFSRLFQTIQRKFGEITNEAVSFLGDSLQRIGTKFKSSLEVMMLCSECPTVFVDAETLMSCGLLETLKFGVLELQEH
LDTYNVKREAAEQWLDDCKRTFGAKEDMYRINTDAQQMEILAELELCRRLYKLHFQLLLLFQAYCKLINQVNTIKNEAEVINMSEELAQL
ESILKEAESASENEEIDISKAAQTTIETAIHSLIETLKNKEFISAVAQVKAFRSLWPSDIFGSCEDDPVQTLLHIYFHHQTLGQTGSFAV

>In-frame_KMT2A_ENST00000534358_chr11_118355029_+_FRYL_ENST00000537810_chr4_48530355_-_2119aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDYDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRYSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKYAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALYPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKTPIIGNKYGDQHSAAGRNGKPKVIAVTRSTSSTS
SGSNSNALVPVSWKRPQLSQRRTREKLMNVLSLCGPESGLPKNPSVVFSSNEDLEVGDQQTSLISTTEDINQEEEVAVEDNSSEQQFGVF
KDFDFLDVELEDAEGESMDNFNWGVRRRSLDSIDKGDTPSLQEYQCSSSTPSLNLTNQEDTDESSEEEAALTASQILSRTQMLNSDSATD
ETIPDHPDLLLQSEDSTGSITTEEVLQIRDETPTLEASLDNANSRLPEDTTSVLKEEHVTTFEDEGSYIIQEQQESLVCQGILDLEETEM
PEPLAPESYPESVCEEDVTLALKELDERCEEEEADFSGLSSQDEEEQDGFPEVQTSPLPSPFLSAIIAAFQPVAYDDEEEAWRCHVNQML
SDTDGSSAVFTFHVFSRLFQTIQRKFGEITNEAVSFLGDSLQRIGTKFKSSLEVMMLCSECPTVFVDAETLMSCGLLETLKFGVLELQEH
LDTYNVKREAAEQWLDDCKRTFGAKEDMYRINTDAQLNEILVELELCRRLYKLHFQLLLLFQAYCKLINQVNTIKNEAEVINMSEELAQL
ESILKEAESASENEEIDISKAAQTTIETAIHSLIETLKNKEFISAVAQVKAFRSLWPSDIFGSCEDDPVQTLLHIYFHHQTLGQTGSFAV

>In-frame_KMT2A_ENST00000389506_chr11_118355029_+_FRYL_ENST00000503238_chr4_48530355_-_2119aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDYDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRYSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKYAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALYPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKTPIIGNKYGDQHSAAGRNGKPKVIAVTRSTSSTS
SGSNSNALVPVSWKRPQLSQRRTREKLMNVLSLCGPESGLPKNPSVVFSSNEDLEVGDQQTSLISTTEDINQEEEVAVEDNSSEQQFGVF
KDFDFLDVELEDAEGESMDNFNWGVRRRSLDSIDKGDTPSLQEYQCSSSTPSLNLTNQEDTDESSEEEAALTASQILSRTQMLNSDSATD
ETIPDHPDLLLQSEDSTGSITTEEVLQIRDETPTLEASLDNANSRLPEDTTSVLKEEHVTTFEDEGSYIIQEQQESLVCQGILDLEETEM
PEPLAPESYPESVCEEDVTLALKELDERCEEEEADFSGLSSQDEEEQDGFPEVQTSPLPSPFLSAIIAAFQPVAYDDEEEAWRCHVNQML
SDTDGSSAVFTFHVFSRLFQTIQRKFGEITNEAVSFLGDSLQRIGTKFKSSLEVMMLCSECPTVFVDAETLMSCGLLETLKFGVLELQEH
LDTYNVKREAAEQWLDDCKRTFGAKEDMYRINTDAQQMEILAELELCRRLYKLHFQLLLLFQAYCKLINQVNTIKNEAEVINMSEELAQL
ESILKEAESASENEEIDISKAAQTTIETAIHSLIETLKNKEFISAVAQVKAFRSLWPSDIFGSCEDDPVQTLLHIYFHHQTLGQTGSFAV

>In-frame_KMT2A_ENST00000389506_chr11_118355029_+_FRYL_ENST00000358350_chr4_48530355_-_2119aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDYDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRYSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKYAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALYPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKTPIIGNKYGDQHSAAGRNGKPKVIAVTRSTSSTS
SGSNSNALVPVSWKRPQLSQRRTREKLMNVLSLCGPESGLPKNPSVVFSSNEDLEVGDQQTSLISTTEDINQEEEVAVEDNSSEQQFGVF
KDFDFLDVELEDAEGESMDNFNWGVRRRSLDSIDKGDTPSLQEYQCSSSTPSLNLTNQEDTDESSEEEAALTASQILSRTQMLNSDSATD
ETIPDHPDLLLQSEDSTGSITTEEVLQIRDETPTLEASLDNANSRLPEDTTSVLKEEHVTTFEDEGSYIIQEQQESLVCQGILDLEETEM
PEPLAPESYPESVCEEDVTLALKELDERCEEEEADFSGLSSQDEEEQDGFPEVQTSPLPSPFLSAIIAAFQPVAYDDEEEAWRCHVNQML
SDTDGSSAVFTFHVFSRLFQTIQRKFGEITNEAVSFLGDSLQRIGTKFKSSLEVMMLCSECPTVFVDAETLMSCGLLETLKFGVLELQEH
LDTYNVKREAAEQWLDDCKRTFGAKEDMYRINTDAQQMEILAELELCRRLYKLHFQLLLLFQAYCKLINQVNTIKNEAEVINMSEELAQL
ESILKEAESASENEEIDISKAAQTTIETAIHSLIETLKNKEFISAVAQVKAFRSLWPSDIFGSCEDDPVQTLLHIYFHHQTLGQTGSFAV

>In-frame_KMT2A_ENST00000389506_chr11_118355029_+_FRYL_ENST00000537810_chr4_48530355_-_2119aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDYDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRYSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKYAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALYPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKTPIIGNKYGDQHSAAGRNGKPKVIAVTRSTSSTS
SGSNSNALVPVSWKRPQLSQRRTREKLMNVLSLCGPESGLPKNPSVVFSSNEDLEVGDQQTSLISTTEDINQEEEVAVEDNSSEQQFGVF
KDFDFLDVELEDAEGESMDNFNWGVRRRSLDSIDKGDTPSLQEYQCSSSTPSLNLTNQEDTDESSEEEAALTASQILSRTQMLNSDSATD
ETIPDHPDLLLQSEDSTGSITTEEVLQIRDETPTLEASLDNANSRLPEDTTSVLKEEHVTTFEDEGSYIIQEQQESLVCQGILDLEETEM
PEPLAPESYPESVCEEDVTLALKELDERCEEEEADFSGLSSQDEEEQDGFPEVQTSPLPSPFLSAIIAAFQPVAYDDEEEAWRCHVNQML
SDTDGSSAVFTFHVFSRLFQTIQRKFGEITNEAVSFLGDSLQRIGTKFKSSLEVMMLCSECPTVFVDAETLMSCGLLETLKFGVLELQEH
LDTYNVKREAAEQWLDDCKRTFGAKEDMYRINTDAQLNEILVELELCRRLYKLHFQLLLLFQAYCKLINQVNTIKNEAEVINMSEELAQL
ESILKEAESASENEEIDISKAAQTTIETAIHSLIETLKNKEFISAVAQVKAFRSLWPSDIFGSCEDDPVQTLLHIYFHHQTLGQTGSFAV

>In-frame_KMT2A_ENST00000354520_chr11_118355029_+_FRYL_ENST00000503238_chr4_48530355_-_2119aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDYDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRYSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKYAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALYPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKTPIIGNKYGDQHSAAGRNGKPKVIAVTRSTSSTS
SGSNSNALVPVSWKRPQLSQRRTREKLMNVLSLCGPESGLPKNPSVVFSSNEDLEVGDQQTSLISTTEDINQEEEVAVEDNSSEQQFGVF
KDFDFLDVELEDAEGESMDNFNWGVRRRSLDSIDKGDTPSLQEYQCSSSTPSLNLTNQEDTDESSEEEAALTASQILSRTQMLNSDSATD
ETIPDHPDLLLQSEDSTGSITTEEVLQIRDETPTLEASLDNANSRLPEDTTSVLKEEHVTTFEDEGSYIIQEQQESLVCQGILDLEETEM
PEPLAPESYPESVCEEDVTLALKELDERCEEEEADFSGLSSQDEEEQDGFPEVQTSPLPSPFLSAIIAAFQPVAYDDEEEAWRCHVNQML
SDTDGSSAVFTFHVFSRLFQTIQRKFGEITNEAVSFLGDSLQRIGTKFKSSLEVMMLCSECPTVFVDAETLMSCGLLETLKFGVLELQEH
LDTYNVKREAAEQWLDDCKRTFGAKEDMYRINTDAQQMEILAELELCRRLYKLHFQLLLLFQAYCKLINQVNTIKNEAEVINMSEELAQL
ESILKEAESASENEEIDISKAAQTTIETAIHSLIETLKNKEFISAVAQVKAFRSLWPSDIFGSCEDDPVQTLLHIYFHHQTLGQTGSFAV

>In-frame_KMT2A_ENST00000354520_chr11_118355029_+_FRYL_ENST00000358350_chr4_48530355_-_2119aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDYDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRYSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKYAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALYPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKTPIIGNKYGDQHSAAGRNGKPKVIAVTRSTSSTS
SGSNSNALVPVSWKRPQLSQRRTREKLMNVLSLCGPESGLPKNPSVVFSSNEDLEVGDQQTSLISTTEDINQEEEVAVEDNSSEQQFGVF
KDFDFLDVELEDAEGESMDNFNWGVRRRSLDSIDKGDTPSLQEYQCSSSTPSLNLTNQEDTDESSEEEAALTASQILSRTQMLNSDSATD
ETIPDHPDLLLQSEDSTGSITTEEVLQIRDETPTLEASLDNANSRLPEDTTSVLKEEHVTTFEDEGSYIIQEQQESLVCQGILDLEETEM
PEPLAPESYPESVCEEDVTLALKELDERCEEEEADFSGLSSQDEEEQDGFPEVQTSPLPSPFLSAIIAAFQPVAYDDEEEAWRCHVNQML
SDTDGSSAVFTFHVFSRLFQTIQRKFGEITNEAVSFLGDSLQRIGTKFKSSLEVMMLCSECPTVFVDAETLMSCGLLETLKFGVLELQEH
LDTYNVKREAAEQWLDDCKRTFGAKEDMYRINTDAQQMEILAELELCRRLYKLHFQLLLLFQAYCKLINQVNTIKNEAEVINMSEELAQL
ESILKEAESASENEEIDISKAAQTTIETAIHSLIETLKNKEFISAVAQVKAFRSLWPSDIFGSCEDDPVQTLLHIYFHHQTLGQTGSFAV

>In-frame_KMT2A_ENST00000354520_chr11_118355029_+_FRYL_ENST00000537810_chr4_48530355_-_2119aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDYDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRYSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKYAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALYPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKTPIIGNKYGDQHSAAGRNGKPKVIAVTRSTSSTS
SGSNSNALVPVSWKRPQLSQRRTREKLMNVLSLCGPESGLPKNPSVVFSSNEDLEVGDQQTSLISTTEDINQEEEVAVEDNSSEQQFGVF
KDFDFLDVELEDAEGESMDNFNWGVRRRSLDSIDKGDTPSLQEYQCSSSTPSLNLTNQEDTDESSEEEAALTASQILSRTQMLNSDSATD
ETIPDHPDLLLQSEDSTGSITTEEVLQIRDETPTLEASLDNANSRLPEDTTSVLKEEHVTTFEDEGSYIIQEQQESLVCQGILDLEETEM
PEPLAPESYPESVCEEDVTLALKELDERCEEEEADFSGLSSQDEEEQDGFPEVQTSPLPSPFLSAIIAAFQPVAYDDEEEAWRCHVNQML
SDTDGSSAVFTFHVFSRLFQTIQRKFGEITNEAVSFLGDSLQRIGTKFKSSLEVMMLCSECPTVFVDAETLMSCGLLETLKFGVLELQEH
LDTYNVKREAAEQWLDDCKRTFGAKEDMYRINTDAQLNEILVELELCRRLYKLHFQLLLLFQAYCKLINQVNTIKNEAEVINMSEELAQL
ESILKEAESASENEEIDISKAAQTTIETAIHSLIETLKNKEFISAVAQVKAFRSLWPSDIFGSCEDDPVQTLLHIYFHHQTLGQTGSFAV

>In-frame_KMT2A_ENST00000534358_chr11_118355690_+_FRYL_ENST00000503238_chr4_48530355_-_2157aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDYDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRYSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKYAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALYPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKEDCEAENVWEMGGLGILTSVPITPRVVCFLCASS
GHVETPIIGNKYGDQHSAAGRNGKPKVIAVTRSTSSTSSGSNSNALVPVSWKRPQLSQRRTREKLMNVLSLCGPESGLPKNPSVVFSSNE
DLEVGDQQTSLISTTEDINQEEEVAVEDNSSEQQFGVFKDFDFLDVELEDAEGESMDNFNWGVRRRSLDSIDKGDTPSLQEYQCSSSTPS
LNLTNQEDTDESSEEEAALTASQILSRTQMLNSDSATDETIPDHPDLLLQSEDSTGSITTEEVLQIRDETPTLEASLDNANSRLPEDTTS
VLKEEHVTTFEDEGSYIIQEQQESLVCQGILDLEETEMPEPLAPESYPESVCEEDVTLALKELDERCEEEEADFSGLSSQDEEEQDGFPE
VQTSPLPSPFLSAIIAAFQPVAYDDEEEAWRCHVNQMLSDTDGSSAVFTFHVFSRLFQTIQRKFGEITNEAVSFLGDSLQRIGTKFKSSL
EVMMLCSECPTVFVDAETLMSCGLLETLKFGVLELQEHLDTYNVKREAAEQWLDDCKRTFGAKEDMYRINTDAQQMEILAELELCRRLYK
LHFQLLLLFQAYCKLINQVNTIKNEAEVINMSEELAQLESILKEAESASENEEIDISKAAQTTIETAIHSLIETLKNKEFISAVAQVKAF

>In-frame_KMT2A_ENST00000534358_chr11_118355690_+_FRYL_ENST00000358350_chr4_48530355_-_2157aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDYDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRYSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKYAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALYPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKEDCEAENVWEMGGLGILTSVPITPRVVCFLCASS
GHVETPIIGNKYGDQHSAAGRNGKPKVIAVTRSTSSTSSGSNSNALVPVSWKRPQLSQRRTREKLMNVLSLCGPESGLPKNPSVVFSSNE
DLEVGDQQTSLISTTEDINQEEEVAVEDNSSEQQFGVFKDFDFLDVELEDAEGESMDNFNWGVRRRSLDSIDKGDTPSLQEYQCSSSTPS
LNLTNQEDTDESSEEEAALTASQILSRTQMLNSDSATDETIPDHPDLLLQSEDSTGSITTEEVLQIRDETPTLEASLDNANSRLPEDTTS
VLKEEHVTTFEDEGSYIIQEQQESLVCQGILDLEETEMPEPLAPESYPESVCEEDVTLALKELDERCEEEEADFSGLSSQDEEEQDGFPE
VQTSPLPSPFLSAIIAAFQPVAYDDEEEAWRCHVNQMLSDTDGSSAVFTFHVFSRLFQTIQRKFGEITNEAVSFLGDSLQRIGTKFKSSL
EVMMLCSECPTVFVDAETLMSCGLLETLKFGVLELQEHLDTYNVKREAAEQWLDDCKRTFGAKEDMYRINTDAQQMEILAELELCRRLYK
LHFQLLLLFQAYCKLINQVNTIKNEAEVINMSEELAQLESILKEAESASENEEIDISKAAQTTIETAIHSLIETLKNKEFISAVAQVKAF

>In-frame_KMT2A_ENST00000534358_chr11_118355690_+_FRYL_ENST00000537810_chr4_48530355_-_2157aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDYDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRYSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKYAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALYPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKEDCEAENVWEMGGLGILTSVPITPRVVCFLCASS
GHVETPIIGNKYGDQHSAAGRNGKPKVIAVTRSTSSTSSGSNSNALVPVSWKRPQLSQRRTREKLMNVLSLCGPESGLPKNPSVVFSSNE
DLEVGDQQTSLISTTEDINQEEEVAVEDNSSEQQFGVFKDFDFLDVELEDAEGESMDNFNWGVRRRSLDSIDKGDTPSLQEYQCSSSTPS
LNLTNQEDTDESSEEEAALTASQILSRTQMLNSDSATDETIPDHPDLLLQSEDSTGSITTEEVLQIRDETPTLEASLDNANSRLPEDTTS
VLKEEHVTTFEDEGSYIIQEQQESLVCQGILDLEETEMPEPLAPESYPESVCEEDVTLALKELDERCEEEEADFSGLSSQDEEEQDGFPE
VQTSPLPSPFLSAIIAAFQPVAYDDEEEAWRCHVNQMLSDTDGSSAVFTFHVFSRLFQTIQRKFGEITNEAVSFLGDSLQRIGTKFKSSL
EVMMLCSECPTVFVDAETLMSCGLLETLKFGVLELQEHLDTYNVKREAAEQWLDDCKRTFGAKEDMYRINTDAQLNEILVELELCRRLYK
LHFQLLLLFQAYCKLINQVNTIKNEAEVINMSEELAQLESILKEAESASENEEIDISKAAQTTIETAIHSLIETLKNKEFISAVAQVKAF

>In-frame_KMT2A_ENST00000389506_chr11_118355690_+_FRYL_ENST00000503238_chr4_48530355_-_2157aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDYDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRYSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKYAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALYPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKEDCEAENVWEMGGLGILTSVPITPRVVCFLCASS
GHVETPIIGNKYGDQHSAAGRNGKPKVIAVTRSTSSTSSGSNSNALVPVSWKRPQLSQRRTREKLMNVLSLCGPESGLPKNPSVVFSSNE
DLEVGDQQTSLISTTEDINQEEEVAVEDNSSEQQFGVFKDFDFLDVELEDAEGESMDNFNWGVRRRSLDSIDKGDTPSLQEYQCSSSTPS
LNLTNQEDTDESSEEEAALTASQILSRTQMLNSDSATDETIPDHPDLLLQSEDSTGSITTEEVLQIRDETPTLEASLDNANSRLPEDTTS
VLKEEHVTTFEDEGSYIIQEQQESLVCQGILDLEETEMPEPLAPESYPESVCEEDVTLALKELDERCEEEEADFSGLSSQDEEEQDGFPE
VQTSPLPSPFLSAIIAAFQPVAYDDEEEAWRCHVNQMLSDTDGSSAVFTFHVFSRLFQTIQRKFGEITNEAVSFLGDSLQRIGTKFKSSL
EVMMLCSECPTVFVDAETLMSCGLLETLKFGVLELQEHLDTYNVKREAAEQWLDDCKRTFGAKEDMYRINTDAQQMEILAELELCRRLYK
LHFQLLLLFQAYCKLINQVNTIKNEAEVINMSEELAQLESILKEAESASENEEIDISKAAQTTIETAIHSLIETLKNKEFISAVAQVKAF

>In-frame_KMT2A_ENST00000389506_chr11_118355690_+_FRYL_ENST00000358350_chr4_48530355_-_2157aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDYDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRYSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKYAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALYPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKEDCEAENVWEMGGLGILTSVPITPRVVCFLCASS
GHVETPIIGNKYGDQHSAAGRNGKPKVIAVTRSTSSTSSGSNSNALVPVSWKRPQLSQRRTREKLMNVLSLCGPESGLPKNPSVVFSSNE
DLEVGDQQTSLISTTEDINQEEEVAVEDNSSEQQFGVFKDFDFLDVELEDAEGESMDNFNWGVRRRSLDSIDKGDTPSLQEYQCSSSTPS
LNLTNQEDTDESSEEEAALTASQILSRTQMLNSDSATDETIPDHPDLLLQSEDSTGSITTEEVLQIRDETPTLEASLDNANSRLPEDTTS
VLKEEHVTTFEDEGSYIIQEQQESLVCQGILDLEETEMPEPLAPESYPESVCEEDVTLALKELDERCEEEEADFSGLSSQDEEEQDGFPE
VQTSPLPSPFLSAIIAAFQPVAYDDEEEAWRCHVNQMLSDTDGSSAVFTFHVFSRLFQTIQRKFGEITNEAVSFLGDSLQRIGTKFKSSL
EVMMLCSECPTVFVDAETLMSCGLLETLKFGVLELQEHLDTYNVKREAAEQWLDDCKRTFGAKEDMYRINTDAQQMEILAELELCRRLYK
LHFQLLLLFQAYCKLINQVNTIKNEAEVINMSEELAQLESILKEAESASENEEIDISKAAQTTIETAIHSLIETLKNKEFISAVAQVKAF

>In-frame_KMT2A_ENST00000389506_chr11_118355690_+_FRYL_ENST00000537810_chr4_48530355_-_2157aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDYDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRYSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKYAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALYPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKEDCEAENVWEMGGLGILTSVPITPRVVCFLCASS
GHVETPIIGNKYGDQHSAAGRNGKPKVIAVTRSTSSTSSGSNSNALVPVSWKRPQLSQRRTREKLMNVLSLCGPESGLPKNPSVVFSSNE
DLEVGDQQTSLISTTEDINQEEEVAVEDNSSEQQFGVFKDFDFLDVELEDAEGESMDNFNWGVRRRSLDSIDKGDTPSLQEYQCSSSTPS
LNLTNQEDTDESSEEEAALTASQILSRTQMLNSDSATDETIPDHPDLLLQSEDSTGSITTEEVLQIRDETPTLEASLDNANSRLPEDTTS
VLKEEHVTTFEDEGSYIIQEQQESLVCQGILDLEETEMPEPLAPESYPESVCEEDVTLALKELDERCEEEEADFSGLSSQDEEEQDGFPE
VQTSPLPSPFLSAIIAAFQPVAYDDEEEAWRCHVNQMLSDTDGSSAVFTFHVFSRLFQTIQRKFGEITNEAVSFLGDSLQRIGTKFKSSL
EVMMLCSECPTVFVDAETLMSCGLLETLKFGVLELQEHLDTYNVKREAAEQWLDDCKRTFGAKEDMYRINTDAQLNEILVELELCRRLYK
LHFQLLLLFQAYCKLINQVNTIKNEAEVINMSEELAQLESILKEAESASENEEIDISKAAQTTIETAIHSLIETLKNKEFISAVAQVKAF


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_KMT2A_ENST00000534358_chr11_118355029_+_FRYL_ENST00000503238_chr4_48530355_-_6357nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGACACCAATTATT
GGAAACAAATATGGTGATCAGCACAGTGCGGCTGGAAGAAATGGGAAACCAAAAGTTATTGCTGTCACTAGAAGTACTTCCTCAACTTCT
TCTGGTTCTAATTCTAATGCCTTGGTTCCTGTTAGTTGGAAAAGGCCACAGTTATCACAGCGAAGAACAAGAGAAAAGCTAATGAATGTG
CTTTCTCTCTGTGGTCCAGAATCTGGCCTCCCAAAGAACCCATCAGTTGTATTTTCTTCTAATGAGGATTTGGAAGTCGGTGACCAACAG
ACTAGCCTAATTTCTACAACAGAAGACATAAATCAAGAGGAAGAAGTAGCTGTGGAAGATAATAGCAGTGAACAACAGTTTGGTGTTTTT
AAGGATTTTGACTTTTTAGATGTTGAATTGGAAGATGCAGAGGGTGAAAGTATGGACAATTTCAACTGGGGAGTTCGCAGGCGCTCACTG
GACAGTATTGACAAAGGGGACACTCCATCCCTCCAGGAGTACCAGTGCTCTAGTAGCACCCCCAGCCTGAACCTCACCAATCAGGAGGAT
ACAGATGAGTCCTCGGAAGAAGAAGCGGCACTTACAGCAAGCCAGATACTCTCACGCACACAGATGTTAAACAGTGATTCTGCCACTGAT
GAAACAATACCAGACCATCCTGACTTACTTCTCCAGTCTGAAGATTCCACTGGCAGCATCACAACAGAGGAAGTGCTTCAAATCAGGGAT
GAGACCCCAACTTTGGAGGCTTCTCTAGATAATGCTAACAGCCGGCTGCCTGAGGATACAACTTCAGTATTAAAGGAGGAACATGTTACA
ACCTTTGAAGATGAAGGATCCTATATAATTCAAGAACAGCAGGAATCTCTTGTGTGTCAAGGAATTCTTGATTTAGAAGAAACTGAAATG
CCAGAGCCTCTAGCTCCTGAAAGTTACCCCGAGTCAGTCTGTGAAGAGGATGTTACCTTAGCTCTGAAAGAGCTAGATGAAAGATGTGAA
GAAGAAGAAGCGGATTTCTCCGGACTGTCTAGTCAAGATGAAGAAGAGCAAGATGGTTTTCCAGAAGTACAGACGTCGCCTCTGCCGTCA
CCATTTCTTTCTGCCATCATAGCCGCCTTTCAGCCCGTGGCATATGATGATGAAGAGGAAGCCTGGCGCTGCCACGTCAATCAGATGCTG
TCTGACACCGACGGGTCCTCTGCAGTGTTTACTTTTCATGTGTTTTCTAGGCTGTTTCAGACAATTCAAAGAAAGTTTGGAGAAATAACT
AATGAGGCAGTCAGCTTTCTTGGTGATAGTCTGCAACGCATTGGTACCAAATTTAAAAGTTCCTTGGAAGTGATGATGCTGTGTTCAGAA
TGCCCAACAGTCTTTGTGGATGCTGAAACACTGATGTCATGTGGTTTGCTGGAAACACTCAAGTTTGGTGTTTTGGAGTTGCAAGAACAC
CTGGATACATACAATGTGAAAAGAGAAGCCGCTGAGCAGTGGCTAGATGATTGTAAGAGGACATTTGGTGCCAAAGAAGACATGTATAGG
ATAAACACAGATGCACAACAAATGGAAATACTAGCAGAATTGGAGCTCTGCCGAAGATTATACAAATTGCATTTTCAATTGCTGCTTCTG
TTCCAGGCCTACTGTAAACTTATCAACCAAGTAAATACGATAAAAAATGAAGCAGAGGTCATCAACATGTCAGAGGAACTTGCCCAACTG
GAAAGTATCCTCAAAGAAGCTGAGTCCGCTTCCGAAAACGAAGAAATTGACATTTCCAAAGCTGCACAAACTACTATAGAAACTGCCATT
CATTCTTTAATTGAAACTTTGAAAAATAAAGAATTTATATCAGCTGTAGCACAAGTCAAAGCTTTCAGATCTCTCTGGCCCAGTGATATC
TTTGGCAGTTGTGAAGATGACCCTGTACAGACACTGTTACATATATATTTCCATCATCAGACGCTGGGCCAGACAGGAAGCTTTGCAGTT
ATAGGCTCTAACCTGGACATGTCAGAAGCCAACTACAAACTGATGGAACTTAATCTGGAAATAAGAGAGTCTCTACGCATGGTGCAATCA

>In-frame_KMT2A_ENST00000534358_chr11_118355029_+_FRYL_ENST00000358350_chr4_48530355_-_6357nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGACACCAATTATT
GGAAACAAATATGGTGATCAGCACAGTGCGGCTGGAAGAAATGGGAAACCAAAAGTTATTGCTGTCACTAGAAGTACTTCCTCAACTTCT
TCTGGTTCTAATTCTAATGCCTTGGTTCCTGTTAGTTGGAAAAGGCCACAGTTATCACAGCGAAGAACAAGAGAAAAGCTAATGAATGTG
CTTTCTCTCTGTGGTCCAGAATCTGGCCTCCCAAAGAACCCATCAGTTGTATTTTCTTCTAATGAGGATTTGGAAGTCGGTGACCAACAG
ACTAGCCTAATTTCTACAACAGAAGACATAAATCAAGAGGAAGAAGTAGCTGTGGAAGATAATAGCAGTGAACAACAGTTTGGTGTTTTT
AAGGATTTTGACTTTTTAGATGTTGAATTGGAAGATGCAGAGGGTGAAAGTATGGACAATTTCAACTGGGGAGTTCGCAGGCGCTCACTG
GACAGTATTGACAAAGGGGACACTCCATCCCTCCAGGAGTACCAGTGCTCTAGTAGCACCCCCAGCCTGAACCTCACCAATCAGGAGGAT
ACAGATGAGTCCTCGGAAGAAGAAGCGGCACTTACAGCAAGCCAGATACTCTCACGCACACAGATGTTAAACAGTGATTCTGCCACTGAT
GAAACAATACCAGACCATCCTGACTTACTTCTCCAGTCTGAAGATTCCACTGGCAGCATCACAACAGAGGAAGTGCTTCAAATCAGGGAT
GAGACCCCAACTTTGGAGGCTTCTCTAGATAATGCTAACAGCCGGCTGCCTGAGGATACAACTTCAGTATTAAAGGAGGAACATGTTACA
ACCTTTGAAGATGAAGGATCCTATATAATTCAAGAACAGCAGGAATCTCTTGTGTGTCAAGGAATTCTTGATTTAGAAGAAACTGAAATG
CCAGAGCCTCTAGCTCCTGAAAGTTACCCCGAGTCAGTCTGTGAAGAGGATGTTACCTTAGCTCTGAAAGAGCTAGATGAAAGATGTGAA
GAAGAAGAAGCGGATTTCTCCGGACTGTCTAGTCAAGATGAAGAAGAGCAAGATGGTTTTCCAGAAGTACAGACGTCGCCTCTGCCGTCA
CCATTTCTTTCTGCCATCATAGCCGCCTTTCAGCCCGTGGCATATGATGATGAAGAGGAAGCCTGGCGCTGCCACGTCAATCAGATGCTG
TCTGACACCGACGGGTCCTCTGCAGTGTTTACTTTTCATGTGTTTTCTAGGCTGTTTCAGACAATTCAAAGAAAGTTTGGAGAAATAACT
AATGAGGCAGTCAGCTTTCTTGGTGATAGTCTGCAACGCATTGGTACCAAATTTAAAAGTTCCTTGGAAGTGATGATGCTGTGTTCAGAA
TGCCCAACAGTCTTTGTGGATGCTGAAACACTGATGTCATGTGGTTTGCTGGAAACACTCAAGTTTGGTGTTTTGGAGTTGCAAGAACAC
CTGGATACATACAATGTGAAAAGAGAAGCCGCTGAGCAGTGGCTAGATGATTGTAAGAGGACATTTGGTGCCAAAGAAGACATGTATAGG
ATAAACACAGATGCACAACAAATGGAAATACTAGCAGAATTGGAGCTCTGCCGAAGATTATACAAATTGCATTTTCAATTGCTGCTTCTG
TTCCAGGCCTACTGTAAACTTATCAACCAAGTAAATACGATAAAAAATGAAGCAGAGGTCATCAACATGTCAGAGGAACTTGCCCAACTG
GAAAGTATCCTCAAAGAAGCTGAGTCCGCTTCCGAAAACGAAGAAATTGACATTTCCAAAGCTGCACAAACTACTATAGAAACTGCCATT
CATTCTTTAATTGAAACTTTGAAAAATAAAGAATTTATATCAGCTGTAGCACAAGTCAAAGCTTTCAGATCTCTCTGGCCCAGTGATATC
TTTGGCAGTTGTGAAGATGACCCTGTACAGACACTGTTACATATATATTTCCATCATCAGACGCTGGGCCAGACAGGAAGCTTTGCAGTT
ATAGGCTCTAACCTGGACATGTCAGAAGCCAACTACAAACTGATGGAACTTAATCTGGAAATAAGAGAGTCTCTACGCATGGTGCAATCA

>In-frame_KMT2A_ENST00000534358_chr11_118355029_+_FRYL_ENST00000537810_chr4_48530355_-_6357nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGACACCAATTATT
GGAAACAAATATGGTGATCAGCACAGTGCGGCTGGAAGAAATGGGAAACCAAAAGTTATTGCTGTCACTAGAAGTACTTCCTCAACTTCT
TCTGGTTCTAATTCTAATGCCTTGGTTCCTGTTAGTTGGAAAAGGCCACAGTTATCACAGCGAAGAACAAGAGAAAAGCTAATGAATGTG
CTTTCTCTCTGTGGTCCAGAATCTGGCCTCCCAAAGAACCCATCAGTTGTATTTTCTTCTAATGAGGATTTGGAAGTCGGTGACCAACAG
ACTAGCCTAATTTCTACAACAGAAGACATAAATCAAGAGGAAGAAGTAGCTGTGGAAGATAATAGCAGTGAACAACAGTTTGGTGTTTTT
AAGGATTTTGACTTTTTAGATGTTGAATTGGAAGATGCAGAGGGTGAAAGTATGGACAATTTCAACTGGGGAGTTCGCAGGCGCTCACTG
GACAGTATTGACAAAGGGGACACTCCATCCCTCCAGGAGTACCAGTGCTCTAGTAGCACCCCCAGCCTGAACCTCACCAATCAGGAGGAT
ACAGATGAGTCCTCGGAAGAAGAAGCGGCACTTACAGCAAGCCAGATACTCTCACGCACACAGATGTTAAACAGTGATTCTGCCACTGAT
GAAACAATACCAGACCATCCTGACTTACTTCTCCAGTCTGAAGATTCCACTGGCAGCATCACAACAGAGGAAGTGCTTCAAATCAGGGAT
GAGACCCCAACTTTGGAGGCTTCTCTAGATAATGCTAACAGCCGGCTGCCTGAGGATACAACTTCAGTATTAAAGGAGGAACATGTTACA
ACCTTTGAAGATGAAGGATCCTATATAATTCAAGAACAGCAGGAATCTCTTGTGTGTCAAGGAATTCTTGATTTAGAAGAAACTGAAATG
CCAGAGCCTCTAGCTCCTGAAAGTTACCCCGAGTCAGTCTGTGAAGAGGATGTTACCTTAGCTCTGAAAGAGCTAGATGAAAGATGTGAA
GAAGAAGAAGCGGATTTCTCCGGACTGTCTAGTCAAGATGAAGAAGAGCAAGATGGTTTTCCAGAAGTACAGACGTCGCCTCTGCCGTCA
CCATTTCTTTCTGCCATCATAGCCGCCTTTCAGCCCGTGGCATATGATGATGAAGAGGAAGCCTGGCGCTGCCACGTCAATCAGATGCTG
TCTGACACCGACGGGTCCTCTGCAGTGTTTACTTTTCATGTGTTTTCTAGGCTGTTTCAGACAATTCAAAGAAAGTTTGGAGAAATAACT
AATGAGGCAGTCAGCTTTCTTGGTGATAGTCTGCAACGCATTGGTACCAAATTTAAAAGTTCCTTGGAAGTGATGATGCTGTGTTCAGAA
TGCCCAACAGTCTTTGTGGATGCTGAAACACTGATGTCATGTGGTTTGCTGGAAACACTCAAGTTTGGTGTTTTGGAGTTGCAAGAACAC
CTGGATACATACAATGTGAAAAGAGAAGCCGCTGAGCAGTGGCTAGATGATTGTAAGAGGACATTTGGTGCCAAAGAAGACATGTATAGG
ATAAACACAGATGCACAACTCAATGAAATACTGGTTGAATTGGAGCTCTGCCGAAGATTATACAAATTGCATTTTCAATTGCTGCTTCTG
TTCCAGGCCTACTGTAAACTTATCAACCAAGTAAATACGATAAAAAATGAAGCAGAGGTCATCAACATGTCAGAGGAACTTGCCCAACTG
GAAAGTATCCTCAAAGAAGCTGAGTCCGCTTCCGAAAACGAAGAAATTGACATTTCCAAAGCTGCACAAACTACTATAGAAACTGCCATT
CATTCTTTAATTGAAACTTTGAAAAATAAAGAATTTATATCAGCTGTAGCACAAGTCAAAGCTTTCAGATCTCTCTGGCCCAGTGATATC
TTTGGCAGTTGTGAAGATGACCCTGTACAGACACTGTTACATATATATTTCCATCATCAGACGCTGGGCCAGACAGGAAGCTTTGCAGTT
ATAGGCTCTAACCTGGACATGTCAGAAGCCAACTACAAACTGATGGAACTTAATCTGGAAATAAGAGAGTCTCTACGCATGGTGCAATCA

>In-frame_KMT2A_ENST00000389506_chr11_118355029_+_FRYL_ENST00000503238_chr4_48530355_-_6357nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGACACCAATTATT
GGAAACAAATATGGTGATCAGCACAGTGCGGCTGGAAGAAATGGGAAACCAAAAGTTATTGCTGTCACTAGAAGTACTTCCTCAACTTCT
TCTGGTTCTAATTCTAATGCCTTGGTTCCTGTTAGTTGGAAAAGGCCACAGTTATCACAGCGAAGAACAAGAGAAAAGCTAATGAATGTG
CTTTCTCTCTGTGGTCCAGAATCTGGCCTCCCAAAGAACCCATCAGTTGTATTTTCTTCTAATGAGGATTTGGAAGTCGGTGACCAACAG
ACTAGCCTAATTTCTACAACAGAAGACATAAATCAAGAGGAAGAAGTAGCTGTGGAAGATAATAGCAGTGAACAACAGTTTGGTGTTTTT
AAGGATTTTGACTTTTTAGATGTTGAATTGGAAGATGCAGAGGGTGAAAGTATGGACAATTTCAACTGGGGAGTTCGCAGGCGCTCACTG
GACAGTATTGACAAAGGGGACACTCCATCCCTCCAGGAGTACCAGTGCTCTAGTAGCACCCCCAGCCTGAACCTCACCAATCAGGAGGAT
ACAGATGAGTCCTCGGAAGAAGAAGCGGCACTTACAGCAAGCCAGATACTCTCACGCACACAGATGTTAAACAGTGATTCTGCCACTGAT
GAAACAATACCAGACCATCCTGACTTACTTCTCCAGTCTGAAGATTCCACTGGCAGCATCACAACAGAGGAAGTGCTTCAAATCAGGGAT
GAGACCCCAACTTTGGAGGCTTCTCTAGATAATGCTAACAGCCGGCTGCCTGAGGATACAACTTCAGTATTAAAGGAGGAACATGTTACA
ACCTTTGAAGATGAAGGATCCTATATAATTCAAGAACAGCAGGAATCTCTTGTGTGTCAAGGAATTCTTGATTTAGAAGAAACTGAAATG
CCAGAGCCTCTAGCTCCTGAAAGTTACCCCGAGTCAGTCTGTGAAGAGGATGTTACCTTAGCTCTGAAAGAGCTAGATGAAAGATGTGAA
GAAGAAGAAGCGGATTTCTCCGGACTGTCTAGTCAAGATGAAGAAGAGCAAGATGGTTTTCCAGAAGTACAGACGTCGCCTCTGCCGTCA
CCATTTCTTTCTGCCATCATAGCCGCCTTTCAGCCCGTGGCATATGATGATGAAGAGGAAGCCTGGCGCTGCCACGTCAATCAGATGCTG
TCTGACACCGACGGGTCCTCTGCAGTGTTTACTTTTCATGTGTTTTCTAGGCTGTTTCAGACAATTCAAAGAAAGTTTGGAGAAATAACT
AATGAGGCAGTCAGCTTTCTTGGTGATAGTCTGCAACGCATTGGTACCAAATTTAAAAGTTCCTTGGAAGTGATGATGCTGTGTTCAGAA
TGCCCAACAGTCTTTGTGGATGCTGAAACACTGATGTCATGTGGTTTGCTGGAAACACTCAAGTTTGGTGTTTTGGAGTTGCAAGAACAC
CTGGATACATACAATGTGAAAAGAGAAGCCGCTGAGCAGTGGCTAGATGATTGTAAGAGGACATTTGGTGCCAAAGAAGACATGTATAGG
ATAAACACAGATGCACAACAAATGGAAATACTAGCAGAATTGGAGCTCTGCCGAAGATTATACAAATTGCATTTTCAATTGCTGCTTCTG
TTCCAGGCCTACTGTAAACTTATCAACCAAGTAAATACGATAAAAAATGAAGCAGAGGTCATCAACATGTCAGAGGAACTTGCCCAACTG
GAAAGTATCCTCAAAGAAGCTGAGTCCGCTTCCGAAAACGAAGAAATTGACATTTCCAAAGCTGCACAAACTACTATAGAAACTGCCATT
CATTCTTTAATTGAAACTTTGAAAAATAAAGAATTTATATCAGCTGTAGCACAAGTCAAAGCTTTCAGATCTCTCTGGCCCAGTGATATC
TTTGGCAGTTGTGAAGATGACCCTGTACAGACACTGTTACATATATATTTCCATCATCAGACGCTGGGCCAGACAGGAAGCTTTGCAGTT
ATAGGCTCTAACCTGGACATGTCAGAAGCCAACTACAAACTGATGGAACTTAATCTGGAAATAAGAGAGTCTCTACGCATGGTGCAATCA

>In-frame_KMT2A_ENST00000389506_chr11_118355029_+_FRYL_ENST00000358350_chr4_48530355_-_6357nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGACACCAATTATT
GGAAACAAATATGGTGATCAGCACAGTGCGGCTGGAAGAAATGGGAAACCAAAAGTTATTGCTGTCACTAGAAGTACTTCCTCAACTTCT
TCTGGTTCTAATTCTAATGCCTTGGTTCCTGTTAGTTGGAAAAGGCCACAGTTATCACAGCGAAGAACAAGAGAAAAGCTAATGAATGTG
CTTTCTCTCTGTGGTCCAGAATCTGGCCTCCCAAAGAACCCATCAGTTGTATTTTCTTCTAATGAGGATTTGGAAGTCGGTGACCAACAG
ACTAGCCTAATTTCTACAACAGAAGACATAAATCAAGAGGAAGAAGTAGCTGTGGAAGATAATAGCAGTGAACAACAGTTTGGTGTTTTT
AAGGATTTTGACTTTTTAGATGTTGAATTGGAAGATGCAGAGGGTGAAAGTATGGACAATTTCAACTGGGGAGTTCGCAGGCGCTCACTG
GACAGTATTGACAAAGGGGACACTCCATCCCTCCAGGAGTACCAGTGCTCTAGTAGCACCCCCAGCCTGAACCTCACCAATCAGGAGGAT
ACAGATGAGTCCTCGGAAGAAGAAGCGGCACTTACAGCAAGCCAGATACTCTCACGCACACAGATGTTAAACAGTGATTCTGCCACTGAT
GAAACAATACCAGACCATCCTGACTTACTTCTCCAGTCTGAAGATTCCACTGGCAGCATCACAACAGAGGAAGTGCTTCAAATCAGGGAT
GAGACCCCAACTTTGGAGGCTTCTCTAGATAATGCTAACAGCCGGCTGCCTGAGGATACAACTTCAGTATTAAAGGAGGAACATGTTACA
ACCTTTGAAGATGAAGGATCCTATATAATTCAAGAACAGCAGGAATCTCTTGTGTGTCAAGGAATTCTTGATTTAGAAGAAACTGAAATG
CCAGAGCCTCTAGCTCCTGAAAGTTACCCCGAGTCAGTCTGTGAAGAGGATGTTACCTTAGCTCTGAAAGAGCTAGATGAAAGATGTGAA
GAAGAAGAAGCGGATTTCTCCGGACTGTCTAGTCAAGATGAAGAAGAGCAAGATGGTTTTCCAGAAGTACAGACGTCGCCTCTGCCGTCA
CCATTTCTTTCTGCCATCATAGCCGCCTTTCAGCCCGTGGCATATGATGATGAAGAGGAAGCCTGGCGCTGCCACGTCAATCAGATGCTG
TCTGACACCGACGGGTCCTCTGCAGTGTTTACTTTTCATGTGTTTTCTAGGCTGTTTCAGACAATTCAAAGAAAGTTTGGAGAAATAACT
AATGAGGCAGTCAGCTTTCTTGGTGATAGTCTGCAACGCATTGGTACCAAATTTAAAAGTTCCTTGGAAGTGATGATGCTGTGTTCAGAA
TGCCCAACAGTCTTTGTGGATGCTGAAACACTGATGTCATGTGGTTTGCTGGAAACACTCAAGTTTGGTGTTTTGGAGTTGCAAGAACAC
CTGGATACATACAATGTGAAAAGAGAAGCCGCTGAGCAGTGGCTAGATGATTGTAAGAGGACATTTGGTGCCAAAGAAGACATGTATAGG
ATAAACACAGATGCACAACAAATGGAAATACTAGCAGAATTGGAGCTCTGCCGAAGATTATACAAATTGCATTTTCAATTGCTGCTTCTG
TTCCAGGCCTACTGTAAACTTATCAACCAAGTAAATACGATAAAAAATGAAGCAGAGGTCATCAACATGTCAGAGGAACTTGCCCAACTG
GAAAGTATCCTCAAAGAAGCTGAGTCCGCTTCCGAAAACGAAGAAATTGACATTTCCAAAGCTGCACAAACTACTATAGAAACTGCCATT
CATTCTTTAATTGAAACTTTGAAAAATAAAGAATTTATATCAGCTGTAGCACAAGTCAAAGCTTTCAGATCTCTCTGGCCCAGTGATATC
TTTGGCAGTTGTGAAGATGACCCTGTACAGACACTGTTACATATATATTTCCATCATCAGACGCTGGGCCAGACAGGAAGCTTTGCAGTT
ATAGGCTCTAACCTGGACATGTCAGAAGCCAACTACAAACTGATGGAACTTAATCTGGAAATAAGAGAGTCTCTACGCATGGTGCAATCA

>In-frame_KMT2A_ENST00000389506_chr11_118355029_+_FRYL_ENST00000537810_chr4_48530355_-_6357nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGACACCAATTATT
GGAAACAAATATGGTGATCAGCACAGTGCGGCTGGAAGAAATGGGAAACCAAAAGTTATTGCTGTCACTAGAAGTACTTCCTCAACTTCT
TCTGGTTCTAATTCTAATGCCTTGGTTCCTGTTAGTTGGAAAAGGCCACAGTTATCACAGCGAAGAACAAGAGAAAAGCTAATGAATGTG
CTTTCTCTCTGTGGTCCAGAATCTGGCCTCCCAAAGAACCCATCAGTTGTATTTTCTTCTAATGAGGATTTGGAAGTCGGTGACCAACAG
ACTAGCCTAATTTCTACAACAGAAGACATAAATCAAGAGGAAGAAGTAGCTGTGGAAGATAATAGCAGTGAACAACAGTTTGGTGTTTTT
AAGGATTTTGACTTTTTAGATGTTGAATTGGAAGATGCAGAGGGTGAAAGTATGGACAATTTCAACTGGGGAGTTCGCAGGCGCTCACTG
GACAGTATTGACAAAGGGGACACTCCATCCCTCCAGGAGTACCAGTGCTCTAGTAGCACCCCCAGCCTGAACCTCACCAATCAGGAGGAT
ACAGATGAGTCCTCGGAAGAAGAAGCGGCACTTACAGCAAGCCAGATACTCTCACGCACACAGATGTTAAACAGTGATTCTGCCACTGAT
GAAACAATACCAGACCATCCTGACTTACTTCTCCAGTCTGAAGATTCCACTGGCAGCATCACAACAGAGGAAGTGCTTCAAATCAGGGAT
GAGACCCCAACTTTGGAGGCTTCTCTAGATAATGCTAACAGCCGGCTGCCTGAGGATACAACTTCAGTATTAAAGGAGGAACATGTTACA
ACCTTTGAAGATGAAGGATCCTATATAATTCAAGAACAGCAGGAATCTCTTGTGTGTCAAGGAATTCTTGATTTAGAAGAAACTGAAATG
CCAGAGCCTCTAGCTCCTGAAAGTTACCCCGAGTCAGTCTGTGAAGAGGATGTTACCTTAGCTCTGAAAGAGCTAGATGAAAGATGTGAA
GAAGAAGAAGCGGATTTCTCCGGACTGTCTAGTCAAGATGAAGAAGAGCAAGATGGTTTTCCAGAAGTACAGACGTCGCCTCTGCCGTCA
CCATTTCTTTCTGCCATCATAGCCGCCTTTCAGCCCGTGGCATATGATGATGAAGAGGAAGCCTGGCGCTGCCACGTCAATCAGATGCTG
TCTGACACCGACGGGTCCTCTGCAGTGTTTACTTTTCATGTGTTTTCTAGGCTGTTTCAGACAATTCAAAGAAAGTTTGGAGAAATAACT
AATGAGGCAGTCAGCTTTCTTGGTGATAGTCTGCAACGCATTGGTACCAAATTTAAAAGTTCCTTGGAAGTGATGATGCTGTGTTCAGAA
TGCCCAACAGTCTTTGTGGATGCTGAAACACTGATGTCATGTGGTTTGCTGGAAACACTCAAGTTTGGTGTTTTGGAGTTGCAAGAACAC
CTGGATACATACAATGTGAAAAGAGAAGCCGCTGAGCAGTGGCTAGATGATTGTAAGAGGACATTTGGTGCCAAAGAAGACATGTATAGG
ATAAACACAGATGCACAACTCAATGAAATACTGGTTGAATTGGAGCTCTGCCGAAGATTATACAAATTGCATTTTCAATTGCTGCTTCTG
TTCCAGGCCTACTGTAAACTTATCAACCAAGTAAATACGATAAAAAATGAAGCAGAGGTCATCAACATGTCAGAGGAACTTGCCCAACTG
GAAAGTATCCTCAAAGAAGCTGAGTCCGCTTCCGAAAACGAAGAAATTGACATTTCCAAAGCTGCACAAACTACTATAGAAACTGCCATT
CATTCTTTAATTGAAACTTTGAAAAATAAAGAATTTATATCAGCTGTAGCACAAGTCAAAGCTTTCAGATCTCTCTGGCCCAGTGATATC
TTTGGCAGTTGTGAAGATGACCCTGTACAGACACTGTTACATATATATTTCCATCATCAGACGCTGGGCCAGACAGGAAGCTTTGCAGTT
ATAGGCTCTAACCTGGACATGTCAGAAGCCAACTACAAACTGATGGAACTTAATCTGGAAATAAGAGAGTCTCTACGCATGGTGCAATCA

>In-frame_KMT2A_ENST00000354520_chr11_118355029_+_FRYL_ENST00000503238_chr4_48530355_-_6357nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGACACCAATTATT
GGAAACAAATATGGTGATCAGCACAGTGCGGCTGGAAGAAATGGGAAACCAAAAGTTATTGCTGTCACTAGAAGTACTTCCTCAACTTCT
TCTGGTTCTAATTCTAATGCCTTGGTTCCTGTTAGTTGGAAAAGGCCACAGTTATCACAGCGAAGAACAAGAGAAAAGCTAATGAATGTG
CTTTCTCTCTGTGGTCCAGAATCTGGCCTCCCAAAGAACCCATCAGTTGTATTTTCTTCTAATGAGGATTTGGAAGTCGGTGACCAACAG
ACTAGCCTAATTTCTACAACAGAAGACATAAATCAAGAGGAAGAAGTAGCTGTGGAAGATAATAGCAGTGAACAACAGTTTGGTGTTTTT
AAGGATTTTGACTTTTTAGATGTTGAATTGGAAGATGCAGAGGGTGAAAGTATGGACAATTTCAACTGGGGAGTTCGCAGGCGCTCACTG
GACAGTATTGACAAAGGGGACACTCCATCCCTCCAGGAGTACCAGTGCTCTAGTAGCACCCCCAGCCTGAACCTCACCAATCAGGAGGAT
ACAGATGAGTCCTCGGAAGAAGAAGCGGCACTTACAGCAAGCCAGATACTCTCACGCACACAGATGTTAAACAGTGATTCTGCCACTGAT
GAAACAATACCAGACCATCCTGACTTACTTCTCCAGTCTGAAGATTCCACTGGCAGCATCACAACAGAGGAAGTGCTTCAAATCAGGGAT
GAGACCCCAACTTTGGAGGCTTCTCTAGATAATGCTAACAGCCGGCTGCCTGAGGATACAACTTCAGTATTAAAGGAGGAACATGTTACA
ACCTTTGAAGATGAAGGATCCTATATAATTCAAGAACAGCAGGAATCTCTTGTGTGTCAAGGAATTCTTGATTTAGAAGAAACTGAAATG
CCAGAGCCTCTAGCTCCTGAAAGTTACCCCGAGTCAGTCTGTGAAGAGGATGTTACCTTAGCTCTGAAAGAGCTAGATGAAAGATGTGAA
GAAGAAGAAGCGGATTTCTCCGGACTGTCTAGTCAAGATGAAGAAGAGCAAGATGGTTTTCCAGAAGTACAGACGTCGCCTCTGCCGTCA
CCATTTCTTTCTGCCATCATAGCCGCCTTTCAGCCCGTGGCATATGATGATGAAGAGGAAGCCTGGCGCTGCCACGTCAATCAGATGCTG
TCTGACACCGACGGGTCCTCTGCAGTGTTTACTTTTCATGTGTTTTCTAGGCTGTTTCAGACAATTCAAAGAAAGTTTGGAGAAATAACT
AATGAGGCAGTCAGCTTTCTTGGTGATAGTCTGCAACGCATTGGTACCAAATTTAAAAGTTCCTTGGAAGTGATGATGCTGTGTTCAGAA
TGCCCAACAGTCTTTGTGGATGCTGAAACACTGATGTCATGTGGTTTGCTGGAAACACTCAAGTTTGGTGTTTTGGAGTTGCAAGAACAC
CTGGATACATACAATGTGAAAAGAGAAGCCGCTGAGCAGTGGCTAGATGATTGTAAGAGGACATTTGGTGCCAAAGAAGACATGTATAGG
ATAAACACAGATGCACAACAAATGGAAATACTAGCAGAATTGGAGCTCTGCCGAAGATTATACAAATTGCATTTTCAATTGCTGCTTCTG
TTCCAGGCCTACTGTAAACTTATCAACCAAGTAAATACGATAAAAAATGAAGCAGAGGTCATCAACATGTCAGAGGAACTTGCCCAACTG
GAAAGTATCCTCAAAGAAGCTGAGTCCGCTTCCGAAAACGAAGAAATTGACATTTCCAAAGCTGCACAAACTACTATAGAAACTGCCATT
CATTCTTTAATTGAAACTTTGAAAAATAAAGAATTTATATCAGCTGTAGCACAAGTCAAAGCTTTCAGATCTCTCTGGCCCAGTGATATC
TTTGGCAGTTGTGAAGATGACCCTGTACAGACACTGTTACATATATATTTCCATCATCAGACGCTGGGCCAGACAGGAAGCTTTGCAGTT
ATAGGCTCTAACCTGGACATGTCAGAAGCCAACTACAAACTGATGGAACTTAATCTGGAAATAAGAGAGTCTCTACGCATGGTGCAATCA

>In-frame_KMT2A_ENST00000354520_chr11_118355029_+_FRYL_ENST00000358350_chr4_48530355_-_6357nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGACACCAATTATT
GGAAACAAATATGGTGATCAGCACAGTGCGGCTGGAAGAAATGGGAAACCAAAAGTTATTGCTGTCACTAGAAGTACTTCCTCAACTTCT
TCTGGTTCTAATTCTAATGCCTTGGTTCCTGTTAGTTGGAAAAGGCCACAGTTATCACAGCGAAGAACAAGAGAAAAGCTAATGAATGTG
CTTTCTCTCTGTGGTCCAGAATCTGGCCTCCCAAAGAACCCATCAGTTGTATTTTCTTCTAATGAGGATTTGGAAGTCGGTGACCAACAG
ACTAGCCTAATTTCTACAACAGAAGACATAAATCAAGAGGAAGAAGTAGCTGTGGAAGATAATAGCAGTGAACAACAGTTTGGTGTTTTT
AAGGATTTTGACTTTTTAGATGTTGAATTGGAAGATGCAGAGGGTGAAAGTATGGACAATTTCAACTGGGGAGTTCGCAGGCGCTCACTG
GACAGTATTGACAAAGGGGACACTCCATCCCTCCAGGAGTACCAGTGCTCTAGTAGCACCCCCAGCCTGAACCTCACCAATCAGGAGGAT
ACAGATGAGTCCTCGGAAGAAGAAGCGGCACTTACAGCAAGCCAGATACTCTCACGCACACAGATGTTAAACAGTGATTCTGCCACTGAT
GAAACAATACCAGACCATCCTGACTTACTTCTCCAGTCTGAAGATTCCACTGGCAGCATCACAACAGAGGAAGTGCTTCAAATCAGGGAT
GAGACCCCAACTTTGGAGGCTTCTCTAGATAATGCTAACAGCCGGCTGCCTGAGGATACAACTTCAGTATTAAAGGAGGAACATGTTACA
ACCTTTGAAGATGAAGGATCCTATATAATTCAAGAACAGCAGGAATCTCTTGTGTGTCAAGGAATTCTTGATTTAGAAGAAACTGAAATG
CCAGAGCCTCTAGCTCCTGAAAGTTACCCCGAGTCAGTCTGTGAAGAGGATGTTACCTTAGCTCTGAAAGAGCTAGATGAAAGATGTGAA
GAAGAAGAAGCGGATTTCTCCGGACTGTCTAGTCAAGATGAAGAAGAGCAAGATGGTTTTCCAGAAGTACAGACGTCGCCTCTGCCGTCA
CCATTTCTTTCTGCCATCATAGCCGCCTTTCAGCCCGTGGCATATGATGATGAAGAGGAAGCCTGGCGCTGCCACGTCAATCAGATGCTG
TCTGACACCGACGGGTCCTCTGCAGTGTTTACTTTTCATGTGTTTTCTAGGCTGTTTCAGACAATTCAAAGAAAGTTTGGAGAAATAACT
AATGAGGCAGTCAGCTTTCTTGGTGATAGTCTGCAACGCATTGGTACCAAATTTAAAAGTTCCTTGGAAGTGATGATGCTGTGTTCAGAA
TGCCCAACAGTCTTTGTGGATGCTGAAACACTGATGTCATGTGGTTTGCTGGAAACACTCAAGTTTGGTGTTTTGGAGTTGCAAGAACAC
CTGGATACATACAATGTGAAAAGAGAAGCCGCTGAGCAGTGGCTAGATGATTGTAAGAGGACATTTGGTGCCAAAGAAGACATGTATAGG
ATAAACACAGATGCACAACAAATGGAAATACTAGCAGAATTGGAGCTCTGCCGAAGATTATACAAATTGCATTTTCAATTGCTGCTTCTG
TTCCAGGCCTACTGTAAACTTATCAACCAAGTAAATACGATAAAAAATGAAGCAGAGGTCATCAACATGTCAGAGGAACTTGCCCAACTG
GAAAGTATCCTCAAAGAAGCTGAGTCCGCTTCCGAAAACGAAGAAATTGACATTTCCAAAGCTGCACAAACTACTATAGAAACTGCCATT
CATTCTTTAATTGAAACTTTGAAAAATAAAGAATTTATATCAGCTGTAGCACAAGTCAAAGCTTTCAGATCTCTCTGGCCCAGTGATATC
TTTGGCAGTTGTGAAGATGACCCTGTACAGACACTGTTACATATATATTTCCATCATCAGACGCTGGGCCAGACAGGAAGCTTTGCAGTT
ATAGGCTCTAACCTGGACATGTCAGAAGCCAACTACAAACTGATGGAACTTAATCTGGAAATAAGAGAGTCTCTACGCATGGTGCAATCA

>In-frame_KMT2A_ENST00000354520_chr11_118355029_+_FRYL_ENST00000537810_chr4_48530355_-_6357nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGACACCAATTATT
GGAAACAAATATGGTGATCAGCACAGTGCGGCTGGAAGAAATGGGAAACCAAAAGTTATTGCTGTCACTAGAAGTACTTCCTCAACTTCT
TCTGGTTCTAATTCTAATGCCTTGGTTCCTGTTAGTTGGAAAAGGCCACAGTTATCACAGCGAAGAACAAGAGAAAAGCTAATGAATGTG
CTTTCTCTCTGTGGTCCAGAATCTGGCCTCCCAAAGAACCCATCAGTTGTATTTTCTTCTAATGAGGATTTGGAAGTCGGTGACCAACAG
ACTAGCCTAATTTCTACAACAGAAGACATAAATCAAGAGGAAGAAGTAGCTGTGGAAGATAATAGCAGTGAACAACAGTTTGGTGTTTTT
AAGGATTTTGACTTTTTAGATGTTGAATTGGAAGATGCAGAGGGTGAAAGTATGGACAATTTCAACTGGGGAGTTCGCAGGCGCTCACTG
GACAGTATTGACAAAGGGGACACTCCATCCCTCCAGGAGTACCAGTGCTCTAGTAGCACCCCCAGCCTGAACCTCACCAATCAGGAGGAT
ACAGATGAGTCCTCGGAAGAAGAAGCGGCACTTACAGCAAGCCAGATACTCTCACGCACACAGATGTTAAACAGTGATTCTGCCACTGAT
GAAACAATACCAGACCATCCTGACTTACTTCTCCAGTCTGAAGATTCCACTGGCAGCATCACAACAGAGGAAGTGCTTCAAATCAGGGAT
GAGACCCCAACTTTGGAGGCTTCTCTAGATAATGCTAACAGCCGGCTGCCTGAGGATACAACTTCAGTATTAAAGGAGGAACATGTTACA
ACCTTTGAAGATGAAGGATCCTATATAATTCAAGAACAGCAGGAATCTCTTGTGTGTCAAGGAATTCTTGATTTAGAAGAAACTGAAATG
CCAGAGCCTCTAGCTCCTGAAAGTTACCCCGAGTCAGTCTGTGAAGAGGATGTTACCTTAGCTCTGAAAGAGCTAGATGAAAGATGTGAA
GAAGAAGAAGCGGATTTCTCCGGACTGTCTAGTCAAGATGAAGAAGAGCAAGATGGTTTTCCAGAAGTACAGACGTCGCCTCTGCCGTCA
CCATTTCTTTCTGCCATCATAGCCGCCTTTCAGCCCGTGGCATATGATGATGAAGAGGAAGCCTGGCGCTGCCACGTCAATCAGATGCTG
TCTGACACCGACGGGTCCTCTGCAGTGTTTACTTTTCATGTGTTTTCTAGGCTGTTTCAGACAATTCAAAGAAAGTTTGGAGAAATAACT
AATGAGGCAGTCAGCTTTCTTGGTGATAGTCTGCAACGCATTGGTACCAAATTTAAAAGTTCCTTGGAAGTGATGATGCTGTGTTCAGAA
TGCCCAACAGTCTTTGTGGATGCTGAAACACTGATGTCATGTGGTTTGCTGGAAACACTCAAGTTTGGTGTTTTGGAGTTGCAAGAACAC
CTGGATACATACAATGTGAAAAGAGAAGCCGCTGAGCAGTGGCTAGATGATTGTAAGAGGACATTTGGTGCCAAAGAAGACATGTATAGG
ATAAACACAGATGCACAACTCAATGAAATACTGGTTGAATTGGAGCTCTGCCGAAGATTATACAAATTGCATTTTCAATTGCTGCTTCTG
TTCCAGGCCTACTGTAAACTTATCAACCAAGTAAATACGATAAAAAATGAAGCAGAGGTCATCAACATGTCAGAGGAACTTGCCCAACTG
GAAAGTATCCTCAAAGAAGCTGAGTCCGCTTCCGAAAACGAAGAAATTGACATTTCCAAAGCTGCACAAACTACTATAGAAACTGCCATT
CATTCTTTAATTGAAACTTTGAAAAATAAAGAATTTATATCAGCTGTAGCACAAGTCAAAGCTTTCAGATCTCTCTGGCCCAGTGATATC
TTTGGCAGTTGTGAAGATGACCCTGTACAGACACTGTTACATATATATTTCCATCATCAGACGCTGGGCCAGACAGGAAGCTTTGCAGTT
ATAGGCTCTAACCTGGACATGTCAGAAGCCAACTACAAACTGATGGAACTTAATCTGGAAATAAGAGAGTCTCTACGCATGGTGCAATCA

>In-frame_KMT2A_ENST00000534358_chr11_118355029_+_FRYL_ENST00000503238_chr4_48530355_-_6357nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGACACCAATTATT
GGAAACAAATATGGTGATCAGCACAGTGCGGCTGGAAGAAATGGGAAACCAAAAGTTATTGCTGTCACTAGAAGTACTTCCTCAACTTCT
TCTGGTTCTAATTCTAATGCCTTGGTTCCTGTTAGTTGGAAAAGGCCACAGTTATCACAGCGAAGAACAAGAGAAAAGCTAATGAATGTG
CTTTCTCTCTGTGGTCCAGAATCTGGCCTCCCAAAGAACCCATCAGTTGTATTTTCTTCTAATGAGGATTTGGAAGTCGGTGACCAACAG
ACTAGCCTAATTTCTACAACAGAAGACATAAATCAAGAGGAAGAAGTAGCTGTGGAAGATAATAGCAGTGAACAACAGTTTGGTGTTTTT
AAGGATTTTGACTTTTTAGATGTTGAATTGGAAGATGCAGAGGGTGAAAGTATGGACAATTTCAACTGGGGAGTTCGCAGGCGCTCACTG
GACAGTATTGACAAAGGGGACACTCCATCCCTCCAGGAGTACCAGTGCTCTAGTAGCACCCCCAGCCTGAACCTCACCAATCAGGAGGAT
ACAGATGAGTCCTCGGAAGAAGAAGCGGCACTTACAGCAAGCCAGATACTCTCACGCACACAGATGTTAAACAGTGATTCTGCCACTGAT
GAAACAATACCAGACCATCCTGACTTACTTCTCCAGTCTGAAGATTCCACTGGCAGCATCACAACAGAGGAAGTGCTTCAAATCAGGGAT
GAGACCCCAACTTTGGAGGCTTCTCTAGATAATGCTAACAGCCGGCTGCCTGAGGATACAACTTCAGTATTAAAGGAGGAACATGTTACA
ACCTTTGAAGATGAAGGATCCTATATAATTCAAGAACAGCAGGAATCTCTTGTGTGTCAAGGAATTCTTGATTTAGAAGAAACTGAAATG
CCAGAGCCTCTAGCTCCTGAAAGTTACCCCGAGTCAGTCTGTGAAGAGGATGTTACCTTAGCTCTGAAAGAGCTAGATGAAAGATGTGAA
GAAGAAGAAGCGGATTTCTCCGGACTGTCTAGTCAAGATGAAGAAGAGCAAGATGGTTTTCCAGAAGTACAGACGTCGCCTCTGCCGTCA
CCATTTCTTTCTGCCATCATAGCCGCCTTTCAGCCCGTGGCATATGATGATGAAGAGGAAGCCTGGCGCTGCCACGTCAATCAGATGCTG
TCTGACACCGACGGGTCCTCTGCAGTGTTTACTTTTCATGTGTTTTCTAGGCTGTTTCAGACAATTCAAAGAAAGTTTGGAGAAATAACT
AATGAGGCAGTCAGCTTTCTTGGTGATAGTCTGCAACGCATTGGTACCAAATTTAAAAGTTCCTTGGAAGTGATGATGCTGTGTTCAGAA
TGCCCAACAGTCTTTGTGGATGCTGAAACACTGATGTCATGTGGTTTGCTGGAAACACTCAAGTTTGGTGTTTTGGAGTTGCAAGAACAC
CTGGATACATACAATGTGAAAAGAGAAGCCGCTGAGCAGTGGCTAGATGATTGTAAGAGGACATTTGGTGCCAAAGAAGACATGTATAGG
ATAAACACAGATGCACAACAAATGGAAATACTAGCAGAATTGGAGCTCTGCCGAAGATTATACAAATTGCATTTTCAATTGCTGCTTCTG
TTCCAGGCCTACTGTAAACTTATCAACCAAGTAAATACGATAAAAAATGAAGCAGAGGTCATCAACATGTCAGAGGAACTTGCCCAACTG
GAAAGTATCCTCAAAGAAGCTGAGTCCGCTTCCGAAAACGAAGAAATTGACATTTCCAAAGCTGCACAAACTACTATAGAAACTGCCATT
CATTCTTTAATTGAAACTTTGAAAAATAAAGAATTTATATCAGCTGTAGCACAAGTCAAAGCTTTCAGATCTCTCTGGCCCAGTGATATC
TTTGGCAGTTGTGAAGATGACCCTGTACAGACACTGTTACATATATATTTCCATCATCAGACGCTGGGCCAGACAGGAAGCTTTGCAGTT
ATAGGCTCTAACCTGGACATGTCAGAAGCCAACTACAAACTGATGGAACTTAATCTGGAAATAAGAGAGTCTCTACGCATGGTGCAATCA

>In-frame_KMT2A_ENST00000534358_chr11_118355029_+_FRYL_ENST00000358350_chr4_48530355_-_6357nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGACACCAATTATT
GGAAACAAATATGGTGATCAGCACAGTGCGGCTGGAAGAAATGGGAAACCAAAAGTTATTGCTGTCACTAGAAGTACTTCCTCAACTTCT
TCTGGTTCTAATTCTAATGCCTTGGTTCCTGTTAGTTGGAAAAGGCCACAGTTATCACAGCGAAGAACAAGAGAAAAGCTAATGAATGTG
CTTTCTCTCTGTGGTCCAGAATCTGGCCTCCCAAAGAACCCATCAGTTGTATTTTCTTCTAATGAGGATTTGGAAGTCGGTGACCAACAG
ACTAGCCTAATTTCTACAACAGAAGACATAAATCAAGAGGAAGAAGTAGCTGTGGAAGATAATAGCAGTGAACAACAGTTTGGTGTTTTT
AAGGATTTTGACTTTTTAGATGTTGAATTGGAAGATGCAGAGGGTGAAAGTATGGACAATTTCAACTGGGGAGTTCGCAGGCGCTCACTG
GACAGTATTGACAAAGGGGACACTCCATCCCTCCAGGAGTACCAGTGCTCTAGTAGCACCCCCAGCCTGAACCTCACCAATCAGGAGGAT
ACAGATGAGTCCTCGGAAGAAGAAGCGGCACTTACAGCAAGCCAGATACTCTCACGCACACAGATGTTAAACAGTGATTCTGCCACTGAT
GAAACAATACCAGACCATCCTGACTTACTTCTCCAGTCTGAAGATTCCACTGGCAGCATCACAACAGAGGAAGTGCTTCAAATCAGGGAT
GAGACCCCAACTTTGGAGGCTTCTCTAGATAATGCTAACAGCCGGCTGCCTGAGGATACAACTTCAGTATTAAAGGAGGAACATGTTACA
ACCTTTGAAGATGAAGGATCCTATATAATTCAAGAACAGCAGGAATCTCTTGTGTGTCAAGGAATTCTTGATTTAGAAGAAACTGAAATG
CCAGAGCCTCTAGCTCCTGAAAGTTACCCCGAGTCAGTCTGTGAAGAGGATGTTACCTTAGCTCTGAAAGAGCTAGATGAAAGATGTGAA
GAAGAAGAAGCGGATTTCTCCGGACTGTCTAGTCAAGATGAAGAAGAGCAAGATGGTTTTCCAGAAGTACAGACGTCGCCTCTGCCGTCA
CCATTTCTTTCTGCCATCATAGCCGCCTTTCAGCCCGTGGCATATGATGATGAAGAGGAAGCCTGGCGCTGCCACGTCAATCAGATGCTG
TCTGACACCGACGGGTCCTCTGCAGTGTTTACTTTTCATGTGTTTTCTAGGCTGTTTCAGACAATTCAAAGAAAGTTTGGAGAAATAACT
AATGAGGCAGTCAGCTTTCTTGGTGATAGTCTGCAACGCATTGGTACCAAATTTAAAAGTTCCTTGGAAGTGATGATGCTGTGTTCAGAA
TGCCCAACAGTCTTTGTGGATGCTGAAACACTGATGTCATGTGGTTTGCTGGAAACACTCAAGTTTGGTGTTTTGGAGTTGCAAGAACAC
CTGGATACATACAATGTGAAAAGAGAAGCCGCTGAGCAGTGGCTAGATGATTGTAAGAGGACATTTGGTGCCAAAGAAGACATGTATAGG
ATAAACACAGATGCACAACAAATGGAAATACTAGCAGAATTGGAGCTCTGCCGAAGATTATACAAATTGCATTTTCAATTGCTGCTTCTG
TTCCAGGCCTACTGTAAACTTATCAACCAAGTAAATACGATAAAAAATGAAGCAGAGGTCATCAACATGTCAGAGGAACTTGCCCAACTG
GAAAGTATCCTCAAAGAAGCTGAGTCCGCTTCCGAAAACGAAGAAATTGACATTTCCAAAGCTGCACAAACTACTATAGAAACTGCCATT
CATTCTTTAATTGAAACTTTGAAAAATAAAGAATTTATATCAGCTGTAGCACAAGTCAAAGCTTTCAGATCTCTCTGGCCCAGTGATATC
TTTGGCAGTTGTGAAGATGACCCTGTACAGACACTGTTACATATATATTTCCATCATCAGACGCTGGGCCAGACAGGAAGCTTTGCAGTT
ATAGGCTCTAACCTGGACATGTCAGAAGCCAACTACAAACTGATGGAACTTAATCTGGAAATAAGAGAGTCTCTACGCATGGTGCAATCA

>In-frame_KMT2A_ENST00000534358_chr11_118355029_+_FRYL_ENST00000537810_chr4_48530355_-_6357nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGACACCAATTATT
GGAAACAAATATGGTGATCAGCACAGTGCGGCTGGAAGAAATGGGAAACCAAAAGTTATTGCTGTCACTAGAAGTACTTCCTCAACTTCT
TCTGGTTCTAATTCTAATGCCTTGGTTCCTGTTAGTTGGAAAAGGCCACAGTTATCACAGCGAAGAACAAGAGAAAAGCTAATGAATGTG
CTTTCTCTCTGTGGTCCAGAATCTGGCCTCCCAAAGAACCCATCAGTTGTATTTTCTTCTAATGAGGATTTGGAAGTCGGTGACCAACAG
ACTAGCCTAATTTCTACAACAGAAGACATAAATCAAGAGGAAGAAGTAGCTGTGGAAGATAATAGCAGTGAACAACAGTTTGGTGTTTTT
AAGGATTTTGACTTTTTAGATGTTGAATTGGAAGATGCAGAGGGTGAAAGTATGGACAATTTCAACTGGGGAGTTCGCAGGCGCTCACTG
GACAGTATTGACAAAGGGGACACTCCATCCCTCCAGGAGTACCAGTGCTCTAGTAGCACCCCCAGCCTGAACCTCACCAATCAGGAGGAT
ACAGATGAGTCCTCGGAAGAAGAAGCGGCACTTACAGCAAGCCAGATACTCTCACGCACACAGATGTTAAACAGTGATTCTGCCACTGAT
GAAACAATACCAGACCATCCTGACTTACTTCTCCAGTCTGAAGATTCCACTGGCAGCATCACAACAGAGGAAGTGCTTCAAATCAGGGAT
GAGACCCCAACTTTGGAGGCTTCTCTAGATAATGCTAACAGCCGGCTGCCTGAGGATACAACTTCAGTATTAAAGGAGGAACATGTTACA
ACCTTTGAAGATGAAGGATCCTATATAATTCAAGAACAGCAGGAATCTCTTGTGTGTCAAGGAATTCTTGATTTAGAAGAAACTGAAATG
CCAGAGCCTCTAGCTCCTGAAAGTTACCCCGAGTCAGTCTGTGAAGAGGATGTTACCTTAGCTCTGAAAGAGCTAGATGAAAGATGTGAA
GAAGAAGAAGCGGATTTCTCCGGACTGTCTAGTCAAGATGAAGAAGAGCAAGATGGTTTTCCAGAAGTACAGACGTCGCCTCTGCCGTCA
CCATTTCTTTCTGCCATCATAGCCGCCTTTCAGCCCGTGGCATATGATGATGAAGAGGAAGCCTGGCGCTGCCACGTCAATCAGATGCTG
TCTGACACCGACGGGTCCTCTGCAGTGTTTACTTTTCATGTGTTTTCTAGGCTGTTTCAGACAATTCAAAGAAAGTTTGGAGAAATAACT
AATGAGGCAGTCAGCTTTCTTGGTGATAGTCTGCAACGCATTGGTACCAAATTTAAAAGTTCCTTGGAAGTGATGATGCTGTGTTCAGAA
TGCCCAACAGTCTTTGTGGATGCTGAAACACTGATGTCATGTGGTTTGCTGGAAACACTCAAGTTTGGTGTTTTGGAGTTGCAAGAACAC
CTGGATACATACAATGTGAAAAGAGAAGCCGCTGAGCAGTGGCTAGATGATTGTAAGAGGACATTTGGTGCCAAAGAAGACATGTATAGG
ATAAACACAGATGCACAACTCAATGAAATACTGGTTGAATTGGAGCTCTGCCGAAGATTATACAAATTGCATTTTCAATTGCTGCTTCTG
TTCCAGGCCTACTGTAAACTTATCAACCAAGTAAATACGATAAAAAATGAAGCAGAGGTCATCAACATGTCAGAGGAACTTGCCCAACTG
GAAAGTATCCTCAAAGAAGCTGAGTCCGCTTCCGAAAACGAAGAAATTGACATTTCCAAAGCTGCACAAACTACTATAGAAACTGCCATT
CATTCTTTAATTGAAACTTTGAAAAATAAAGAATTTATATCAGCTGTAGCACAAGTCAAAGCTTTCAGATCTCTCTGGCCCAGTGATATC
TTTGGCAGTTGTGAAGATGACCCTGTACAGACACTGTTACATATATATTTCCATCATCAGACGCTGGGCCAGACAGGAAGCTTTGCAGTT
ATAGGCTCTAACCTGGACATGTCAGAAGCCAACTACAAACTGATGGAACTTAATCTGGAAATAAGAGAGTCTCTACGCATGGTGCAATCA

>In-frame_KMT2A_ENST00000389506_chr11_118355029_+_FRYL_ENST00000503238_chr4_48530355_-_6357nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGACACCAATTATT
GGAAACAAATATGGTGATCAGCACAGTGCGGCTGGAAGAAATGGGAAACCAAAAGTTATTGCTGTCACTAGAAGTACTTCCTCAACTTCT
TCTGGTTCTAATTCTAATGCCTTGGTTCCTGTTAGTTGGAAAAGGCCACAGTTATCACAGCGAAGAACAAGAGAAAAGCTAATGAATGTG
CTTTCTCTCTGTGGTCCAGAATCTGGCCTCCCAAAGAACCCATCAGTTGTATTTTCTTCTAATGAGGATTTGGAAGTCGGTGACCAACAG
ACTAGCCTAATTTCTACAACAGAAGACATAAATCAAGAGGAAGAAGTAGCTGTGGAAGATAATAGCAGTGAACAACAGTTTGGTGTTTTT
AAGGATTTTGACTTTTTAGATGTTGAATTGGAAGATGCAGAGGGTGAAAGTATGGACAATTTCAACTGGGGAGTTCGCAGGCGCTCACTG
GACAGTATTGACAAAGGGGACACTCCATCCCTCCAGGAGTACCAGTGCTCTAGTAGCACCCCCAGCCTGAACCTCACCAATCAGGAGGAT
ACAGATGAGTCCTCGGAAGAAGAAGCGGCACTTACAGCAAGCCAGATACTCTCACGCACACAGATGTTAAACAGTGATTCTGCCACTGAT
GAAACAATACCAGACCATCCTGACTTACTTCTCCAGTCTGAAGATTCCACTGGCAGCATCACAACAGAGGAAGTGCTTCAAATCAGGGAT
GAGACCCCAACTTTGGAGGCTTCTCTAGATAATGCTAACAGCCGGCTGCCTGAGGATACAACTTCAGTATTAAAGGAGGAACATGTTACA
ACCTTTGAAGATGAAGGATCCTATATAATTCAAGAACAGCAGGAATCTCTTGTGTGTCAAGGAATTCTTGATTTAGAAGAAACTGAAATG
CCAGAGCCTCTAGCTCCTGAAAGTTACCCCGAGTCAGTCTGTGAAGAGGATGTTACCTTAGCTCTGAAAGAGCTAGATGAAAGATGTGAA
GAAGAAGAAGCGGATTTCTCCGGACTGTCTAGTCAAGATGAAGAAGAGCAAGATGGTTTTCCAGAAGTACAGACGTCGCCTCTGCCGTCA
CCATTTCTTTCTGCCATCATAGCCGCCTTTCAGCCCGTGGCATATGATGATGAAGAGGAAGCCTGGCGCTGCCACGTCAATCAGATGCTG
TCTGACACCGACGGGTCCTCTGCAGTGTTTACTTTTCATGTGTTTTCTAGGCTGTTTCAGACAATTCAAAGAAAGTTTGGAGAAATAACT
AATGAGGCAGTCAGCTTTCTTGGTGATAGTCTGCAACGCATTGGTACCAAATTTAAAAGTTCCTTGGAAGTGATGATGCTGTGTTCAGAA
TGCCCAACAGTCTTTGTGGATGCTGAAACACTGATGTCATGTGGTTTGCTGGAAACACTCAAGTTTGGTGTTTTGGAGTTGCAAGAACAC
CTGGATACATACAATGTGAAAAGAGAAGCCGCTGAGCAGTGGCTAGATGATTGTAAGAGGACATTTGGTGCCAAAGAAGACATGTATAGG
ATAAACACAGATGCACAACAAATGGAAATACTAGCAGAATTGGAGCTCTGCCGAAGATTATACAAATTGCATTTTCAATTGCTGCTTCTG
TTCCAGGCCTACTGTAAACTTATCAACCAAGTAAATACGATAAAAAATGAAGCAGAGGTCATCAACATGTCAGAGGAACTTGCCCAACTG
GAAAGTATCCTCAAAGAAGCTGAGTCCGCTTCCGAAAACGAAGAAATTGACATTTCCAAAGCTGCACAAACTACTATAGAAACTGCCATT
CATTCTTTAATTGAAACTTTGAAAAATAAAGAATTTATATCAGCTGTAGCACAAGTCAAAGCTTTCAGATCTCTCTGGCCCAGTGATATC
TTTGGCAGTTGTGAAGATGACCCTGTACAGACACTGTTACATATATATTTCCATCATCAGACGCTGGGCCAGACAGGAAGCTTTGCAGTT
ATAGGCTCTAACCTGGACATGTCAGAAGCCAACTACAAACTGATGGAACTTAATCTGGAAATAAGAGAGTCTCTACGCATGGTGCAATCA

>In-frame_KMT2A_ENST00000389506_chr11_118355029_+_FRYL_ENST00000358350_chr4_48530355_-_6357nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGACACCAATTATT
GGAAACAAATATGGTGATCAGCACAGTGCGGCTGGAAGAAATGGGAAACCAAAAGTTATTGCTGTCACTAGAAGTACTTCCTCAACTTCT
TCTGGTTCTAATTCTAATGCCTTGGTTCCTGTTAGTTGGAAAAGGCCACAGTTATCACAGCGAAGAACAAGAGAAAAGCTAATGAATGTG
CTTTCTCTCTGTGGTCCAGAATCTGGCCTCCCAAAGAACCCATCAGTTGTATTTTCTTCTAATGAGGATTTGGAAGTCGGTGACCAACAG
ACTAGCCTAATTTCTACAACAGAAGACATAAATCAAGAGGAAGAAGTAGCTGTGGAAGATAATAGCAGTGAACAACAGTTTGGTGTTTTT
AAGGATTTTGACTTTTTAGATGTTGAATTGGAAGATGCAGAGGGTGAAAGTATGGACAATTTCAACTGGGGAGTTCGCAGGCGCTCACTG
GACAGTATTGACAAAGGGGACACTCCATCCCTCCAGGAGTACCAGTGCTCTAGTAGCACCCCCAGCCTGAACCTCACCAATCAGGAGGAT
ACAGATGAGTCCTCGGAAGAAGAAGCGGCACTTACAGCAAGCCAGATACTCTCACGCACACAGATGTTAAACAGTGATTCTGCCACTGAT
GAAACAATACCAGACCATCCTGACTTACTTCTCCAGTCTGAAGATTCCACTGGCAGCATCACAACAGAGGAAGTGCTTCAAATCAGGGAT
GAGACCCCAACTTTGGAGGCTTCTCTAGATAATGCTAACAGCCGGCTGCCTGAGGATACAACTTCAGTATTAAAGGAGGAACATGTTACA
ACCTTTGAAGATGAAGGATCCTATATAATTCAAGAACAGCAGGAATCTCTTGTGTGTCAAGGAATTCTTGATTTAGAAGAAACTGAAATG
CCAGAGCCTCTAGCTCCTGAAAGTTACCCCGAGTCAGTCTGTGAAGAGGATGTTACCTTAGCTCTGAAAGAGCTAGATGAAAGATGTGAA
GAAGAAGAAGCGGATTTCTCCGGACTGTCTAGTCAAGATGAAGAAGAGCAAGATGGTTTTCCAGAAGTACAGACGTCGCCTCTGCCGTCA
CCATTTCTTTCTGCCATCATAGCCGCCTTTCAGCCCGTGGCATATGATGATGAAGAGGAAGCCTGGCGCTGCCACGTCAATCAGATGCTG
TCTGACACCGACGGGTCCTCTGCAGTGTTTACTTTTCATGTGTTTTCTAGGCTGTTTCAGACAATTCAAAGAAAGTTTGGAGAAATAACT
AATGAGGCAGTCAGCTTTCTTGGTGATAGTCTGCAACGCATTGGTACCAAATTTAAAAGTTCCTTGGAAGTGATGATGCTGTGTTCAGAA
TGCCCAACAGTCTTTGTGGATGCTGAAACACTGATGTCATGTGGTTTGCTGGAAACACTCAAGTTTGGTGTTTTGGAGTTGCAAGAACAC
CTGGATACATACAATGTGAAAAGAGAAGCCGCTGAGCAGTGGCTAGATGATTGTAAGAGGACATTTGGTGCCAAAGAAGACATGTATAGG
ATAAACACAGATGCACAACAAATGGAAATACTAGCAGAATTGGAGCTCTGCCGAAGATTATACAAATTGCATTTTCAATTGCTGCTTCTG
TTCCAGGCCTACTGTAAACTTATCAACCAAGTAAATACGATAAAAAATGAAGCAGAGGTCATCAACATGTCAGAGGAACTTGCCCAACTG
GAAAGTATCCTCAAAGAAGCTGAGTCCGCTTCCGAAAACGAAGAAATTGACATTTCCAAAGCTGCACAAACTACTATAGAAACTGCCATT
CATTCTTTAATTGAAACTTTGAAAAATAAAGAATTTATATCAGCTGTAGCACAAGTCAAAGCTTTCAGATCTCTCTGGCCCAGTGATATC
TTTGGCAGTTGTGAAGATGACCCTGTACAGACACTGTTACATATATATTTCCATCATCAGACGCTGGGCCAGACAGGAAGCTTTGCAGTT
ATAGGCTCTAACCTGGACATGTCAGAAGCCAACTACAAACTGATGGAACTTAATCTGGAAATAAGAGAGTCTCTACGCATGGTGCAATCA

>In-frame_KMT2A_ENST00000389506_chr11_118355029_+_FRYL_ENST00000537810_chr4_48530355_-_6357nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGACACCAATTATT
GGAAACAAATATGGTGATCAGCACAGTGCGGCTGGAAGAAATGGGAAACCAAAAGTTATTGCTGTCACTAGAAGTACTTCCTCAACTTCT
TCTGGTTCTAATTCTAATGCCTTGGTTCCTGTTAGTTGGAAAAGGCCACAGTTATCACAGCGAAGAACAAGAGAAAAGCTAATGAATGTG
CTTTCTCTCTGTGGTCCAGAATCTGGCCTCCCAAAGAACCCATCAGTTGTATTTTCTTCTAATGAGGATTTGGAAGTCGGTGACCAACAG
ACTAGCCTAATTTCTACAACAGAAGACATAAATCAAGAGGAAGAAGTAGCTGTGGAAGATAATAGCAGTGAACAACAGTTTGGTGTTTTT
AAGGATTTTGACTTTTTAGATGTTGAATTGGAAGATGCAGAGGGTGAAAGTATGGACAATTTCAACTGGGGAGTTCGCAGGCGCTCACTG
GACAGTATTGACAAAGGGGACACTCCATCCCTCCAGGAGTACCAGTGCTCTAGTAGCACCCCCAGCCTGAACCTCACCAATCAGGAGGAT
ACAGATGAGTCCTCGGAAGAAGAAGCGGCACTTACAGCAAGCCAGATACTCTCACGCACACAGATGTTAAACAGTGATTCTGCCACTGAT
GAAACAATACCAGACCATCCTGACTTACTTCTCCAGTCTGAAGATTCCACTGGCAGCATCACAACAGAGGAAGTGCTTCAAATCAGGGAT
GAGACCCCAACTTTGGAGGCTTCTCTAGATAATGCTAACAGCCGGCTGCCTGAGGATACAACTTCAGTATTAAAGGAGGAACATGTTACA
ACCTTTGAAGATGAAGGATCCTATATAATTCAAGAACAGCAGGAATCTCTTGTGTGTCAAGGAATTCTTGATTTAGAAGAAACTGAAATG
CCAGAGCCTCTAGCTCCTGAAAGTTACCCCGAGTCAGTCTGTGAAGAGGATGTTACCTTAGCTCTGAAAGAGCTAGATGAAAGATGTGAA
GAAGAAGAAGCGGATTTCTCCGGACTGTCTAGTCAAGATGAAGAAGAGCAAGATGGTTTTCCAGAAGTACAGACGTCGCCTCTGCCGTCA
CCATTTCTTTCTGCCATCATAGCCGCCTTTCAGCCCGTGGCATATGATGATGAAGAGGAAGCCTGGCGCTGCCACGTCAATCAGATGCTG
TCTGACACCGACGGGTCCTCTGCAGTGTTTACTTTTCATGTGTTTTCTAGGCTGTTTCAGACAATTCAAAGAAAGTTTGGAGAAATAACT
AATGAGGCAGTCAGCTTTCTTGGTGATAGTCTGCAACGCATTGGTACCAAATTTAAAAGTTCCTTGGAAGTGATGATGCTGTGTTCAGAA
TGCCCAACAGTCTTTGTGGATGCTGAAACACTGATGTCATGTGGTTTGCTGGAAACACTCAAGTTTGGTGTTTTGGAGTTGCAAGAACAC
CTGGATACATACAATGTGAAAAGAGAAGCCGCTGAGCAGTGGCTAGATGATTGTAAGAGGACATTTGGTGCCAAAGAAGACATGTATAGG
ATAAACACAGATGCACAACTCAATGAAATACTGGTTGAATTGGAGCTCTGCCGAAGATTATACAAATTGCATTTTCAATTGCTGCTTCTG
TTCCAGGCCTACTGTAAACTTATCAACCAAGTAAATACGATAAAAAATGAAGCAGAGGTCATCAACATGTCAGAGGAACTTGCCCAACTG
GAAAGTATCCTCAAAGAAGCTGAGTCCGCTTCCGAAAACGAAGAAATTGACATTTCCAAAGCTGCACAAACTACTATAGAAACTGCCATT
CATTCTTTAATTGAAACTTTGAAAAATAAAGAATTTATATCAGCTGTAGCACAAGTCAAAGCTTTCAGATCTCTCTGGCCCAGTGATATC
TTTGGCAGTTGTGAAGATGACCCTGTACAGACACTGTTACATATATATTTCCATCATCAGACGCTGGGCCAGACAGGAAGCTTTGCAGTT
ATAGGCTCTAACCTGGACATGTCAGAAGCCAACTACAAACTGATGGAACTTAATCTGGAAATAAGAGAGTCTCTACGCATGGTGCAATCA

>In-frame_KMT2A_ENST00000354520_chr11_118355029_+_FRYL_ENST00000503238_chr4_48530355_-_6357nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGACACCAATTATT
GGAAACAAATATGGTGATCAGCACAGTGCGGCTGGAAGAAATGGGAAACCAAAAGTTATTGCTGTCACTAGAAGTACTTCCTCAACTTCT
TCTGGTTCTAATTCTAATGCCTTGGTTCCTGTTAGTTGGAAAAGGCCACAGTTATCACAGCGAAGAACAAGAGAAAAGCTAATGAATGTG
CTTTCTCTCTGTGGTCCAGAATCTGGCCTCCCAAAGAACCCATCAGTTGTATTTTCTTCTAATGAGGATTTGGAAGTCGGTGACCAACAG
ACTAGCCTAATTTCTACAACAGAAGACATAAATCAAGAGGAAGAAGTAGCTGTGGAAGATAATAGCAGTGAACAACAGTTTGGTGTTTTT
AAGGATTTTGACTTTTTAGATGTTGAATTGGAAGATGCAGAGGGTGAAAGTATGGACAATTTCAACTGGGGAGTTCGCAGGCGCTCACTG
GACAGTATTGACAAAGGGGACACTCCATCCCTCCAGGAGTACCAGTGCTCTAGTAGCACCCCCAGCCTGAACCTCACCAATCAGGAGGAT
ACAGATGAGTCCTCGGAAGAAGAAGCGGCACTTACAGCAAGCCAGATACTCTCACGCACACAGATGTTAAACAGTGATTCTGCCACTGAT
GAAACAATACCAGACCATCCTGACTTACTTCTCCAGTCTGAAGATTCCACTGGCAGCATCACAACAGAGGAAGTGCTTCAAATCAGGGAT
GAGACCCCAACTTTGGAGGCTTCTCTAGATAATGCTAACAGCCGGCTGCCTGAGGATACAACTTCAGTATTAAAGGAGGAACATGTTACA
ACCTTTGAAGATGAAGGATCCTATATAATTCAAGAACAGCAGGAATCTCTTGTGTGTCAAGGAATTCTTGATTTAGAAGAAACTGAAATG
CCAGAGCCTCTAGCTCCTGAAAGTTACCCCGAGTCAGTCTGTGAAGAGGATGTTACCTTAGCTCTGAAAGAGCTAGATGAAAGATGTGAA
GAAGAAGAAGCGGATTTCTCCGGACTGTCTAGTCAAGATGAAGAAGAGCAAGATGGTTTTCCAGAAGTACAGACGTCGCCTCTGCCGTCA
CCATTTCTTTCTGCCATCATAGCCGCCTTTCAGCCCGTGGCATATGATGATGAAGAGGAAGCCTGGCGCTGCCACGTCAATCAGATGCTG
TCTGACACCGACGGGTCCTCTGCAGTGTTTACTTTTCATGTGTTTTCTAGGCTGTTTCAGACAATTCAAAGAAAGTTTGGAGAAATAACT
AATGAGGCAGTCAGCTTTCTTGGTGATAGTCTGCAACGCATTGGTACCAAATTTAAAAGTTCCTTGGAAGTGATGATGCTGTGTTCAGAA
TGCCCAACAGTCTTTGTGGATGCTGAAACACTGATGTCATGTGGTTTGCTGGAAACACTCAAGTTTGGTGTTTTGGAGTTGCAAGAACAC
CTGGATACATACAATGTGAAAAGAGAAGCCGCTGAGCAGTGGCTAGATGATTGTAAGAGGACATTTGGTGCCAAAGAAGACATGTATAGG
ATAAACACAGATGCACAACAAATGGAAATACTAGCAGAATTGGAGCTCTGCCGAAGATTATACAAATTGCATTTTCAATTGCTGCTTCTG
TTCCAGGCCTACTGTAAACTTATCAACCAAGTAAATACGATAAAAAATGAAGCAGAGGTCATCAACATGTCAGAGGAACTTGCCCAACTG
GAAAGTATCCTCAAAGAAGCTGAGTCCGCTTCCGAAAACGAAGAAATTGACATTTCCAAAGCTGCACAAACTACTATAGAAACTGCCATT
CATTCTTTAATTGAAACTTTGAAAAATAAAGAATTTATATCAGCTGTAGCACAAGTCAAAGCTTTCAGATCTCTCTGGCCCAGTGATATC
TTTGGCAGTTGTGAAGATGACCCTGTACAGACACTGTTACATATATATTTCCATCATCAGACGCTGGGCCAGACAGGAAGCTTTGCAGTT
ATAGGCTCTAACCTGGACATGTCAGAAGCCAACTACAAACTGATGGAACTTAATCTGGAAATAAGAGAGTCTCTACGCATGGTGCAATCA

>In-frame_KMT2A_ENST00000354520_chr11_118355029_+_FRYL_ENST00000358350_chr4_48530355_-_6357nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGACACCAATTATT
GGAAACAAATATGGTGATCAGCACAGTGCGGCTGGAAGAAATGGGAAACCAAAAGTTATTGCTGTCACTAGAAGTACTTCCTCAACTTCT
TCTGGTTCTAATTCTAATGCCTTGGTTCCTGTTAGTTGGAAAAGGCCACAGTTATCACAGCGAAGAACAAGAGAAAAGCTAATGAATGTG
CTTTCTCTCTGTGGTCCAGAATCTGGCCTCCCAAAGAACCCATCAGTTGTATTTTCTTCTAATGAGGATTTGGAAGTCGGTGACCAACAG
ACTAGCCTAATTTCTACAACAGAAGACATAAATCAAGAGGAAGAAGTAGCTGTGGAAGATAATAGCAGTGAACAACAGTTTGGTGTTTTT
AAGGATTTTGACTTTTTAGATGTTGAATTGGAAGATGCAGAGGGTGAAAGTATGGACAATTTCAACTGGGGAGTTCGCAGGCGCTCACTG
GACAGTATTGACAAAGGGGACACTCCATCCCTCCAGGAGTACCAGTGCTCTAGTAGCACCCCCAGCCTGAACCTCACCAATCAGGAGGAT
ACAGATGAGTCCTCGGAAGAAGAAGCGGCACTTACAGCAAGCCAGATACTCTCACGCACACAGATGTTAAACAGTGATTCTGCCACTGAT
GAAACAATACCAGACCATCCTGACTTACTTCTCCAGTCTGAAGATTCCACTGGCAGCATCACAACAGAGGAAGTGCTTCAAATCAGGGAT
GAGACCCCAACTTTGGAGGCTTCTCTAGATAATGCTAACAGCCGGCTGCCTGAGGATACAACTTCAGTATTAAAGGAGGAACATGTTACA
ACCTTTGAAGATGAAGGATCCTATATAATTCAAGAACAGCAGGAATCTCTTGTGTGTCAAGGAATTCTTGATTTAGAAGAAACTGAAATG
CCAGAGCCTCTAGCTCCTGAAAGTTACCCCGAGTCAGTCTGTGAAGAGGATGTTACCTTAGCTCTGAAAGAGCTAGATGAAAGATGTGAA
GAAGAAGAAGCGGATTTCTCCGGACTGTCTAGTCAAGATGAAGAAGAGCAAGATGGTTTTCCAGAAGTACAGACGTCGCCTCTGCCGTCA
CCATTTCTTTCTGCCATCATAGCCGCCTTTCAGCCCGTGGCATATGATGATGAAGAGGAAGCCTGGCGCTGCCACGTCAATCAGATGCTG
TCTGACACCGACGGGTCCTCTGCAGTGTTTACTTTTCATGTGTTTTCTAGGCTGTTTCAGACAATTCAAAGAAAGTTTGGAGAAATAACT
AATGAGGCAGTCAGCTTTCTTGGTGATAGTCTGCAACGCATTGGTACCAAATTTAAAAGTTCCTTGGAAGTGATGATGCTGTGTTCAGAA
TGCCCAACAGTCTTTGTGGATGCTGAAACACTGATGTCATGTGGTTTGCTGGAAACACTCAAGTTTGGTGTTTTGGAGTTGCAAGAACAC
CTGGATACATACAATGTGAAAAGAGAAGCCGCTGAGCAGTGGCTAGATGATTGTAAGAGGACATTTGGTGCCAAAGAAGACATGTATAGG
ATAAACACAGATGCACAACAAATGGAAATACTAGCAGAATTGGAGCTCTGCCGAAGATTATACAAATTGCATTTTCAATTGCTGCTTCTG
TTCCAGGCCTACTGTAAACTTATCAACCAAGTAAATACGATAAAAAATGAAGCAGAGGTCATCAACATGTCAGAGGAACTTGCCCAACTG
GAAAGTATCCTCAAAGAAGCTGAGTCCGCTTCCGAAAACGAAGAAATTGACATTTCCAAAGCTGCACAAACTACTATAGAAACTGCCATT
CATTCTTTAATTGAAACTTTGAAAAATAAAGAATTTATATCAGCTGTAGCACAAGTCAAAGCTTTCAGATCTCTCTGGCCCAGTGATATC
TTTGGCAGTTGTGAAGATGACCCTGTACAGACACTGTTACATATATATTTCCATCATCAGACGCTGGGCCAGACAGGAAGCTTTGCAGTT
ATAGGCTCTAACCTGGACATGTCAGAAGCCAACTACAAACTGATGGAACTTAATCTGGAAATAAGAGAGTCTCTACGCATGGTGCAATCA

>In-frame_KMT2A_ENST00000354520_chr11_118355029_+_FRYL_ENST00000537810_chr4_48530355_-_6357nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGACACCAATTATT
GGAAACAAATATGGTGATCAGCACAGTGCGGCTGGAAGAAATGGGAAACCAAAAGTTATTGCTGTCACTAGAAGTACTTCCTCAACTTCT
TCTGGTTCTAATTCTAATGCCTTGGTTCCTGTTAGTTGGAAAAGGCCACAGTTATCACAGCGAAGAACAAGAGAAAAGCTAATGAATGTG
CTTTCTCTCTGTGGTCCAGAATCTGGCCTCCCAAAGAACCCATCAGTTGTATTTTCTTCTAATGAGGATTTGGAAGTCGGTGACCAACAG
ACTAGCCTAATTTCTACAACAGAAGACATAAATCAAGAGGAAGAAGTAGCTGTGGAAGATAATAGCAGTGAACAACAGTTTGGTGTTTTT
AAGGATTTTGACTTTTTAGATGTTGAATTGGAAGATGCAGAGGGTGAAAGTATGGACAATTTCAACTGGGGAGTTCGCAGGCGCTCACTG
GACAGTATTGACAAAGGGGACACTCCATCCCTCCAGGAGTACCAGTGCTCTAGTAGCACCCCCAGCCTGAACCTCACCAATCAGGAGGAT
ACAGATGAGTCCTCGGAAGAAGAAGCGGCACTTACAGCAAGCCAGATACTCTCACGCACACAGATGTTAAACAGTGATTCTGCCACTGAT
GAAACAATACCAGACCATCCTGACTTACTTCTCCAGTCTGAAGATTCCACTGGCAGCATCACAACAGAGGAAGTGCTTCAAATCAGGGAT
GAGACCCCAACTTTGGAGGCTTCTCTAGATAATGCTAACAGCCGGCTGCCTGAGGATACAACTTCAGTATTAAAGGAGGAACATGTTACA
ACCTTTGAAGATGAAGGATCCTATATAATTCAAGAACAGCAGGAATCTCTTGTGTGTCAAGGAATTCTTGATTTAGAAGAAACTGAAATG
CCAGAGCCTCTAGCTCCTGAAAGTTACCCCGAGTCAGTCTGTGAAGAGGATGTTACCTTAGCTCTGAAAGAGCTAGATGAAAGATGTGAA
GAAGAAGAAGCGGATTTCTCCGGACTGTCTAGTCAAGATGAAGAAGAGCAAGATGGTTTTCCAGAAGTACAGACGTCGCCTCTGCCGTCA
CCATTTCTTTCTGCCATCATAGCCGCCTTTCAGCCCGTGGCATATGATGATGAAGAGGAAGCCTGGCGCTGCCACGTCAATCAGATGCTG
TCTGACACCGACGGGTCCTCTGCAGTGTTTACTTTTCATGTGTTTTCTAGGCTGTTTCAGACAATTCAAAGAAAGTTTGGAGAAATAACT
AATGAGGCAGTCAGCTTTCTTGGTGATAGTCTGCAACGCATTGGTACCAAATTTAAAAGTTCCTTGGAAGTGATGATGCTGTGTTCAGAA
TGCCCAACAGTCTTTGTGGATGCTGAAACACTGATGTCATGTGGTTTGCTGGAAACACTCAAGTTTGGTGTTTTGGAGTTGCAAGAACAC
CTGGATACATACAATGTGAAAAGAGAAGCCGCTGAGCAGTGGCTAGATGATTGTAAGAGGACATTTGGTGCCAAAGAAGACATGTATAGG
ATAAACACAGATGCACAACTCAATGAAATACTGGTTGAATTGGAGCTCTGCCGAAGATTATACAAATTGCATTTTCAATTGCTGCTTCTG
TTCCAGGCCTACTGTAAACTTATCAACCAAGTAAATACGATAAAAAATGAAGCAGAGGTCATCAACATGTCAGAGGAACTTGCCCAACTG
GAAAGTATCCTCAAAGAAGCTGAGTCCGCTTCCGAAAACGAAGAAATTGACATTTCCAAAGCTGCACAAACTACTATAGAAACTGCCATT
CATTCTTTAATTGAAACTTTGAAAAATAAAGAATTTATATCAGCTGTAGCACAAGTCAAAGCTTTCAGATCTCTCTGGCCCAGTGATATC
TTTGGCAGTTGTGAAGATGACCCTGTACAGACACTGTTACATATATATTTCCATCATCAGACGCTGGGCCAGACAGGAAGCTTTGCAGTT
ATAGGCTCTAACCTGGACATGTCAGAAGCCAACTACAAACTGATGGAACTTAATCTGGAAATAAGAGAGTCTCTACGCATGGTGCAATCA

>In-frame_KMT2A_ENST00000534358_chr11_118355690_+_FRYL_ENST00000503238_chr4_48530355_-_6471nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGGAGGATTGTGAA
GCAGAAAATGTGTGGGAGATGGGAGGCTTAGGAATCTTGACTTCTGTTCCTATAACACCCAGGGTGGTTTGCTTTCTCTGTGCCAGTAGT
GGGCATGTAGAGACACCAATTATTGGAAACAAATATGGTGATCAGCACAGTGCGGCTGGAAGAAATGGGAAACCAAAAGTTATTGCTGTC
ACTAGAAGTACTTCCTCAACTTCTTCTGGTTCTAATTCTAATGCCTTGGTTCCTGTTAGTTGGAAAAGGCCACAGTTATCACAGCGAAGA
ACAAGAGAAAAGCTAATGAATGTGCTTTCTCTCTGTGGTCCAGAATCTGGCCTCCCAAAGAACCCATCAGTTGTATTTTCTTCTAATGAG
GATTTGGAAGTCGGTGACCAACAGACTAGCCTAATTTCTACAACAGAAGACATAAATCAAGAGGAAGAAGTAGCTGTGGAAGATAATAGC
AGTGAACAACAGTTTGGTGTTTTTAAGGATTTTGACTTTTTAGATGTTGAATTGGAAGATGCAGAGGGTGAAAGTATGGACAATTTCAAC
TGGGGAGTTCGCAGGCGCTCACTGGACAGTATTGACAAAGGGGACACTCCATCCCTCCAGGAGTACCAGTGCTCTAGTAGCACCCCCAGC
CTGAACCTCACCAATCAGGAGGATACAGATGAGTCCTCGGAAGAAGAAGCGGCACTTACAGCAAGCCAGATACTCTCACGCACACAGATG
TTAAACAGTGATTCTGCCACTGATGAAACAATACCAGACCATCCTGACTTACTTCTCCAGTCTGAAGATTCCACTGGCAGCATCACAACA
GAGGAAGTGCTTCAAATCAGGGATGAGACCCCAACTTTGGAGGCTTCTCTAGATAATGCTAACAGCCGGCTGCCTGAGGATACAACTTCA
GTATTAAAGGAGGAACATGTTACAACCTTTGAAGATGAAGGATCCTATATAATTCAAGAACAGCAGGAATCTCTTGTGTGTCAAGGAATT
CTTGATTTAGAAGAAACTGAAATGCCAGAGCCTCTAGCTCCTGAAAGTTACCCCGAGTCAGTCTGTGAAGAGGATGTTACCTTAGCTCTG
AAAGAGCTAGATGAAAGATGTGAAGAAGAAGAAGCGGATTTCTCCGGACTGTCTAGTCAAGATGAAGAAGAGCAAGATGGTTTTCCAGAA
GTACAGACGTCGCCTCTGCCGTCACCATTTCTTTCTGCCATCATAGCCGCCTTTCAGCCCGTGGCATATGATGATGAAGAGGAAGCCTGG
CGCTGCCACGTCAATCAGATGCTGTCTGACACCGACGGGTCCTCTGCAGTGTTTACTTTTCATGTGTTTTCTAGGCTGTTTCAGACAATT
CAAAGAAAGTTTGGAGAAATAACTAATGAGGCAGTCAGCTTTCTTGGTGATAGTCTGCAACGCATTGGTACCAAATTTAAAAGTTCCTTG
GAAGTGATGATGCTGTGTTCAGAATGCCCAACAGTCTTTGTGGATGCTGAAACACTGATGTCATGTGGTTTGCTGGAAACACTCAAGTTT
GGTGTTTTGGAGTTGCAAGAACACCTGGATACATACAATGTGAAAAGAGAAGCCGCTGAGCAGTGGCTAGATGATTGTAAGAGGACATTT
GGTGCCAAAGAAGACATGTATAGGATAAACACAGATGCACAACAAATGGAAATACTAGCAGAATTGGAGCTCTGCCGAAGATTATACAAA
TTGCATTTTCAATTGCTGCTTCTGTTCCAGGCCTACTGTAAACTTATCAACCAAGTAAATACGATAAAAAATGAAGCAGAGGTCATCAAC
ATGTCAGAGGAACTTGCCCAACTGGAAAGTATCCTCAAAGAAGCTGAGTCCGCTTCCGAAAACGAAGAAATTGACATTTCCAAAGCTGCA
CAAACTACTATAGAAACTGCCATTCATTCTTTAATTGAAACTTTGAAAAATAAAGAATTTATATCAGCTGTAGCACAAGTCAAAGCTTTC
AGATCTCTCTGGCCCAGTGATATCTTTGGCAGTTGTGAAGATGACCCTGTACAGACACTGTTACATATATATTTCCATCATCAGACGCTG
GGCCAGACAGGAAGCTTTGCAGTTATAGGCTCTAACCTGGACATGTCAGAAGCCAACTACAAACTGATGGAACTTAATCTGGAAATAAGA

>In-frame_KMT2A_ENST00000534358_chr11_118355690_+_FRYL_ENST00000358350_chr4_48530355_-_6471nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGGAGGATTGTGAA
GCAGAAAATGTGTGGGAGATGGGAGGCTTAGGAATCTTGACTTCTGTTCCTATAACACCCAGGGTGGTTTGCTTTCTCTGTGCCAGTAGT
GGGCATGTAGAGACACCAATTATTGGAAACAAATATGGTGATCAGCACAGTGCGGCTGGAAGAAATGGGAAACCAAAAGTTATTGCTGTC
ACTAGAAGTACTTCCTCAACTTCTTCTGGTTCTAATTCTAATGCCTTGGTTCCTGTTAGTTGGAAAAGGCCACAGTTATCACAGCGAAGA
ACAAGAGAAAAGCTAATGAATGTGCTTTCTCTCTGTGGTCCAGAATCTGGCCTCCCAAAGAACCCATCAGTTGTATTTTCTTCTAATGAG
GATTTGGAAGTCGGTGACCAACAGACTAGCCTAATTTCTACAACAGAAGACATAAATCAAGAGGAAGAAGTAGCTGTGGAAGATAATAGC
AGTGAACAACAGTTTGGTGTTTTTAAGGATTTTGACTTTTTAGATGTTGAATTGGAAGATGCAGAGGGTGAAAGTATGGACAATTTCAAC
TGGGGAGTTCGCAGGCGCTCACTGGACAGTATTGACAAAGGGGACACTCCATCCCTCCAGGAGTACCAGTGCTCTAGTAGCACCCCCAGC
CTGAACCTCACCAATCAGGAGGATACAGATGAGTCCTCGGAAGAAGAAGCGGCACTTACAGCAAGCCAGATACTCTCACGCACACAGATG
TTAAACAGTGATTCTGCCACTGATGAAACAATACCAGACCATCCTGACTTACTTCTCCAGTCTGAAGATTCCACTGGCAGCATCACAACA
GAGGAAGTGCTTCAAATCAGGGATGAGACCCCAACTTTGGAGGCTTCTCTAGATAATGCTAACAGCCGGCTGCCTGAGGATACAACTTCA
GTATTAAAGGAGGAACATGTTACAACCTTTGAAGATGAAGGATCCTATATAATTCAAGAACAGCAGGAATCTCTTGTGTGTCAAGGAATT
CTTGATTTAGAAGAAACTGAAATGCCAGAGCCTCTAGCTCCTGAAAGTTACCCCGAGTCAGTCTGTGAAGAGGATGTTACCTTAGCTCTG
AAAGAGCTAGATGAAAGATGTGAAGAAGAAGAAGCGGATTTCTCCGGACTGTCTAGTCAAGATGAAGAAGAGCAAGATGGTTTTCCAGAA
GTACAGACGTCGCCTCTGCCGTCACCATTTCTTTCTGCCATCATAGCCGCCTTTCAGCCCGTGGCATATGATGATGAAGAGGAAGCCTGG
CGCTGCCACGTCAATCAGATGCTGTCTGACACCGACGGGTCCTCTGCAGTGTTTACTTTTCATGTGTTTTCTAGGCTGTTTCAGACAATT
CAAAGAAAGTTTGGAGAAATAACTAATGAGGCAGTCAGCTTTCTTGGTGATAGTCTGCAACGCATTGGTACCAAATTTAAAAGTTCCTTG
GAAGTGATGATGCTGTGTTCAGAATGCCCAACAGTCTTTGTGGATGCTGAAACACTGATGTCATGTGGTTTGCTGGAAACACTCAAGTTT
GGTGTTTTGGAGTTGCAAGAACACCTGGATACATACAATGTGAAAAGAGAAGCCGCTGAGCAGTGGCTAGATGATTGTAAGAGGACATTT
GGTGCCAAAGAAGACATGTATAGGATAAACACAGATGCACAACAAATGGAAATACTAGCAGAATTGGAGCTCTGCCGAAGATTATACAAA
TTGCATTTTCAATTGCTGCTTCTGTTCCAGGCCTACTGTAAACTTATCAACCAAGTAAATACGATAAAAAATGAAGCAGAGGTCATCAAC
ATGTCAGAGGAACTTGCCCAACTGGAAAGTATCCTCAAAGAAGCTGAGTCCGCTTCCGAAAACGAAGAAATTGACATTTCCAAAGCTGCA
CAAACTACTATAGAAACTGCCATTCATTCTTTAATTGAAACTTTGAAAAATAAAGAATTTATATCAGCTGTAGCACAAGTCAAAGCTTTC
AGATCTCTCTGGCCCAGTGATATCTTTGGCAGTTGTGAAGATGACCCTGTACAGACACTGTTACATATATATTTCCATCATCAGACGCTG
GGCCAGACAGGAAGCTTTGCAGTTATAGGCTCTAACCTGGACATGTCAGAAGCCAACTACAAACTGATGGAACTTAATCTGGAAATAAGA

>In-frame_KMT2A_ENST00000534358_chr11_118355690_+_FRYL_ENST00000537810_chr4_48530355_-_6471nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGGAGGATTGTGAA
GCAGAAAATGTGTGGGAGATGGGAGGCTTAGGAATCTTGACTTCTGTTCCTATAACACCCAGGGTGGTTTGCTTTCTCTGTGCCAGTAGT
GGGCATGTAGAGACACCAATTATTGGAAACAAATATGGTGATCAGCACAGTGCGGCTGGAAGAAATGGGAAACCAAAAGTTATTGCTGTC
ACTAGAAGTACTTCCTCAACTTCTTCTGGTTCTAATTCTAATGCCTTGGTTCCTGTTAGTTGGAAAAGGCCACAGTTATCACAGCGAAGA
ACAAGAGAAAAGCTAATGAATGTGCTTTCTCTCTGTGGTCCAGAATCTGGCCTCCCAAAGAACCCATCAGTTGTATTTTCTTCTAATGAG
GATTTGGAAGTCGGTGACCAACAGACTAGCCTAATTTCTACAACAGAAGACATAAATCAAGAGGAAGAAGTAGCTGTGGAAGATAATAGC
AGTGAACAACAGTTTGGTGTTTTTAAGGATTTTGACTTTTTAGATGTTGAATTGGAAGATGCAGAGGGTGAAAGTATGGACAATTTCAAC
TGGGGAGTTCGCAGGCGCTCACTGGACAGTATTGACAAAGGGGACACTCCATCCCTCCAGGAGTACCAGTGCTCTAGTAGCACCCCCAGC
CTGAACCTCACCAATCAGGAGGATACAGATGAGTCCTCGGAAGAAGAAGCGGCACTTACAGCAAGCCAGATACTCTCACGCACACAGATG
TTAAACAGTGATTCTGCCACTGATGAAACAATACCAGACCATCCTGACTTACTTCTCCAGTCTGAAGATTCCACTGGCAGCATCACAACA
GAGGAAGTGCTTCAAATCAGGGATGAGACCCCAACTTTGGAGGCTTCTCTAGATAATGCTAACAGCCGGCTGCCTGAGGATACAACTTCA
GTATTAAAGGAGGAACATGTTACAACCTTTGAAGATGAAGGATCCTATATAATTCAAGAACAGCAGGAATCTCTTGTGTGTCAAGGAATT
CTTGATTTAGAAGAAACTGAAATGCCAGAGCCTCTAGCTCCTGAAAGTTACCCCGAGTCAGTCTGTGAAGAGGATGTTACCTTAGCTCTG
AAAGAGCTAGATGAAAGATGTGAAGAAGAAGAAGCGGATTTCTCCGGACTGTCTAGTCAAGATGAAGAAGAGCAAGATGGTTTTCCAGAA
GTACAGACGTCGCCTCTGCCGTCACCATTTCTTTCTGCCATCATAGCCGCCTTTCAGCCCGTGGCATATGATGATGAAGAGGAAGCCTGG
CGCTGCCACGTCAATCAGATGCTGTCTGACACCGACGGGTCCTCTGCAGTGTTTACTTTTCATGTGTTTTCTAGGCTGTTTCAGACAATT
CAAAGAAAGTTTGGAGAAATAACTAATGAGGCAGTCAGCTTTCTTGGTGATAGTCTGCAACGCATTGGTACCAAATTTAAAAGTTCCTTG
GAAGTGATGATGCTGTGTTCAGAATGCCCAACAGTCTTTGTGGATGCTGAAACACTGATGTCATGTGGTTTGCTGGAAACACTCAAGTTT
GGTGTTTTGGAGTTGCAAGAACACCTGGATACATACAATGTGAAAAGAGAAGCCGCTGAGCAGTGGCTAGATGATTGTAAGAGGACATTT
GGTGCCAAAGAAGACATGTATAGGATAAACACAGATGCACAACTCAATGAAATACTGGTTGAATTGGAGCTCTGCCGAAGATTATACAAA
TTGCATTTTCAATTGCTGCTTCTGTTCCAGGCCTACTGTAAACTTATCAACCAAGTAAATACGATAAAAAATGAAGCAGAGGTCATCAAC
ATGTCAGAGGAACTTGCCCAACTGGAAAGTATCCTCAAAGAAGCTGAGTCCGCTTCCGAAAACGAAGAAATTGACATTTCCAAAGCTGCA
CAAACTACTATAGAAACTGCCATTCATTCTTTAATTGAAACTTTGAAAAATAAAGAATTTATATCAGCTGTAGCACAAGTCAAAGCTTTC
AGATCTCTCTGGCCCAGTGATATCTTTGGCAGTTGTGAAGATGACCCTGTACAGACACTGTTACATATATATTTCCATCATCAGACGCTG
GGCCAGACAGGAAGCTTTGCAGTTATAGGCTCTAACCTGGACATGTCAGAAGCCAACTACAAACTGATGGAACTTAATCTGGAAATAAGA

>In-frame_KMT2A_ENST00000389506_chr11_118355690_+_FRYL_ENST00000503238_chr4_48530355_-_6471nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGGAGGATTGTGAA
GCAGAAAATGTGTGGGAGATGGGAGGCTTAGGAATCTTGACTTCTGTTCCTATAACACCCAGGGTGGTTTGCTTTCTCTGTGCCAGTAGT
GGGCATGTAGAGACACCAATTATTGGAAACAAATATGGTGATCAGCACAGTGCGGCTGGAAGAAATGGGAAACCAAAAGTTATTGCTGTC
ACTAGAAGTACTTCCTCAACTTCTTCTGGTTCTAATTCTAATGCCTTGGTTCCTGTTAGTTGGAAAAGGCCACAGTTATCACAGCGAAGA
ACAAGAGAAAAGCTAATGAATGTGCTTTCTCTCTGTGGTCCAGAATCTGGCCTCCCAAAGAACCCATCAGTTGTATTTTCTTCTAATGAG
GATTTGGAAGTCGGTGACCAACAGACTAGCCTAATTTCTACAACAGAAGACATAAATCAAGAGGAAGAAGTAGCTGTGGAAGATAATAGC
AGTGAACAACAGTTTGGTGTTTTTAAGGATTTTGACTTTTTAGATGTTGAATTGGAAGATGCAGAGGGTGAAAGTATGGACAATTTCAAC
TGGGGAGTTCGCAGGCGCTCACTGGACAGTATTGACAAAGGGGACACTCCATCCCTCCAGGAGTACCAGTGCTCTAGTAGCACCCCCAGC
CTGAACCTCACCAATCAGGAGGATACAGATGAGTCCTCGGAAGAAGAAGCGGCACTTACAGCAAGCCAGATACTCTCACGCACACAGATG
TTAAACAGTGATTCTGCCACTGATGAAACAATACCAGACCATCCTGACTTACTTCTCCAGTCTGAAGATTCCACTGGCAGCATCACAACA
GAGGAAGTGCTTCAAATCAGGGATGAGACCCCAACTTTGGAGGCTTCTCTAGATAATGCTAACAGCCGGCTGCCTGAGGATACAACTTCA
GTATTAAAGGAGGAACATGTTACAACCTTTGAAGATGAAGGATCCTATATAATTCAAGAACAGCAGGAATCTCTTGTGTGTCAAGGAATT
CTTGATTTAGAAGAAACTGAAATGCCAGAGCCTCTAGCTCCTGAAAGTTACCCCGAGTCAGTCTGTGAAGAGGATGTTACCTTAGCTCTG
AAAGAGCTAGATGAAAGATGTGAAGAAGAAGAAGCGGATTTCTCCGGACTGTCTAGTCAAGATGAAGAAGAGCAAGATGGTTTTCCAGAA
GTACAGACGTCGCCTCTGCCGTCACCATTTCTTTCTGCCATCATAGCCGCCTTTCAGCCCGTGGCATATGATGATGAAGAGGAAGCCTGG
CGCTGCCACGTCAATCAGATGCTGTCTGACACCGACGGGTCCTCTGCAGTGTTTACTTTTCATGTGTTTTCTAGGCTGTTTCAGACAATT
CAAAGAAAGTTTGGAGAAATAACTAATGAGGCAGTCAGCTTTCTTGGTGATAGTCTGCAACGCATTGGTACCAAATTTAAAAGTTCCTTG
GAAGTGATGATGCTGTGTTCAGAATGCCCAACAGTCTTTGTGGATGCTGAAACACTGATGTCATGTGGTTTGCTGGAAACACTCAAGTTT
GGTGTTTTGGAGTTGCAAGAACACCTGGATACATACAATGTGAAAAGAGAAGCCGCTGAGCAGTGGCTAGATGATTGTAAGAGGACATTT
GGTGCCAAAGAAGACATGTATAGGATAAACACAGATGCACAACAAATGGAAATACTAGCAGAATTGGAGCTCTGCCGAAGATTATACAAA
TTGCATTTTCAATTGCTGCTTCTGTTCCAGGCCTACTGTAAACTTATCAACCAAGTAAATACGATAAAAAATGAAGCAGAGGTCATCAAC
ATGTCAGAGGAACTTGCCCAACTGGAAAGTATCCTCAAAGAAGCTGAGTCCGCTTCCGAAAACGAAGAAATTGACATTTCCAAAGCTGCA
CAAACTACTATAGAAACTGCCATTCATTCTTTAATTGAAACTTTGAAAAATAAAGAATTTATATCAGCTGTAGCACAAGTCAAAGCTTTC
AGATCTCTCTGGCCCAGTGATATCTTTGGCAGTTGTGAAGATGACCCTGTACAGACACTGTTACATATATATTTCCATCATCAGACGCTG
GGCCAGACAGGAAGCTTTGCAGTTATAGGCTCTAACCTGGACATGTCAGAAGCCAACTACAAACTGATGGAACTTAATCTGGAAATAAGA

>In-frame_KMT2A_ENST00000389506_chr11_118355690_+_FRYL_ENST00000358350_chr4_48530355_-_6471nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGGAGGATTGTGAA
GCAGAAAATGTGTGGGAGATGGGAGGCTTAGGAATCTTGACTTCTGTTCCTATAACACCCAGGGTGGTTTGCTTTCTCTGTGCCAGTAGT
GGGCATGTAGAGACACCAATTATTGGAAACAAATATGGTGATCAGCACAGTGCGGCTGGAAGAAATGGGAAACCAAAAGTTATTGCTGTC
ACTAGAAGTACTTCCTCAACTTCTTCTGGTTCTAATTCTAATGCCTTGGTTCCTGTTAGTTGGAAAAGGCCACAGTTATCACAGCGAAGA
ACAAGAGAAAAGCTAATGAATGTGCTTTCTCTCTGTGGTCCAGAATCTGGCCTCCCAAAGAACCCATCAGTTGTATTTTCTTCTAATGAG
GATTTGGAAGTCGGTGACCAACAGACTAGCCTAATTTCTACAACAGAAGACATAAATCAAGAGGAAGAAGTAGCTGTGGAAGATAATAGC
AGTGAACAACAGTTTGGTGTTTTTAAGGATTTTGACTTTTTAGATGTTGAATTGGAAGATGCAGAGGGTGAAAGTATGGACAATTTCAAC
TGGGGAGTTCGCAGGCGCTCACTGGACAGTATTGACAAAGGGGACACTCCATCCCTCCAGGAGTACCAGTGCTCTAGTAGCACCCCCAGC
CTGAACCTCACCAATCAGGAGGATACAGATGAGTCCTCGGAAGAAGAAGCGGCACTTACAGCAAGCCAGATACTCTCACGCACACAGATG
TTAAACAGTGATTCTGCCACTGATGAAACAATACCAGACCATCCTGACTTACTTCTCCAGTCTGAAGATTCCACTGGCAGCATCACAACA
GAGGAAGTGCTTCAAATCAGGGATGAGACCCCAACTTTGGAGGCTTCTCTAGATAATGCTAACAGCCGGCTGCCTGAGGATACAACTTCA
GTATTAAAGGAGGAACATGTTACAACCTTTGAAGATGAAGGATCCTATATAATTCAAGAACAGCAGGAATCTCTTGTGTGTCAAGGAATT
CTTGATTTAGAAGAAACTGAAATGCCAGAGCCTCTAGCTCCTGAAAGTTACCCCGAGTCAGTCTGTGAAGAGGATGTTACCTTAGCTCTG
AAAGAGCTAGATGAAAGATGTGAAGAAGAAGAAGCGGATTTCTCCGGACTGTCTAGTCAAGATGAAGAAGAGCAAGATGGTTTTCCAGAA
GTACAGACGTCGCCTCTGCCGTCACCATTTCTTTCTGCCATCATAGCCGCCTTTCAGCCCGTGGCATATGATGATGAAGAGGAAGCCTGG
CGCTGCCACGTCAATCAGATGCTGTCTGACACCGACGGGTCCTCTGCAGTGTTTACTTTTCATGTGTTTTCTAGGCTGTTTCAGACAATT
CAAAGAAAGTTTGGAGAAATAACTAATGAGGCAGTCAGCTTTCTTGGTGATAGTCTGCAACGCATTGGTACCAAATTTAAAAGTTCCTTG
GAAGTGATGATGCTGTGTTCAGAATGCCCAACAGTCTTTGTGGATGCTGAAACACTGATGTCATGTGGTTTGCTGGAAACACTCAAGTTT
GGTGTTTTGGAGTTGCAAGAACACCTGGATACATACAATGTGAAAAGAGAAGCCGCTGAGCAGTGGCTAGATGATTGTAAGAGGACATTT
GGTGCCAAAGAAGACATGTATAGGATAAACACAGATGCACAACAAATGGAAATACTAGCAGAATTGGAGCTCTGCCGAAGATTATACAAA
TTGCATTTTCAATTGCTGCTTCTGTTCCAGGCCTACTGTAAACTTATCAACCAAGTAAATACGATAAAAAATGAAGCAGAGGTCATCAAC
ATGTCAGAGGAACTTGCCCAACTGGAAAGTATCCTCAAAGAAGCTGAGTCCGCTTCCGAAAACGAAGAAATTGACATTTCCAAAGCTGCA
CAAACTACTATAGAAACTGCCATTCATTCTTTAATTGAAACTTTGAAAAATAAAGAATTTATATCAGCTGTAGCACAAGTCAAAGCTTTC
AGATCTCTCTGGCCCAGTGATATCTTTGGCAGTTGTGAAGATGACCCTGTACAGACACTGTTACATATATATTTCCATCATCAGACGCTG
GGCCAGACAGGAAGCTTTGCAGTTATAGGCTCTAACCTGGACATGTCAGAAGCCAACTACAAACTGATGGAACTTAATCTGGAAATAAGA

>In-frame_KMT2A_ENST00000389506_chr11_118355690_+_FRYL_ENST00000537810_chr4_48530355_-_6471nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGGAGGATTGTGAA
GCAGAAAATGTGTGGGAGATGGGAGGCTTAGGAATCTTGACTTCTGTTCCTATAACACCCAGGGTGGTTTGCTTTCTCTGTGCCAGTAGT
GGGCATGTAGAGACACCAATTATTGGAAACAAATATGGTGATCAGCACAGTGCGGCTGGAAGAAATGGGAAACCAAAAGTTATTGCTGTC
ACTAGAAGTACTTCCTCAACTTCTTCTGGTTCTAATTCTAATGCCTTGGTTCCTGTTAGTTGGAAAAGGCCACAGTTATCACAGCGAAGA
ACAAGAGAAAAGCTAATGAATGTGCTTTCTCTCTGTGGTCCAGAATCTGGCCTCCCAAAGAACCCATCAGTTGTATTTTCTTCTAATGAG
GATTTGGAAGTCGGTGACCAACAGACTAGCCTAATTTCTACAACAGAAGACATAAATCAAGAGGAAGAAGTAGCTGTGGAAGATAATAGC
AGTGAACAACAGTTTGGTGTTTTTAAGGATTTTGACTTTTTAGATGTTGAATTGGAAGATGCAGAGGGTGAAAGTATGGACAATTTCAAC
TGGGGAGTTCGCAGGCGCTCACTGGACAGTATTGACAAAGGGGACACTCCATCCCTCCAGGAGTACCAGTGCTCTAGTAGCACCCCCAGC
CTGAACCTCACCAATCAGGAGGATACAGATGAGTCCTCGGAAGAAGAAGCGGCACTTACAGCAAGCCAGATACTCTCACGCACACAGATG
TTAAACAGTGATTCTGCCACTGATGAAACAATACCAGACCATCCTGACTTACTTCTCCAGTCTGAAGATTCCACTGGCAGCATCACAACA
GAGGAAGTGCTTCAAATCAGGGATGAGACCCCAACTTTGGAGGCTTCTCTAGATAATGCTAACAGCCGGCTGCCTGAGGATACAACTTCA
GTATTAAAGGAGGAACATGTTACAACCTTTGAAGATGAAGGATCCTATATAATTCAAGAACAGCAGGAATCTCTTGTGTGTCAAGGAATT
CTTGATTTAGAAGAAACTGAAATGCCAGAGCCTCTAGCTCCTGAAAGTTACCCCGAGTCAGTCTGTGAAGAGGATGTTACCTTAGCTCTG
AAAGAGCTAGATGAAAGATGTGAAGAAGAAGAAGCGGATTTCTCCGGACTGTCTAGTCAAGATGAAGAAGAGCAAGATGGTTTTCCAGAA
GTACAGACGTCGCCTCTGCCGTCACCATTTCTTTCTGCCATCATAGCCGCCTTTCAGCCCGTGGCATATGATGATGAAGAGGAAGCCTGG
CGCTGCCACGTCAATCAGATGCTGTCTGACACCGACGGGTCCTCTGCAGTGTTTACTTTTCATGTGTTTTCTAGGCTGTTTCAGACAATT
CAAAGAAAGTTTGGAGAAATAACTAATGAGGCAGTCAGCTTTCTTGGTGATAGTCTGCAACGCATTGGTACCAAATTTAAAAGTTCCTTG
GAAGTGATGATGCTGTGTTCAGAATGCCCAACAGTCTTTGTGGATGCTGAAACACTGATGTCATGTGGTTTGCTGGAAACACTCAAGTTT
GGTGTTTTGGAGTTGCAAGAACACCTGGATACATACAATGTGAAAAGAGAAGCCGCTGAGCAGTGGCTAGATGATTGTAAGAGGACATTT
GGTGCCAAAGAAGACATGTATAGGATAAACACAGATGCACAACTCAATGAAATACTGGTTGAATTGGAGCTCTGCCGAAGATTATACAAA
TTGCATTTTCAATTGCTGCTTCTGTTCCAGGCCTACTGTAAACTTATCAACCAAGTAAATACGATAAAAAATGAAGCAGAGGTCATCAAC
ATGTCAGAGGAACTTGCCCAACTGGAAAGTATCCTCAAAGAAGCTGAGTCCGCTTCCGAAAACGAAGAAATTGACATTTCCAAAGCTGCA
CAAACTACTATAGAAACTGCCATTCATTCTTTAATTGAAACTTTGAAAAATAAAGAATTTATATCAGCTGTAGCACAAGTCAAAGCTTTC
AGATCTCTCTGGCCCAGTGATATCTTTGGCAGTTGTGAAGATGACCCTGTACAGACACTGTTACATATATATTTCCATCATCAGACGCTG
GGCCAGACAGGAAGCTTTGCAGTTATAGGCTCTAACCTGGACATGTCAGAAGCCAACTACAAACTGATGGAACTTAATCTGGAAATAAGA


* Fusion transcript sequences (Full-length transcript).
>In-frame_KMT2A_ENST00000534358_chr11_118355029_+_FRYL_ENST00000503238_chr4_48530355_-_8441nt
CTGCTTCACTTCACGGGGCGAACATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGG
GGCGCCGGGGCCTAGGGGGCGCCCCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGG
CGCCCCCCTCCCCCCCGGCTGTGGCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAG
CAGCCTCCTCGTCGTCCGCCTCGTCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCG
ACGCGGCGCTGCAGGTCTCGGCCGCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCG
GAGAGGATGAGCAATTCTTAGGTTTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTC
GAAAACCTCGTGGGAGACCTAGAAGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAG
AGACCAAATCTGGAGATAAGATCAAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAA
TCAAAATAACACATGGAAAGGACATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTA
CGTTTCAGCAAGCCACAAAGATTAAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAG
GAAGGAAGGGGGTACAAATTGTACGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTG
AACTGGAAAAGCCCCAGAAAGTCCGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTC
GAAGGATTAAGCCAGTTAGGATTATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGG
CTCAAAAGAAAATTGAAAAAGAAGCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTG
TTGTCAGTGCTATCTCCTCGCGGATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGAT
TAGAGTCTACACCGAATAGTAGATTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGT
CTTCAGACTCCTCTCGATCTAGTAGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGC
GGAGCGATACCCCTGAAGTTCATCCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAG
TGTCGGAGAGAAGTTTTGGATCTAGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTC
CACCTCTGCTGACTCCACCGCCACCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAG
CATCACCATTTTTGCCTGCTTCCACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAA
AGCATTCTAGGTCAGAGCCACAATACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGAC
CCCCTCCACTAACTCCCGAGGACGTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCC
ATTCTGGAACAAGGTTTGATATGCACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTG
AGTCTGTAACCTTGCCTAGTAATCGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTC
CTATTCGATCTGAACCAAGATCTCCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCC
CGTCTTCTGTCTCTTCCTCGTTAAGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCC
TGACTCAGTCTGGGGAATCTGCAGAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTA
CTCCTCTCTTCCCTTGGTTTACCCCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAG
ATGCTGACAAGAGCGTGGAGAAGGACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAA
GGAAAAAGGGATCAGAAATTCAGAGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCA
CTTCATCTTCTGCCAAAAAAGCAACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATA
CAACAGCTGTCAAAACCAAAATACTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCC
TGGAGAAGGAGAAAACCCTCTGCCTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGG
CAGACAAGCTTCCAATGACTGACAAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTC
TTAAACAAACCGACCAGCCCAAAGCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCA
GAAGAGCAGCTGTTGCCCTTGGCCGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAA
AGATTTTGTCTTCCATGGGGAATGATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTA
AACCTGTCACTAGAAACAAGGCACCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGG
TGCCTGAGGACTGTGGTGTTTGTACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAA
AATGTCAGAATCTACAATGGATGCCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCA
GTGAAAAGAAAGACAGCAAAGAGAGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTG
CCCCAAAGAAAAGCAGTAGTGAGCCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAAT
CCAAACAGGCCACCACTCCAGCTTCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAG
GACCGCCAAGAAAAGAAGTTCCCAAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCA
AACAGAAAAAAGTGGCTCCCCGCCCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGA
ATGCAGGCACTTTGAACATCCTCAGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAG
TGGACTTTAAGACACCAATTATTGGAAACAAATATGGTGATCAGCACAGTGCGGCTGGAAGAAATGGGAAACCAAAAGTTATTGCTGTCA
CTAGAAGTACTTCCTCAACTTCTTCTGGTTCTAATTCTAATGCCTTGGTTCCTGTTAGTTGGAAAAGGCCACAGTTATCACAGCGAAGAA
CAAGAGAAAAGCTAATGAATGTGCTTTCTCTCTGTGGTCCAGAATCTGGCCTCCCAAAGAACCCATCAGTTGTATTTTCTTCTAATGAGG
ATTTGGAAGTCGGTGACCAACAGACTAGCCTAATTTCTACAACAGAAGACATAAATCAAGAGGAAGAAGTAGCTGTGGAAGATAATAGCA
GTGAACAACAGTTTGGTGTTTTTAAGGATTTTGACTTTTTAGATGTTGAATTGGAAGATGCAGAGGGTGAAAGTATGGACAATTTCAACT
GGGGAGTTCGCAGGCGCTCACTGGACAGTATTGACAAAGGGGACACTCCATCCCTCCAGGAGTACCAGTGCTCTAGTAGCACCCCCAGCC
TGAACCTCACCAATCAGGAGGATACAGATGAGTCCTCGGAAGAAGAAGCGGCACTTACAGCAAGCCAGATACTCTCACGCACACAGATGT
TAAACAGTGATTCTGCCACTGATGAAACAATACCAGACCATCCTGACTTACTTCTCCAGTCTGAAGATTCCACTGGCAGCATCACAACAG
AGGAAGTGCTTCAAATCAGGGATGAGACCCCAACTTTGGAGGCTTCTCTAGATAATGCTAACAGCCGGCTGCCTGAGGATACAACTTCAG
TATTAAAGGAGGAACATGTTACAACCTTTGAAGATGAAGGATCCTATATAATTCAAGAACAGCAGGAATCTCTTGTGTGTCAAGGAATTC
TTGATTTAGAAGAAACTGAAATGCCAGAGCCTCTAGCTCCTGAAAGTTACCCCGAGTCAGTCTGTGAAGAGGATGTTACCTTAGCTCTGA
AAGAGCTAGATGAAAGATGTGAAGAAGAAGAAGCGGATTTCTCCGGACTGTCTAGTCAAGATGAAGAAGAGCAAGATGGTTTTCCAGAAG
TACAGACGTCGCCTCTGCCGTCACCATTTCTTTCTGCCATCATAGCCGCCTTTCAGCCCGTGGCATATGATGATGAAGAGGAAGCCTGGC
GCTGCCACGTCAATCAGATGCTGTCTGACACCGACGGGTCCTCTGCAGTGTTTACTTTTCATGTGTTTTCTAGGCTGTTTCAGACAATTC
AAAGAAAGTTTGGAGAAATAACTAATGAGGCAGTCAGCTTTCTTGGTGATAGTCTGCAACGCATTGGTACCAAATTTAAAAGTTCCTTGG
AAGTGATGATGCTGTGTTCAGAATGCCCAACAGTCTTTGTGGATGCTGAAACACTGATGTCATGTGGTTTGCTGGAAACACTCAAGTTTG
GTGTTTTGGAGTTGCAAGAACACCTGGATACATACAATGTGAAAAGAGAAGCCGCTGAGCAGTGGCTAGATGATTGTAAGAGGACATTTG
GTGCCAAAGAAGACATGTATAGGATAAACACAGATGCACAACAAATGGAAATACTAGCAGAATTGGAGCTCTGCCGAAGATTATACAAAT
TGCATTTTCAATTGCTGCTTCTGTTCCAGGCCTACTGTAAACTTATCAACCAAGTAAATACGATAAAAAATGAAGCAGAGGTCATCAACA
TGTCAGAGGAACTTGCCCAACTGGAAAGTATCCTCAAAGAAGCTGAGTCCGCTTCCGAAAACGAAGAAATTGACATTTCCAAAGCTGCAC
AAACTACTATAGAAACTGCCATTCATTCTTTAATTGAAACTTTGAAAAATAAAGAATTTATATCAGCTGTAGCACAAGTCAAAGCTTTCA
GATCTCTCTGGCCCAGTGATATCTTTGGCAGTTGTGAAGATGACCCTGTACAGACACTGTTACATATATATTTCCATCATCAGACGCTGG
GCCAGACAGGAAGCTTTGCAGTTATAGGCTCTAACCTGGACATGTCAGAAGCCAACTACAAACTGATGGAACTTAATCTGGAAATAAGAG
AGTCTCTACGCATGGTGCAATCATACCAACTTCTAGCACAGGCCAAACCAATGGGAAATATGGTGAGCACTGGATTCTGAGACACTTCAG
GCCTTTAGGAAAGAAACTAAACTGAAGATGATGAAGAATATTAACCAAGCACCTTTTATGGACCCTTGCATTCACTGATAACTTTCTGGC
AGCATCTACTTTTTAGTGTAACTAATGTCAAACTGTATCATCAAAAACAAAGATCTGAAAGAAAAAAACATCTGATATTTTAACAGCTGC
CAATATCTCCCACAATAACTGCGTGAAGAAGGAATTTTTTAATTACTTAACCTACGTGAAAAGAAAAGGGCTAAAAGTGATGCCTACAAA
TACATTACTTTCTGGGGAAAGAAAAGAATTCCAAGAATGTTTGCAATAATGGCCTCCAATACTGAAACAACCAAAAGCAGGTGAAATGAG
GCTGAAATCAAGGCTGTTTCATTTTAGCTGAAGACCTGCAAAGCTGCTTGGATTTCTAGCAGTTGAAAACCTAACCTGCAATTGATGCTT
AATCATCCATCCACATGAACATGCAGTCAGCTATACGCATCAAGACTCGTTTGCAAAAACCATTGATTTTTCAGTATGTGGGATAAGGGT
TTGGGTTTTTTTGTTTTTTGGTCTGTATAAGGAATTATGTGTGTGTGAGTTGGGATGTATGGATATGTGATAGTCATATTTTCAAGGTAT
GGATGTTTGGTGATAACGTCTCAGAGCATGCCTAAAAGAGCACTGCAAGATTATTTTTGAAGAAATGTTATTTTATTAGATCTAACTCTT
CATAGTATGTAAATGTTAGAACATTTTAATAATATTTTAAAACTGGGCTTTCCCAGTATTTCAAAAAGAAATAATATATCTGTTAACGTT
ATTGGAATGCTGCTCAGTTCTCTGATCAGTGCTTATGTTATGATTGTTGATAACTAACCAAAGTAGATGCCTGCAGAGACTTTAAAATGT
AAAATAAAGATGTATGCTGCCTGTCAGCTATTCTCATTAGAAAAGTTTTAACTTATTTTACTCCATATAGAAACTGTAGAGACTAAAACC
AGTTATTTTCTTGTACATTTGTGCCATGCACTGTTGTTATACAAGAATAGGTGTACAAAGCTAAAGAAAAATTGTGGTCATTGATGATGG
AATATATGACTTGCAGGCTTTGAAGTCTGCAGAATTCAAGAAAAGAGCTGCAAATGCATTTTTGTATCTTTATTCAGGACTCACATGCTT
TACCCTAAAGAAACCTGGGGCTAGGGGAAATGAAAGGAAGCCTGAAGACTGACTACCAAAACATGCAATATACTTATTCACTGTCTAAGT
CTGTAGTATAACATGAACTGGAGTCTCTATCCTTTTCTAAAATCGCATTTTGTAAGAAAAGAAAGAAAAAAAAAAAAAAAGAATGTAGTC
CCACAACTCCTGATTTGAAAGAAACACCTTGTATTTTTTATATACATCTCTTATCCACTGTGACTTTTCTTTTAAACTGGGCTCTGTGAT
TCCAGAGTTTAGAATGTAGAAATGAAATGCTTAGCTTTACCTTTTCTTGGGGGGTGTGGACCCTGCCAGAAATGTAATTACGTATGCTCA
AGTGCATTAATTGAAGGCACTGTGCACACCATTGGACTGCTGACCACAGTTAAACATTTCCAGTAAAATTTCGTAACTGGTCACAGCTCA
TTCATAATCACTGTATTTTTTGACCCTGATAAAGACAATTATTTTGATGGTGTTCTGGTACTGTAATTGGTATCCTTTAAATTATTTAAA
ACTTTTGGGTGTGGGGCAGGCAGAGAGGGATGGTGTCCAGAGATACATCACACTTTACATCCTATCTTACTGTCCTCTGTTTTTCTTACC
CTCCTTACATCCTTTTTGTTAAAAATAAAAAGCATTGTAGCTGTTGGTTTGTGTTGTATTTTAACAAAGAATGAATGATTACAGTGTGCA
TCATTTAGAAACCTTTCAAATGTTACCTTCTTGAATTGCCCTAGAAAAGAACAAAATTAGTTGACTACCCAACCAAACCTTTCAGTTGAT

>In-frame_KMT2A_ENST00000534358_chr11_118355029_+_FRYL_ENST00000358350_chr4_48530355_-_8439nt
CTGCTTCACTTCACGGGGCGAACATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGG
GGCGCCGGGGCCTAGGGGGCGCCCCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGG
CGCCCCCCTCCCCCCCGGCTGTGGCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAG
CAGCCTCCTCGTCGTCCGCCTCGTCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCG
ACGCGGCGCTGCAGGTCTCGGCCGCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCG
GAGAGGATGAGCAATTCTTAGGTTTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTC
GAAAACCTCGTGGGAGACCTAGAAGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAG
AGACCAAATCTGGAGATAAGATCAAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAA
TCAAAATAACACATGGAAAGGACATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTA
CGTTTCAGCAAGCCACAAAGATTAAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAG
GAAGGAAGGGGGTACAAATTGTACGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTG
AACTGGAAAAGCCCCAGAAAGTCCGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTC
GAAGGATTAAGCCAGTTAGGATTATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGG
CTCAAAAGAAAATTGAAAAAGAAGCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTG
TTGTCAGTGCTATCTCCTCGCGGATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGAT
TAGAGTCTACACCGAATAGTAGATTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGT
CTTCAGACTCCTCTCGATCTAGTAGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGC
GGAGCGATACCCCTGAAGTTCATCCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAG
TGTCGGAGAGAAGTTTTGGATCTAGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTC
CACCTCTGCTGACTCCACCGCCACCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAG
CATCACCATTTTTGCCTGCTTCCACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAA
AGCATTCTAGGTCAGAGCCACAATACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGAC
CCCCTCCACTAACTCCCGAGGACGTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCC
ATTCTGGAACAAGGTTTGATATGCACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTG
AGTCTGTAACCTTGCCTAGTAATCGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTC
CTATTCGATCTGAACCAAGATCTCCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCC
CGTCTTCTGTCTCTTCCTCGTTAAGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCC
TGACTCAGTCTGGGGAATCTGCAGAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTA
CTCCTCTCTTCCCTTGGTTTACCCCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAG
ATGCTGACAAGAGCGTGGAGAAGGACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAA
GGAAAAAGGGATCAGAAATTCAGAGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCA
CTTCATCTTCTGCCAAAAAAGCAACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATA
CAACAGCTGTCAAAACCAAAATACTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCC
TGGAGAAGGAGAAAACCCTCTGCCTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGG
CAGACAAGCTTCCAATGACTGACAAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTC
TTAAACAAACCGACCAGCCCAAAGCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCA
GAAGAGCAGCTGTTGCCCTTGGCCGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAA
AGATTTTGTCTTCCATGGGGAATGATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTA
AACCTGTCACTAGAAACAAGGCACCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGG
TGCCTGAGGACTGTGGTGTTTGTACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAA
AATGTCAGAATCTACAATGGATGCCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCA
GTGAAAAGAAAGACAGCAAAGAGAGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTG
CCCCAAAGAAAAGCAGTAGTGAGCCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAAT
CCAAACAGGCCACCACTCCAGCTTCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAG
GACCGCCAAGAAAAGAAGTTCCCAAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCA
AACAGAAAAAAGTGGCTCCCCGCCCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGA
ATGCAGGCACTTTGAACATCCTCAGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAG
TGGACTTTAAGACACCAATTATTGGAAACAAATATGGTGATCAGCACAGTGCGGCTGGAAGAAATGGGAAACCAAAAGTTATTGCTGTCA
CTAGAAGTACTTCCTCAACTTCTTCTGGTTCTAATTCTAATGCCTTGGTTCCTGTTAGTTGGAAAAGGCCACAGTTATCACAGCGAAGAA
CAAGAGAAAAGCTAATGAATGTGCTTTCTCTCTGTGGTCCAGAATCTGGCCTCCCAAAGAACCCATCAGTTGTATTTTCTTCTAATGAGG
ATTTGGAAGTCGGTGACCAACAGACTAGCCTAATTTCTACAACAGAAGACATAAATCAAGAGGAAGAAGTAGCTGTGGAAGATAATAGCA
GTGAACAACAGTTTGGTGTTTTTAAGGATTTTGACTTTTTAGATGTTGAATTGGAAGATGCAGAGGGTGAAAGTATGGACAATTTCAACT
GGGGAGTTCGCAGGCGCTCACTGGACAGTATTGACAAAGGGGACACTCCATCCCTCCAGGAGTACCAGTGCTCTAGTAGCACCCCCAGCC
TGAACCTCACCAATCAGGAGGATACAGATGAGTCCTCGGAAGAAGAAGCGGCACTTACAGCAAGCCAGATACTCTCACGCACACAGATGT
TAAACAGTGATTCTGCCACTGATGAAACAATACCAGACCATCCTGACTTACTTCTCCAGTCTGAAGATTCCACTGGCAGCATCACAACAG
AGGAAGTGCTTCAAATCAGGGATGAGACCCCAACTTTGGAGGCTTCTCTAGATAATGCTAACAGCCGGCTGCCTGAGGATACAACTTCAG
TATTAAAGGAGGAACATGTTACAACCTTTGAAGATGAAGGATCCTATATAATTCAAGAACAGCAGGAATCTCTTGTGTGTCAAGGAATTC
TTGATTTAGAAGAAACTGAAATGCCAGAGCCTCTAGCTCCTGAAAGTTACCCCGAGTCAGTCTGTGAAGAGGATGTTACCTTAGCTCTGA
AAGAGCTAGATGAAAGATGTGAAGAAGAAGAAGCGGATTTCTCCGGACTGTCTAGTCAAGATGAAGAAGAGCAAGATGGTTTTCCAGAAG
TACAGACGTCGCCTCTGCCGTCACCATTTCTTTCTGCCATCATAGCCGCCTTTCAGCCCGTGGCATATGATGATGAAGAGGAAGCCTGGC
GCTGCCACGTCAATCAGATGCTGTCTGACACCGACGGGTCCTCTGCAGTGTTTACTTTTCATGTGTTTTCTAGGCTGTTTCAGACAATTC
AAAGAAAGTTTGGAGAAATAACTAATGAGGCAGTCAGCTTTCTTGGTGATAGTCTGCAACGCATTGGTACCAAATTTAAAAGTTCCTTGG
AAGTGATGATGCTGTGTTCAGAATGCCCAACAGTCTTTGTGGATGCTGAAACACTGATGTCATGTGGTTTGCTGGAAACACTCAAGTTTG
GTGTTTTGGAGTTGCAAGAACACCTGGATACATACAATGTGAAAAGAGAAGCCGCTGAGCAGTGGCTAGATGATTGTAAGAGGACATTTG
GTGCCAAAGAAGACATGTATAGGATAAACACAGATGCACAACAAATGGAAATACTAGCAGAATTGGAGCTCTGCCGAAGATTATACAAAT
TGCATTTTCAATTGCTGCTTCTGTTCCAGGCCTACTGTAAACTTATCAACCAAGTAAATACGATAAAAAATGAAGCAGAGGTCATCAACA
TGTCAGAGGAACTTGCCCAACTGGAAAGTATCCTCAAAGAAGCTGAGTCCGCTTCCGAAAACGAAGAAATTGACATTTCCAAAGCTGCAC
AAACTACTATAGAAACTGCCATTCATTCTTTAATTGAAACTTTGAAAAATAAAGAATTTATATCAGCTGTAGCACAAGTCAAAGCTTTCA
GATCTCTCTGGCCCAGTGATATCTTTGGCAGTTGTGAAGATGACCCTGTACAGACACTGTTACATATATATTTCCATCATCAGACGCTGG
GCCAGACAGGAAGCTTTGCAGTTATAGGCTCTAACCTGGACATGTCAGAAGCCAACTACAAACTGATGGAACTTAATCTGGAAATAAGAG
AGTCTCTACGCATGGTGCAATCATACCAACTTCTAGCACAGGCCAAACCAATGGGAAATATGGTGAGCACTGGATTCTGAGACACTTCAG
GCCTTTAGGAAAGAAACTAAACTGAAGATGATGAAGAATATTAACCAAGCACCTTTTATGGACCCTTGCATTCACTGATAACTTTCTGGC
AGCATCTACTTTTTAGTGTAACTAATGTCAAACTGTATCATCAAAAACAAAGATCTGAAAGAAAAAAACATCTGATATTTTAACAGCTGC
CAATATCTCCCACAATAACTGCGTGAAGAAGGAATTTTTTAATTACTTAACCTACGTGAAAAGAAAAGGGCTAAAAGTGATGCCTACAAA
TACATTACTTTCTGGGGAAAGAAAAGAATTCCAAGAATGTTTGCAATAATGGCCTCCAATACTGAAACAACCAAAAGCAGGTGAAATGAG
GCTGAAATCAAGGCTGTTTCATTTTAGCTGAAGACCTGCAAAGCTGCTTGGATTTCTAGCAGTTGAAAACCTAACCTGCAATTGATGCTT
AATCATCCATCCACATGAACATGCAGTCAGCTATACGCATCAAGACTCGTTTGCAAAAACCATTGATTTTTCAGTATGTGGGATAAGGGT
TTGGGTTTTTTTGTTTTTTGGTCTGTATAAGGAATTATGTGTGTGTGAGTTGGGATGTATGGATATGTGATAGTCATATTTTCAAGGTAT
GGATGTTTGGTGATAACGTCTCAGAGCATGCCTAAAAGAGCACTGCAAGATTATTTTTGAAGAAATGTTATTTTATTAGATCTAACTCTT
CATAGTATGTAAATGTTAGAACATTTTAATAATATTTTAAAACTGGGCTTTCCCAGTATTTCAAAAAGAAATAATATATCTGTTAACGTT
ATTGGAATGCTGCTCAGTTCTCTGATCAGTGCTTATGTTATGATTGTTGATAACTAACCAAAGTAGATGCCTGCAGAGACTTTAAAATGT
AAAATAAAGATGTATGCTGCCTGTCAGCTATTCTCATTAGAAAAGTTTTAACTTATTTTACTCCATATAGAAACTGTAGAGACTAAAACC
AGTTATTTTCTTGTACATTTGTGCCATGCACTGTTGTTATACAAGAATAGGTGTACAAAGCTAAAGAAAAATTGTGGTCATTGATGATGG
AATATATGACTTGCAGGCTTTGAAGTCTGCAGAATTCAAGAAAAGAGCTGCAAATGCATTTTTGTATCTTTATTCAGGACTCACATGCTT
TACCCTAAAGAAACCTGGGGCTAGGGGAAATGAAAGGAAGCCTGAAGACTGACTACCAAAACATGCAATATACTTATTCACTGTCTAAGT
CTGTAGTATAACATGAACTGGAGTCTCTATCCTTTTCTAAAATCGCATTTTGTAAGAAAAGAAAGAAAAAAAAAAAAAAAGAATGTAGTC
CCACAACTCCTGATTTGAAAGAAACACCTTGTATTTTTTATATACATCTCTTATCCACTGTGACTTTTCTTTTAAACTGGGCTCTGTGAT
TCCAGAGTTTAGAATGTAGAAATGAAATGCTTAGCTTTACCTTTTCTTGGGGGGTGTGGACCCTGCCAGAAATGTAATTACGTATGCTCA
AGTGCATTAATTGAAGGCACTGTGCACACCATTGGACTGCTGACCACAGTTAAACATTTCCAGTAAAATTTCGTAACTGGTCACAGCTCA
TTCATAATCACTGTATTTTTTGACCCTGATAAAGACAATTATTTTGATGGTGTTCTGGTACTGTAATTGGTATCCTTTAAATTATTTAAA
ACTTTTGGGTGTGGGGCAGGCAGAGAGGGATGGTGTCCAGAGATACATCACACTTTACATCCTATCTTACTGTCCTCTGTTTTTCTTACC
CTCCTTACATCCTTTTTGTTAAAAATAAAAAGCATTGTAGCTGTTGGTTTGTGTTGTATTTTAACAAAGAATGAATGATTACAGTGTGCA
TCATTTAGAAACCTTTCAAATGTTACCTTCTTGAATTGCCCTAGAAAAGAACAAAATTAGTTGACTACCCAACCAAACCTTTCAGTTGAT

>In-frame_KMT2A_ENST00000534358_chr11_118355029_+_FRYL_ENST00000537810_chr4_48530355_-_8439nt
CTGCTTCACTTCACGGGGCGAACATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGG
GGCGCCGGGGCCTAGGGGGCGCCCCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGG
CGCCCCCCTCCCCCCCGGCTGTGGCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAG
CAGCCTCCTCGTCGTCCGCCTCGTCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCG
ACGCGGCGCTGCAGGTCTCGGCCGCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCG
GAGAGGATGAGCAATTCTTAGGTTTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTC
GAAAACCTCGTGGGAGACCTAGAAGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAG
AGACCAAATCTGGAGATAAGATCAAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAA
TCAAAATAACACATGGAAAGGACATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTA
CGTTTCAGCAAGCCACAAAGATTAAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAG
GAAGGAAGGGGGTACAAATTGTACGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTG
AACTGGAAAAGCCCCAGAAAGTCCGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTC
GAAGGATTAAGCCAGTTAGGATTATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGG
CTCAAAAGAAAATTGAAAAAGAAGCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTG
TTGTCAGTGCTATCTCCTCGCGGATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGAT
TAGAGTCTACACCGAATAGTAGATTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGT
CTTCAGACTCCTCTCGATCTAGTAGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGC
GGAGCGATACCCCTGAAGTTCATCCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAG
TGTCGGAGAGAAGTTTTGGATCTAGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTC
CACCTCTGCTGACTCCACCGCCACCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAG
CATCACCATTTTTGCCTGCTTCCACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAA
AGCATTCTAGGTCAGAGCCACAATACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGAC
CCCCTCCACTAACTCCCGAGGACGTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCC
ATTCTGGAACAAGGTTTGATATGCACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTG
AGTCTGTAACCTTGCCTAGTAATCGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTC
CTATTCGATCTGAACCAAGATCTCCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCC
CGTCTTCTGTCTCTTCCTCGTTAAGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCC
TGACTCAGTCTGGGGAATCTGCAGAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTA
CTCCTCTCTTCCCTTGGTTTACCCCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAG
ATGCTGACAAGAGCGTGGAGAAGGACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAA
GGAAAAAGGGATCAGAAATTCAGAGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCA
CTTCATCTTCTGCCAAAAAAGCAACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATA
CAACAGCTGTCAAAACCAAAATACTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCC
TGGAGAAGGAGAAAACCCTCTGCCTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGG
CAGACAAGCTTCCAATGACTGACAAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTC
TTAAACAAACCGACCAGCCCAAAGCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCA
GAAGAGCAGCTGTTGCCCTTGGCCGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAA
AGATTTTGTCTTCCATGGGGAATGATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTA
AACCTGTCACTAGAAACAAGGCACCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGG
TGCCTGAGGACTGTGGTGTTTGTACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAA
AATGTCAGAATCTACAATGGATGCCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCA
GTGAAAAGAAAGACAGCAAAGAGAGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTG
CCCCAAAGAAAAGCAGTAGTGAGCCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAAT
CCAAACAGGCCACCACTCCAGCTTCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAG
GACCGCCAAGAAAAGAAGTTCCCAAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCA
AACAGAAAAAAGTGGCTCCCCGCCCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGA
ATGCAGGCACTTTGAACATCCTCAGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAG
TGGACTTTAAGACACCAATTATTGGAAACAAATATGGTGATCAGCACAGTGCGGCTGGAAGAAATGGGAAACCAAAAGTTATTGCTGTCA
CTAGAAGTACTTCCTCAACTTCTTCTGGTTCTAATTCTAATGCCTTGGTTCCTGTTAGTTGGAAAAGGCCACAGTTATCACAGCGAAGAA
CAAGAGAAAAGCTAATGAATGTGCTTTCTCTCTGTGGTCCAGAATCTGGCCTCCCAAAGAACCCATCAGTTGTATTTTCTTCTAATGAGG
ATTTGGAAGTCGGTGACCAACAGACTAGCCTAATTTCTACAACAGAAGACATAAATCAAGAGGAAGAAGTAGCTGTGGAAGATAATAGCA
GTGAACAACAGTTTGGTGTTTTTAAGGATTTTGACTTTTTAGATGTTGAATTGGAAGATGCAGAGGGTGAAAGTATGGACAATTTCAACT
GGGGAGTTCGCAGGCGCTCACTGGACAGTATTGACAAAGGGGACACTCCATCCCTCCAGGAGTACCAGTGCTCTAGTAGCACCCCCAGCC
TGAACCTCACCAATCAGGAGGATACAGATGAGTCCTCGGAAGAAGAAGCGGCACTTACAGCAAGCCAGATACTCTCACGCACACAGATGT
TAAACAGTGATTCTGCCACTGATGAAACAATACCAGACCATCCTGACTTACTTCTCCAGTCTGAAGATTCCACTGGCAGCATCACAACAG
AGGAAGTGCTTCAAATCAGGGATGAGACCCCAACTTTGGAGGCTTCTCTAGATAATGCTAACAGCCGGCTGCCTGAGGATACAACTTCAG
TATTAAAGGAGGAACATGTTACAACCTTTGAAGATGAAGGATCCTATATAATTCAAGAACAGCAGGAATCTCTTGTGTGTCAAGGAATTC
TTGATTTAGAAGAAACTGAAATGCCAGAGCCTCTAGCTCCTGAAAGTTACCCCGAGTCAGTCTGTGAAGAGGATGTTACCTTAGCTCTGA
AAGAGCTAGATGAAAGATGTGAAGAAGAAGAAGCGGATTTCTCCGGACTGTCTAGTCAAGATGAAGAAGAGCAAGATGGTTTTCCAGAAG
TACAGACGTCGCCTCTGCCGTCACCATTTCTTTCTGCCATCATAGCCGCCTTTCAGCCCGTGGCATATGATGATGAAGAGGAAGCCTGGC
GCTGCCACGTCAATCAGATGCTGTCTGACACCGACGGGTCCTCTGCAGTGTTTACTTTTCATGTGTTTTCTAGGCTGTTTCAGACAATTC
AAAGAAAGTTTGGAGAAATAACTAATGAGGCAGTCAGCTTTCTTGGTGATAGTCTGCAACGCATTGGTACCAAATTTAAAAGTTCCTTGG
AAGTGATGATGCTGTGTTCAGAATGCCCAACAGTCTTTGTGGATGCTGAAACACTGATGTCATGTGGTTTGCTGGAAACACTCAAGTTTG
GTGTTTTGGAGTTGCAAGAACACCTGGATACATACAATGTGAAAAGAGAAGCCGCTGAGCAGTGGCTAGATGATTGTAAGAGGACATTTG
GTGCCAAAGAAGACATGTATAGGATAAACACAGATGCACAACTCAATGAAATACTGGTTGAATTGGAGCTCTGCCGAAGATTATACAAAT
TGCATTTTCAATTGCTGCTTCTGTTCCAGGCCTACTGTAAACTTATCAACCAAGTAAATACGATAAAAAATGAAGCAGAGGTCATCAACA
TGTCAGAGGAACTTGCCCAACTGGAAAGTATCCTCAAAGAAGCTGAGTCCGCTTCCGAAAACGAAGAAATTGACATTTCCAAAGCTGCAC
AAACTACTATAGAAACTGCCATTCATTCTTTAATTGAAACTTTGAAAAATAAAGAATTTATATCAGCTGTAGCACAAGTCAAAGCTTTCA
GATCTCTCTGGCCCAGTGATATCTTTGGCAGTTGTGAAGATGACCCTGTACAGACACTGTTACATATATATTTCCATCATCAGACGCTGG
GCCAGACAGGAAGCTTTGCAGTTATAGGCTCTAACCTGGACATGTCAGAAGCCAACTACAAACTGATGGAACTTAATCTGGAAATAAGAG
AGTCTCTACGCATGGTGCAATCATACCAACTTCTAGCACAGGCCAAACCAATGGGAAATATGGTGAGCACTGGATTCTGAGACACTTCAG
GCCTTTAGGAAAGAAACTAAACTGAAGATGATGAAGAATATTAACCAAGCACCTTTTATGGACCCTTGCATTCACTGATAACTTTCTGGC
AGCATCTACTTTTTAGTGTAACTAATGTCAAACTGTATCATCAAAAACAAAGATCTGAAAGAAAAAAACATCTGATATTTTAACAGCTGC
CAATATCTCCCACAATAACTGCGTGAAGAAGGAATTTTTTAATTACTTAACCTACGTGAAAAGAAAAGGGCTAAAAGTGATGCCTACAAA
TACATTACTTTCTGGGGAAAGAAAAGAATTCCAAGAATGTTTGCAATAATGGCCTCCAATACTGAAACAACCAAAAGCAGGTGAAATGAG
GCTGAAATCAAGGCTGTTTCATTTTAGCTGAAGACCTGCAAAGCTGCTTGGATTTCTAGCAGTTGAAAACCTAACCTGCAATTGATGCTT
AATCATCCATCCACATGAACATGCAGTCAGCTATACGCATCAAGACTCGTTTGCAAAAACCATTGATTTTTCAGTATGTGGGATAAGGGT
TTGGGTTTTTTTGTTTTTTGGTCTGTATAAGGAATTATGTGTGTGTGAGTTGGGATGTATGGATATGTGATAGTCATATTTTCAAGGTAT
GGATGTTTGGTGATAACGTCTCAGAGCATGCCTAAAAGAGCACTGCAAGATTATTTTTGAAGAAATGTTATTTTATTAGATCTAACTCTT
CATAGTATGTAAATGTTAGAACATTTTAATAATATTTTAAAACTGGGCTTTCCCAGTATTTCAAAAAGAAATAATATATCTGTTAACGTT
ATTGGAATGCTGCTCAGTTCTCTGATCAGTGCTTATGTTATGATTGTTGATAACTAACCAAAGTAGATGCCTGCAGAGACTTTAAAATGT
AAAATAAAGATGTATGCTGCCTGTCAGCTATTCTCATTAGAAAAGTTTTAACTTATTTTACTCCATATAGAAACTGTAGAGACTAAAACC
AGTTATTTTCTTGTACATTTGTGCCATGCACTGTTGTTATACAAGAATAGGTGTACAAAGCTAAAGAAAAATTGTGGTCATTGATGATGG
AATATATGACTTGCAGGCTTTGAAGTCTGCAGAATTCAAGAAAAGAGCTGCAAATGCATTTTTGTATCTTTATTCAGGACTCACATGCTT
TACCCTAAAGAAACCTGGGGCTAGGGGAAATGAAAGGAAGCCTGAAGACTGACTACCAAAACATGCAATATACTTATTCACTGTCTAAGT
CTGTAGTATAACATGAACTGGAGTCTCTATCCTTTTCTAAAATCGCATTTTGTAAGAAAAGAAAGAAAAAAAAAAAAAAAGAATGTAGTC
CCACAACTCCTGATTTGAAAGAAACACCTTGTATTTTTTATATACATCTCTTATCCACTGTGACTTTTCTTTTAAACTGGGCTCTGTGAT
TCCAGAGTTTAGAATGTAGAAATGAAATGCTTAGCTTTACCTTTTCTTGGGGGGTGTGGACCCTGCCAGAAATGTAATTACGTATGCTCA
AGTGCATTAATTGAAGGCACTGTGCACACCATTGGACTGCTGACCACAGTTAAACATTTCCAGTAAAATTTCGTAACTGGTCACAGCTCA
TTCATAATCACTGTATTTTTTGACCCTGATAAAGACAATTATTTTGATGGTGTTCTGGTACTGTAATTGGTATCCTTTAAATTATTTAAA
ACTTTTGGGTGTGGGGCAGGCAGAGAGGGATGGTGTCCAGAGATACATCACACTTTACATCCTATCTTACTGTCCTCTGTTTTTCTTACC
CTCCTTACATCCTTTTTGTTAAAAATAAAAAGCATTGTAGCTGTTGGTTTGTGTTGTATTTTAACAAAGAATGAATGATTACAGTGTGCA
TCATTTAGAAACCTTTCAAATGTTACCTTCTTGAATTGCCCTAGAAAAGAACAAAATTAGTTGACTACCCAACCAAACCTTTCAGTTGAT

>In-frame_KMT2A_ENST00000389506_chr11_118355029_+_FRYL_ENST00000503238_chr4_48530355_-_8418nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGACACCAATTATT
GGAAACAAATATGGTGATCAGCACAGTGCGGCTGGAAGAAATGGGAAACCAAAAGTTATTGCTGTCACTAGAAGTACTTCCTCAACTTCT
TCTGGTTCTAATTCTAATGCCTTGGTTCCTGTTAGTTGGAAAAGGCCACAGTTATCACAGCGAAGAACAAGAGAAAAGCTAATGAATGTG
CTTTCTCTCTGTGGTCCAGAATCTGGCCTCCCAAAGAACCCATCAGTTGTATTTTCTTCTAATGAGGATTTGGAAGTCGGTGACCAACAG
ACTAGCCTAATTTCTACAACAGAAGACATAAATCAAGAGGAAGAAGTAGCTGTGGAAGATAATAGCAGTGAACAACAGTTTGGTGTTTTT
AAGGATTTTGACTTTTTAGATGTTGAATTGGAAGATGCAGAGGGTGAAAGTATGGACAATTTCAACTGGGGAGTTCGCAGGCGCTCACTG
GACAGTATTGACAAAGGGGACACTCCATCCCTCCAGGAGTACCAGTGCTCTAGTAGCACCCCCAGCCTGAACCTCACCAATCAGGAGGAT
ACAGATGAGTCCTCGGAAGAAGAAGCGGCACTTACAGCAAGCCAGATACTCTCACGCACACAGATGTTAAACAGTGATTCTGCCACTGAT
GAAACAATACCAGACCATCCTGACTTACTTCTCCAGTCTGAAGATTCCACTGGCAGCATCACAACAGAGGAAGTGCTTCAAATCAGGGAT
GAGACCCCAACTTTGGAGGCTTCTCTAGATAATGCTAACAGCCGGCTGCCTGAGGATACAACTTCAGTATTAAAGGAGGAACATGTTACA
ACCTTTGAAGATGAAGGATCCTATATAATTCAAGAACAGCAGGAATCTCTTGTGTGTCAAGGAATTCTTGATTTAGAAGAAACTGAAATG
CCAGAGCCTCTAGCTCCTGAAAGTTACCCCGAGTCAGTCTGTGAAGAGGATGTTACCTTAGCTCTGAAAGAGCTAGATGAAAGATGTGAA
GAAGAAGAAGCGGATTTCTCCGGACTGTCTAGTCAAGATGAAGAAGAGCAAGATGGTTTTCCAGAAGTACAGACGTCGCCTCTGCCGTCA
CCATTTCTTTCTGCCATCATAGCCGCCTTTCAGCCCGTGGCATATGATGATGAAGAGGAAGCCTGGCGCTGCCACGTCAATCAGATGCTG
TCTGACACCGACGGGTCCTCTGCAGTGTTTACTTTTCATGTGTTTTCTAGGCTGTTTCAGACAATTCAAAGAAAGTTTGGAGAAATAACT
AATGAGGCAGTCAGCTTTCTTGGTGATAGTCTGCAACGCATTGGTACCAAATTTAAAAGTTCCTTGGAAGTGATGATGCTGTGTTCAGAA
TGCCCAACAGTCTTTGTGGATGCTGAAACACTGATGTCATGTGGTTTGCTGGAAACACTCAAGTTTGGTGTTTTGGAGTTGCAAGAACAC
CTGGATACATACAATGTGAAAAGAGAAGCCGCTGAGCAGTGGCTAGATGATTGTAAGAGGACATTTGGTGCCAAAGAAGACATGTATAGG
ATAAACACAGATGCACAACAAATGGAAATACTAGCAGAATTGGAGCTCTGCCGAAGATTATACAAATTGCATTTTCAATTGCTGCTTCTG
TTCCAGGCCTACTGTAAACTTATCAACCAAGTAAATACGATAAAAAATGAAGCAGAGGTCATCAACATGTCAGAGGAACTTGCCCAACTG
GAAAGTATCCTCAAAGAAGCTGAGTCCGCTTCCGAAAACGAAGAAATTGACATTTCCAAAGCTGCACAAACTACTATAGAAACTGCCATT
CATTCTTTAATTGAAACTTTGAAAAATAAAGAATTTATATCAGCTGTAGCACAAGTCAAAGCTTTCAGATCTCTCTGGCCCAGTGATATC
TTTGGCAGTTGTGAAGATGACCCTGTACAGACACTGTTACATATATATTTCCATCATCAGACGCTGGGCCAGACAGGAAGCTTTGCAGTT
ATAGGCTCTAACCTGGACATGTCAGAAGCCAACTACAAACTGATGGAACTTAATCTGGAAATAAGAGAGTCTCTACGCATGGTGCAATCA
TACCAACTTCTAGCACAGGCCAAACCAATGGGAAATATGGTGAGCACTGGATTCTGAGACACTTCAGGCCTTTAGGAAAGAAACTAAACT
GAAGATGATGAAGAATATTAACCAAGCACCTTTTATGGACCCTTGCATTCACTGATAACTTTCTGGCAGCATCTACTTTTTAGTGTAACT
AATGTCAAACTGTATCATCAAAAACAAAGATCTGAAAGAAAAAAACATCTGATATTTTAACAGCTGCCAATATCTCCCACAATAACTGCG
TGAAGAAGGAATTTTTTAATTACTTAACCTACGTGAAAAGAAAAGGGCTAAAAGTGATGCCTACAAATACATTACTTTCTGGGGAAAGAA
AAGAATTCCAAGAATGTTTGCAATAATGGCCTCCAATACTGAAACAACCAAAAGCAGGTGAAATGAGGCTGAAATCAAGGCTGTTTCATT
TTAGCTGAAGACCTGCAAAGCTGCTTGGATTTCTAGCAGTTGAAAACCTAACCTGCAATTGATGCTTAATCATCCATCCACATGAACATG
CAGTCAGCTATACGCATCAAGACTCGTTTGCAAAAACCATTGATTTTTCAGTATGTGGGATAAGGGTTTGGGTTTTTTTGTTTTTTGGTC
TGTATAAGGAATTATGTGTGTGTGAGTTGGGATGTATGGATATGTGATAGTCATATTTTCAAGGTATGGATGTTTGGTGATAACGTCTCA
GAGCATGCCTAAAAGAGCACTGCAAGATTATTTTTGAAGAAATGTTATTTTATTAGATCTAACTCTTCATAGTATGTAAATGTTAGAACA
TTTTAATAATATTTTAAAACTGGGCTTTCCCAGTATTTCAAAAAGAAATAATATATCTGTTAACGTTATTGGAATGCTGCTCAGTTCTCT
GATCAGTGCTTATGTTATGATTGTTGATAACTAACCAAAGTAGATGCCTGCAGAGACTTTAAAATGTAAAATAAAGATGTATGCTGCCTG
TCAGCTATTCTCATTAGAAAAGTTTTAACTTATTTTACTCCATATAGAAACTGTAGAGACTAAAACCAGTTATTTTCTTGTACATTTGTG
CCATGCACTGTTGTTATACAAGAATAGGTGTACAAAGCTAAAGAAAAATTGTGGTCATTGATGATGGAATATATGACTTGCAGGCTTTGA
AGTCTGCAGAATTCAAGAAAAGAGCTGCAAATGCATTTTTGTATCTTTATTCAGGACTCACATGCTTTACCCTAAAGAAACCTGGGGCTA
GGGGAAATGAAAGGAAGCCTGAAGACTGACTACCAAAACATGCAATATACTTATTCACTGTCTAAGTCTGTAGTATAACATGAACTGGAG
TCTCTATCCTTTTCTAAAATCGCATTTTGTAAGAAAAGAAAGAAAAAAAAAAAAAAAGAATGTAGTCCCACAACTCCTGATTTGAAAGAA
ACACCTTGTATTTTTTATATACATCTCTTATCCACTGTGACTTTTCTTTTAAACTGGGCTCTGTGATTCCAGAGTTTAGAATGTAGAAAT
GAAATGCTTAGCTTTACCTTTTCTTGGGGGGTGTGGACCCTGCCAGAAATGTAATTACGTATGCTCAAGTGCATTAATTGAAGGCACTGT
GCACACCATTGGACTGCTGACCACAGTTAAACATTTCCAGTAAAATTTCGTAACTGGTCACAGCTCATTCATAATCACTGTATTTTTTGA
CCCTGATAAAGACAATTATTTTGATGGTGTTCTGGTACTGTAATTGGTATCCTTTAAATTATTTAAAACTTTTGGGTGTGGGGCAGGCAG
AGAGGGATGGTGTCCAGAGATACATCACACTTTACATCCTATCTTACTGTCCTCTGTTTTTCTTACCCTCCTTACATCCTTTTTGTTAAA
AATAAAAAGCATTGTAGCTGTTGGTTTGTGTTGTATTTTAACAAAGAATGAATGATTACAGTGTGCATCATTTAGAAACCTTTCAAATGT
TACCTTCTTGAATTGCCCTAGAAAAGAACAAAATTAGTTGACTACCCAACCAAACCTTTCAGTTGATATTTGCTTTTTGTGTTTATTTAT

>In-frame_KMT2A_ENST00000389506_chr11_118355029_+_FRYL_ENST00000358350_chr4_48530355_-_8416nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGACACCAATTATT
GGAAACAAATATGGTGATCAGCACAGTGCGGCTGGAAGAAATGGGAAACCAAAAGTTATTGCTGTCACTAGAAGTACTTCCTCAACTTCT
TCTGGTTCTAATTCTAATGCCTTGGTTCCTGTTAGTTGGAAAAGGCCACAGTTATCACAGCGAAGAACAAGAGAAAAGCTAATGAATGTG
CTTTCTCTCTGTGGTCCAGAATCTGGCCTCCCAAAGAACCCATCAGTTGTATTTTCTTCTAATGAGGATTTGGAAGTCGGTGACCAACAG
ACTAGCCTAATTTCTACAACAGAAGACATAAATCAAGAGGAAGAAGTAGCTGTGGAAGATAATAGCAGTGAACAACAGTTTGGTGTTTTT
AAGGATTTTGACTTTTTAGATGTTGAATTGGAAGATGCAGAGGGTGAAAGTATGGACAATTTCAACTGGGGAGTTCGCAGGCGCTCACTG
GACAGTATTGACAAAGGGGACACTCCATCCCTCCAGGAGTACCAGTGCTCTAGTAGCACCCCCAGCCTGAACCTCACCAATCAGGAGGAT
ACAGATGAGTCCTCGGAAGAAGAAGCGGCACTTACAGCAAGCCAGATACTCTCACGCACACAGATGTTAAACAGTGATTCTGCCACTGAT
GAAACAATACCAGACCATCCTGACTTACTTCTCCAGTCTGAAGATTCCACTGGCAGCATCACAACAGAGGAAGTGCTTCAAATCAGGGAT
GAGACCCCAACTTTGGAGGCTTCTCTAGATAATGCTAACAGCCGGCTGCCTGAGGATACAACTTCAGTATTAAAGGAGGAACATGTTACA
ACCTTTGAAGATGAAGGATCCTATATAATTCAAGAACAGCAGGAATCTCTTGTGTGTCAAGGAATTCTTGATTTAGAAGAAACTGAAATG
CCAGAGCCTCTAGCTCCTGAAAGTTACCCCGAGTCAGTCTGTGAAGAGGATGTTACCTTAGCTCTGAAAGAGCTAGATGAAAGATGTGAA
GAAGAAGAAGCGGATTTCTCCGGACTGTCTAGTCAAGATGAAGAAGAGCAAGATGGTTTTCCAGAAGTACAGACGTCGCCTCTGCCGTCA
CCATTTCTTTCTGCCATCATAGCCGCCTTTCAGCCCGTGGCATATGATGATGAAGAGGAAGCCTGGCGCTGCCACGTCAATCAGATGCTG
TCTGACACCGACGGGTCCTCTGCAGTGTTTACTTTTCATGTGTTTTCTAGGCTGTTTCAGACAATTCAAAGAAAGTTTGGAGAAATAACT
AATGAGGCAGTCAGCTTTCTTGGTGATAGTCTGCAACGCATTGGTACCAAATTTAAAAGTTCCTTGGAAGTGATGATGCTGTGTTCAGAA
TGCCCAACAGTCTTTGTGGATGCTGAAACACTGATGTCATGTGGTTTGCTGGAAACACTCAAGTTTGGTGTTTTGGAGTTGCAAGAACAC
CTGGATACATACAATGTGAAAAGAGAAGCCGCTGAGCAGTGGCTAGATGATTGTAAGAGGACATTTGGTGCCAAAGAAGACATGTATAGG
ATAAACACAGATGCACAACAAATGGAAATACTAGCAGAATTGGAGCTCTGCCGAAGATTATACAAATTGCATTTTCAATTGCTGCTTCTG
TTCCAGGCCTACTGTAAACTTATCAACCAAGTAAATACGATAAAAAATGAAGCAGAGGTCATCAACATGTCAGAGGAACTTGCCCAACTG
GAAAGTATCCTCAAAGAAGCTGAGTCCGCTTCCGAAAACGAAGAAATTGACATTTCCAAAGCTGCACAAACTACTATAGAAACTGCCATT
CATTCTTTAATTGAAACTTTGAAAAATAAAGAATTTATATCAGCTGTAGCACAAGTCAAAGCTTTCAGATCTCTCTGGCCCAGTGATATC
TTTGGCAGTTGTGAAGATGACCCTGTACAGACACTGTTACATATATATTTCCATCATCAGACGCTGGGCCAGACAGGAAGCTTTGCAGTT
ATAGGCTCTAACCTGGACATGTCAGAAGCCAACTACAAACTGATGGAACTTAATCTGGAAATAAGAGAGTCTCTACGCATGGTGCAATCA
TACCAACTTCTAGCACAGGCCAAACCAATGGGAAATATGGTGAGCACTGGATTCTGAGACACTTCAGGCCTTTAGGAAAGAAACTAAACT
GAAGATGATGAAGAATATTAACCAAGCACCTTTTATGGACCCTTGCATTCACTGATAACTTTCTGGCAGCATCTACTTTTTAGTGTAACT
AATGTCAAACTGTATCATCAAAAACAAAGATCTGAAAGAAAAAAACATCTGATATTTTAACAGCTGCCAATATCTCCCACAATAACTGCG
TGAAGAAGGAATTTTTTAATTACTTAACCTACGTGAAAAGAAAAGGGCTAAAAGTGATGCCTACAAATACATTACTTTCTGGGGAAAGAA
AAGAATTCCAAGAATGTTTGCAATAATGGCCTCCAATACTGAAACAACCAAAAGCAGGTGAAATGAGGCTGAAATCAAGGCTGTTTCATT
TTAGCTGAAGACCTGCAAAGCTGCTTGGATTTCTAGCAGTTGAAAACCTAACCTGCAATTGATGCTTAATCATCCATCCACATGAACATG
CAGTCAGCTATACGCATCAAGACTCGTTTGCAAAAACCATTGATTTTTCAGTATGTGGGATAAGGGTTTGGGTTTTTTTGTTTTTTGGTC
TGTATAAGGAATTATGTGTGTGTGAGTTGGGATGTATGGATATGTGATAGTCATATTTTCAAGGTATGGATGTTTGGTGATAACGTCTCA
GAGCATGCCTAAAAGAGCACTGCAAGATTATTTTTGAAGAAATGTTATTTTATTAGATCTAACTCTTCATAGTATGTAAATGTTAGAACA
TTTTAATAATATTTTAAAACTGGGCTTTCCCAGTATTTCAAAAAGAAATAATATATCTGTTAACGTTATTGGAATGCTGCTCAGTTCTCT
GATCAGTGCTTATGTTATGATTGTTGATAACTAACCAAAGTAGATGCCTGCAGAGACTTTAAAATGTAAAATAAAGATGTATGCTGCCTG
TCAGCTATTCTCATTAGAAAAGTTTTAACTTATTTTACTCCATATAGAAACTGTAGAGACTAAAACCAGTTATTTTCTTGTACATTTGTG
CCATGCACTGTTGTTATACAAGAATAGGTGTACAAAGCTAAAGAAAAATTGTGGTCATTGATGATGGAATATATGACTTGCAGGCTTTGA
AGTCTGCAGAATTCAAGAAAAGAGCTGCAAATGCATTTTTGTATCTTTATTCAGGACTCACATGCTTTACCCTAAAGAAACCTGGGGCTA
GGGGAAATGAAAGGAAGCCTGAAGACTGACTACCAAAACATGCAATATACTTATTCACTGTCTAAGTCTGTAGTATAACATGAACTGGAG
TCTCTATCCTTTTCTAAAATCGCATTTTGTAAGAAAAGAAAGAAAAAAAAAAAAAAAGAATGTAGTCCCACAACTCCTGATTTGAAAGAA
ACACCTTGTATTTTTTATATACATCTCTTATCCACTGTGACTTTTCTTTTAAACTGGGCTCTGTGATTCCAGAGTTTAGAATGTAGAAAT
GAAATGCTTAGCTTTACCTTTTCTTGGGGGGTGTGGACCCTGCCAGAAATGTAATTACGTATGCTCAAGTGCATTAATTGAAGGCACTGT
GCACACCATTGGACTGCTGACCACAGTTAAACATTTCCAGTAAAATTTCGTAACTGGTCACAGCTCATTCATAATCACTGTATTTTTTGA
CCCTGATAAAGACAATTATTTTGATGGTGTTCTGGTACTGTAATTGGTATCCTTTAAATTATTTAAAACTTTTGGGTGTGGGGCAGGCAG
AGAGGGATGGTGTCCAGAGATACATCACACTTTACATCCTATCTTACTGTCCTCTGTTTTTCTTACCCTCCTTACATCCTTTTTGTTAAA
AATAAAAAGCATTGTAGCTGTTGGTTTGTGTTGTATTTTAACAAAGAATGAATGATTACAGTGTGCATCATTTAGAAACCTTTCAAATGT
TACCTTCTTGAATTGCCCTAGAAAAGAACAAAATTAGTTGACTACCCAACCAAACCTTTCAGTTGATATTTGCTTTTTGTGTTTATTTAT

>In-frame_KMT2A_ENST00000389506_chr11_118355029_+_FRYL_ENST00000537810_chr4_48530355_-_8416nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGACACCAATTATT
GGAAACAAATATGGTGATCAGCACAGTGCGGCTGGAAGAAATGGGAAACCAAAAGTTATTGCTGTCACTAGAAGTACTTCCTCAACTTCT
TCTGGTTCTAATTCTAATGCCTTGGTTCCTGTTAGTTGGAAAAGGCCACAGTTATCACAGCGAAGAACAAGAGAAAAGCTAATGAATGTG
CTTTCTCTCTGTGGTCCAGAATCTGGCCTCCCAAAGAACCCATCAGTTGTATTTTCTTCTAATGAGGATTTGGAAGTCGGTGACCAACAG
ACTAGCCTAATTTCTACAACAGAAGACATAAATCAAGAGGAAGAAGTAGCTGTGGAAGATAATAGCAGTGAACAACAGTTTGGTGTTTTT
AAGGATTTTGACTTTTTAGATGTTGAATTGGAAGATGCAGAGGGTGAAAGTATGGACAATTTCAACTGGGGAGTTCGCAGGCGCTCACTG
GACAGTATTGACAAAGGGGACACTCCATCCCTCCAGGAGTACCAGTGCTCTAGTAGCACCCCCAGCCTGAACCTCACCAATCAGGAGGAT
ACAGATGAGTCCTCGGAAGAAGAAGCGGCACTTACAGCAAGCCAGATACTCTCACGCACACAGATGTTAAACAGTGATTCTGCCACTGAT
GAAACAATACCAGACCATCCTGACTTACTTCTCCAGTCTGAAGATTCCACTGGCAGCATCACAACAGAGGAAGTGCTTCAAATCAGGGAT
GAGACCCCAACTTTGGAGGCTTCTCTAGATAATGCTAACAGCCGGCTGCCTGAGGATACAACTTCAGTATTAAAGGAGGAACATGTTACA
ACCTTTGAAGATGAAGGATCCTATATAATTCAAGAACAGCAGGAATCTCTTGTGTGTCAAGGAATTCTTGATTTAGAAGAAACTGAAATG
CCAGAGCCTCTAGCTCCTGAAAGTTACCCCGAGTCAGTCTGTGAAGAGGATGTTACCTTAGCTCTGAAAGAGCTAGATGAAAGATGTGAA
GAAGAAGAAGCGGATTTCTCCGGACTGTCTAGTCAAGATGAAGAAGAGCAAGATGGTTTTCCAGAAGTACAGACGTCGCCTCTGCCGTCA
CCATTTCTTTCTGCCATCATAGCCGCCTTTCAGCCCGTGGCATATGATGATGAAGAGGAAGCCTGGCGCTGCCACGTCAATCAGATGCTG
TCTGACACCGACGGGTCCTCTGCAGTGTTTACTTTTCATGTGTTTTCTAGGCTGTTTCAGACAATTCAAAGAAAGTTTGGAGAAATAACT
AATGAGGCAGTCAGCTTTCTTGGTGATAGTCTGCAACGCATTGGTACCAAATTTAAAAGTTCCTTGGAAGTGATGATGCTGTGTTCAGAA
TGCCCAACAGTCTTTGTGGATGCTGAAACACTGATGTCATGTGGTTTGCTGGAAACACTCAAGTTTGGTGTTTTGGAGTTGCAAGAACAC
CTGGATACATACAATGTGAAAAGAGAAGCCGCTGAGCAGTGGCTAGATGATTGTAAGAGGACATTTGGTGCCAAAGAAGACATGTATAGG
ATAAACACAGATGCACAACTCAATGAAATACTGGTTGAATTGGAGCTCTGCCGAAGATTATACAAATTGCATTTTCAATTGCTGCTTCTG
TTCCAGGCCTACTGTAAACTTATCAACCAAGTAAATACGATAAAAAATGAAGCAGAGGTCATCAACATGTCAGAGGAACTTGCCCAACTG
GAAAGTATCCTCAAAGAAGCTGAGTCCGCTTCCGAAAACGAAGAAATTGACATTTCCAAAGCTGCACAAACTACTATAGAAACTGCCATT
CATTCTTTAATTGAAACTTTGAAAAATAAAGAATTTATATCAGCTGTAGCACAAGTCAAAGCTTTCAGATCTCTCTGGCCCAGTGATATC
TTTGGCAGTTGTGAAGATGACCCTGTACAGACACTGTTACATATATATTTCCATCATCAGACGCTGGGCCAGACAGGAAGCTTTGCAGTT
ATAGGCTCTAACCTGGACATGTCAGAAGCCAACTACAAACTGATGGAACTTAATCTGGAAATAAGAGAGTCTCTACGCATGGTGCAATCA
TACCAACTTCTAGCACAGGCCAAACCAATGGGAAATATGGTGAGCACTGGATTCTGAGACACTTCAGGCCTTTAGGAAAGAAACTAAACT
GAAGATGATGAAGAATATTAACCAAGCACCTTTTATGGACCCTTGCATTCACTGATAACTTTCTGGCAGCATCTACTTTTTAGTGTAACT
AATGTCAAACTGTATCATCAAAAACAAAGATCTGAAAGAAAAAAACATCTGATATTTTAACAGCTGCCAATATCTCCCACAATAACTGCG
TGAAGAAGGAATTTTTTAATTACTTAACCTACGTGAAAAGAAAAGGGCTAAAAGTGATGCCTACAAATACATTACTTTCTGGGGAAAGAA
AAGAATTCCAAGAATGTTTGCAATAATGGCCTCCAATACTGAAACAACCAAAAGCAGGTGAAATGAGGCTGAAATCAAGGCTGTTTCATT
TTAGCTGAAGACCTGCAAAGCTGCTTGGATTTCTAGCAGTTGAAAACCTAACCTGCAATTGATGCTTAATCATCCATCCACATGAACATG
CAGTCAGCTATACGCATCAAGACTCGTTTGCAAAAACCATTGATTTTTCAGTATGTGGGATAAGGGTTTGGGTTTTTTTGTTTTTTGGTC
TGTATAAGGAATTATGTGTGTGTGAGTTGGGATGTATGGATATGTGATAGTCATATTTTCAAGGTATGGATGTTTGGTGATAACGTCTCA
GAGCATGCCTAAAAGAGCACTGCAAGATTATTTTTGAAGAAATGTTATTTTATTAGATCTAACTCTTCATAGTATGTAAATGTTAGAACA
TTTTAATAATATTTTAAAACTGGGCTTTCCCAGTATTTCAAAAAGAAATAATATATCTGTTAACGTTATTGGAATGCTGCTCAGTTCTCT
GATCAGTGCTTATGTTATGATTGTTGATAACTAACCAAAGTAGATGCCTGCAGAGACTTTAAAATGTAAAATAAAGATGTATGCTGCCTG
TCAGCTATTCTCATTAGAAAAGTTTTAACTTATTTTACTCCATATAGAAACTGTAGAGACTAAAACCAGTTATTTTCTTGTACATTTGTG
CCATGCACTGTTGTTATACAAGAATAGGTGTACAAAGCTAAAGAAAAATTGTGGTCATTGATGATGGAATATATGACTTGCAGGCTTTGA
AGTCTGCAGAATTCAAGAAAAGAGCTGCAAATGCATTTTTGTATCTTTATTCAGGACTCACATGCTTTACCCTAAAGAAACCTGGGGCTA
GGGGAAATGAAAGGAAGCCTGAAGACTGACTACCAAAACATGCAATATACTTATTCACTGTCTAAGTCTGTAGTATAACATGAACTGGAG
TCTCTATCCTTTTCTAAAATCGCATTTTGTAAGAAAAGAAAGAAAAAAAAAAAAAAAGAATGTAGTCCCACAACTCCTGATTTGAAAGAA
ACACCTTGTATTTTTTATATACATCTCTTATCCACTGTGACTTTTCTTTTAAACTGGGCTCTGTGATTCCAGAGTTTAGAATGTAGAAAT
GAAATGCTTAGCTTTACCTTTTCTTGGGGGGTGTGGACCCTGCCAGAAATGTAATTACGTATGCTCAAGTGCATTAATTGAAGGCACTGT
GCACACCATTGGACTGCTGACCACAGTTAAACATTTCCAGTAAAATTTCGTAACTGGTCACAGCTCATTCATAATCACTGTATTTTTTGA
CCCTGATAAAGACAATTATTTTGATGGTGTTCTGGTACTGTAATTGGTATCCTTTAAATTATTTAAAACTTTTGGGTGTGGGGCAGGCAG
AGAGGGATGGTGTCCAGAGATACATCACACTTTACATCCTATCTTACTGTCCTCTGTTTTTCTTACCCTCCTTACATCCTTTTTGTTAAA
AATAAAAAGCATTGTAGCTGTTGGTTTGTGTTGTATTTTAACAAAGAATGAATGATTACAGTGTGCATCATTTAGAAACCTTTCAAATGT
TACCTTCTTGAATTGCCCTAGAAAAGAACAAAATTAGTTGACTACCCAACCAAACCTTTCAGTTGATATTTGCTTTTTGTGTTTATTTAT

>In-frame_KMT2A_ENST00000354520_chr11_118355029_+_FRYL_ENST00000503238_chr4_48530355_-_8418nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGACACCAATTATT
GGAAACAAATATGGTGATCAGCACAGTGCGGCTGGAAGAAATGGGAAACCAAAAGTTATTGCTGTCACTAGAAGTACTTCCTCAACTTCT
TCTGGTTCTAATTCTAATGCCTTGGTTCCTGTTAGTTGGAAAAGGCCACAGTTATCACAGCGAAGAACAAGAGAAAAGCTAATGAATGTG
CTTTCTCTCTGTGGTCCAGAATCTGGCCTCCCAAAGAACCCATCAGTTGTATTTTCTTCTAATGAGGATTTGGAAGTCGGTGACCAACAG
ACTAGCCTAATTTCTACAACAGAAGACATAAATCAAGAGGAAGAAGTAGCTGTGGAAGATAATAGCAGTGAACAACAGTTTGGTGTTTTT
AAGGATTTTGACTTTTTAGATGTTGAATTGGAAGATGCAGAGGGTGAAAGTATGGACAATTTCAACTGGGGAGTTCGCAGGCGCTCACTG
GACAGTATTGACAAAGGGGACACTCCATCCCTCCAGGAGTACCAGTGCTCTAGTAGCACCCCCAGCCTGAACCTCACCAATCAGGAGGAT
ACAGATGAGTCCTCGGAAGAAGAAGCGGCACTTACAGCAAGCCAGATACTCTCACGCACACAGATGTTAAACAGTGATTCTGCCACTGAT
GAAACAATACCAGACCATCCTGACTTACTTCTCCAGTCTGAAGATTCCACTGGCAGCATCACAACAGAGGAAGTGCTTCAAATCAGGGAT
GAGACCCCAACTTTGGAGGCTTCTCTAGATAATGCTAACAGCCGGCTGCCTGAGGATACAACTTCAGTATTAAAGGAGGAACATGTTACA
ACCTTTGAAGATGAAGGATCCTATATAATTCAAGAACAGCAGGAATCTCTTGTGTGTCAAGGAATTCTTGATTTAGAAGAAACTGAAATG
CCAGAGCCTCTAGCTCCTGAAAGTTACCCCGAGTCAGTCTGTGAAGAGGATGTTACCTTAGCTCTGAAAGAGCTAGATGAAAGATGTGAA
GAAGAAGAAGCGGATTTCTCCGGACTGTCTAGTCAAGATGAAGAAGAGCAAGATGGTTTTCCAGAAGTACAGACGTCGCCTCTGCCGTCA
CCATTTCTTTCTGCCATCATAGCCGCCTTTCAGCCCGTGGCATATGATGATGAAGAGGAAGCCTGGCGCTGCCACGTCAATCAGATGCTG
TCTGACACCGACGGGTCCTCTGCAGTGTTTACTTTTCATGTGTTTTCTAGGCTGTTTCAGACAATTCAAAGAAAGTTTGGAGAAATAACT
AATGAGGCAGTCAGCTTTCTTGGTGATAGTCTGCAACGCATTGGTACCAAATTTAAAAGTTCCTTGGAAGTGATGATGCTGTGTTCAGAA
TGCCCAACAGTCTTTGTGGATGCTGAAACACTGATGTCATGTGGTTTGCTGGAAACACTCAAGTTTGGTGTTTTGGAGTTGCAAGAACAC
CTGGATACATACAATGTGAAAAGAGAAGCCGCTGAGCAGTGGCTAGATGATTGTAAGAGGACATTTGGTGCCAAAGAAGACATGTATAGG
ATAAACACAGATGCACAACAAATGGAAATACTAGCAGAATTGGAGCTCTGCCGAAGATTATACAAATTGCATTTTCAATTGCTGCTTCTG
TTCCAGGCCTACTGTAAACTTATCAACCAAGTAAATACGATAAAAAATGAAGCAGAGGTCATCAACATGTCAGAGGAACTTGCCCAACTG
GAAAGTATCCTCAAAGAAGCTGAGTCCGCTTCCGAAAACGAAGAAATTGACATTTCCAAAGCTGCACAAACTACTATAGAAACTGCCATT
CATTCTTTAATTGAAACTTTGAAAAATAAAGAATTTATATCAGCTGTAGCACAAGTCAAAGCTTTCAGATCTCTCTGGCCCAGTGATATC
TTTGGCAGTTGTGAAGATGACCCTGTACAGACACTGTTACATATATATTTCCATCATCAGACGCTGGGCCAGACAGGAAGCTTTGCAGTT
ATAGGCTCTAACCTGGACATGTCAGAAGCCAACTACAAACTGATGGAACTTAATCTGGAAATAAGAGAGTCTCTACGCATGGTGCAATCA
TACCAACTTCTAGCACAGGCCAAACCAATGGGAAATATGGTGAGCACTGGATTCTGAGACACTTCAGGCCTTTAGGAAAGAAACTAAACT
GAAGATGATGAAGAATATTAACCAAGCACCTTTTATGGACCCTTGCATTCACTGATAACTTTCTGGCAGCATCTACTTTTTAGTGTAACT
AATGTCAAACTGTATCATCAAAAACAAAGATCTGAAAGAAAAAAACATCTGATATTTTAACAGCTGCCAATATCTCCCACAATAACTGCG
TGAAGAAGGAATTTTTTAATTACTTAACCTACGTGAAAAGAAAAGGGCTAAAAGTGATGCCTACAAATACATTACTTTCTGGGGAAAGAA
AAGAATTCCAAGAATGTTTGCAATAATGGCCTCCAATACTGAAACAACCAAAAGCAGGTGAAATGAGGCTGAAATCAAGGCTGTTTCATT
TTAGCTGAAGACCTGCAAAGCTGCTTGGATTTCTAGCAGTTGAAAACCTAACCTGCAATTGATGCTTAATCATCCATCCACATGAACATG
CAGTCAGCTATACGCATCAAGACTCGTTTGCAAAAACCATTGATTTTTCAGTATGTGGGATAAGGGTTTGGGTTTTTTTGTTTTTTGGTC
TGTATAAGGAATTATGTGTGTGTGAGTTGGGATGTATGGATATGTGATAGTCATATTTTCAAGGTATGGATGTTTGGTGATAACGTCTCA
GAGCATGCCTAAAAGAGCACTGCAAGATTATTTTTGAAGAAATGTTATTTTATTAGATCTAACTCTTCATAGTATGTAAATGTTAGAACA
TTTTAATAATATTTTAAAACTGGGCTTTCCCAGTATTTCAAAAAGAAATAATATATCTGTTAACGTTATTGGAATGCTGCTCAGTTCTCT
GATCAGTGCTTATGTTATGATTGTTGATAACTAACCAAAGTAGATGCCTGCAGAGACTTTAAAATGTAAAATAAAGATGTATGCTGCCTG
TCAGCTATTCTCATTAGAAAAGTTTTAACTTATTTTACTCCATATAGAAACTGTAGAGACTAAAACCAGTTATTTTCTTGTACATTTGTG
CCATGCACTGTTGTTATACAAGAATAGGTGTACAAAGCTAAAGAAAAATTGTGGTCATTGATGATGGAATATATGACTTGCAGGCTTTGA
AGTCTGCAGAATTCAAGAAAAGAGCTGCAAATGCATTTTTGTATCTTTATTCAGGACTCACATGCTTTACCCTAAAGAAACCTGGGGCTA
GGGGAAATGAAAGGAAGCCTGAAGACTGACTACCAAAACATGCAATATACTTATTCACTGTCTAAGTCTGTAGTATAACATGAACTGGAG
TCTCTATCCTTTTCTAAAATCGCATTTTGTAAGAAAAGAAAGAAAAAAAAAAAAAAAGAATGTAGTCCCACAACTCCTGATTTGAAAGAA
ACACCTTGTATTTTTTATATACATCTCTTATCCACTGTGACTTTTCTTTTAAACTGGGCTCTGTGATTCCAGAGTTTAGAATGTAGAAAT
GAAATGCTTAGCTTTACCTTTTCTTGGGGGGTGTGGACCCTGCCAGAAATGTAATTACGTATGCTCAAGTGCATTAATTGAAGGCACTGT
GCACACCATTGGACTGCTGACCACAGTTAAACATTTCCAGTAAAATTTCGTAACTGGTCACAGCTCATTCATAATCACTGTATTTTTTGA
CCCTGATAAAGACAATTATTTTGATGGTGTTCTGGTACTGTAATTGGTATCCTTTAAATTATTTAAAACTTTTGGGTGTGGGGCAGGCAG
AGAGGGATGGTGTCCAGAGATACATCACACTTTACATCCTATCTTACTGTCCTCTGTTTTTCTTACCCTCCTTACATCCTTTTTGTTAAA
AATAAAAAGCATTGTAGCTGTTGGTTTGTGTTGTATTTTAACAAAGAATGAATGATTACAGTGTGCATCATTTAGAAACCTTTCAAATGT
TACCTTCTTGAATTGCCCTAGAAAAGAACAAAATTAGTTGACTACCCAACCAAACCTTTCAGTTGATATTTGCTTTTTGTGTTTATTTAT

>In-frame_KMT2A_ENST00000354520_chr11_118355029_+_FRYL_ENST00000358350_chr4_48530355_-_8416nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGACACCAATTATT
GGAAACAAATATGGTGATCAGCACAGTGCGGCTGGAAGAAATGGGAAACCAAAAGTTATTGCTGTCACTAGAAGTACTTCCTCAACTTCT
TCTGGTTCTAATTCTAATGCCTTGGTTCCTGTTAGTTGGAAAAGGCCACAGTTATCACAGCGAAGAACAAGAGAAAAGCTAATGAATGTG
CTTTCTCTCTGTGGTCCAGAATCTGGCCTCCCAAAGAACCCATCAGTTGTATTTTCTTCTAATGAGGATTTGGAAGTCGGTGACCAACAG
ACTAGCCTAATTTCTACAACAGAAGACATAAATCAAGAGGAAGAAGTAGCTGTGGAAGATAATAGCAGTGAACAACAGTTTGGTGTTTTT
AAGGATTTTGACTTTTTAGATGTTGAATTGGAAGATGCAGAGGGTGAAAGTATGGACAATTTCAACTGGGGAGTTCGCAGGCGCTCACTG
GACAGTATTGACAAAGGGGACACTCCATCCCTCCAGGAGTACCAGTGCTCTAGTAGCACCCCCAGCCTGAACCTCACCAATCAGGAGGAT
ACAGATGAGTCCTCGGAAGAAGAAGCGGCACTTACAGCAAGCCAGATACTCTCACGCACACAGATGTTAAACAGTGATTCTGCCACTGAT
GAAACAATACCAGACCATCCTGACTTACTTCTCCAGTCTGAAGATTCCACTGGCAGCATCACAACAGAGGAAGTGCTTCAAATCAGGGAT
GAGACCCCAACTTTGGAGGCTTCTCTAGATAATGCTAACAGCCGGCTGCCTGAGGATACAACTTCAGTATTAAAGGAGGAACATGTTACA
ACCTTTGAAGATGAAGGATCCTATATAATTCAAGAACAGCAGGAATCTCTTGTGTGTCAAGGAATTCTTGATTTAGAAGAAACTGAAATG
CCAGAGCCTCTAGCTCCTGAAAGTTACCCCGAGTCAGTCTGTGAAGAGGATGTTACCTTAGCTCTGAAAGAGCTAGATGAAAGATGTGAA
GAAGAAGAAGCGGATTTCTCCGGACTGTCTAGTCAAGATGAAGAAGAGCAAGATGGTTTTCCAGAAGTACAGACGTCGCCTCTGCCGTCA
CCATTTCTTTCTGCCATCATAGCCGCCTTTCAGCCCGTGGCATATGATGATGAAGAGGAAGCCTGGCGCTGCCACGTCAATCAGATGCTG
TCTGACACCGACGGGTCCTCTGCAGTGTTTACTTTTCATGTGTTTTCTAGGCTGTTTCAGACAATTCAAAGAAAGTTTGGAGAAATAACT
AATGAGGCAGTCAGCTTTCTTGGTGATAGTCTGCAACGCATTGGTACCAAATTTAAAAGTTCCTTGGAAGTGATGATGCTGTGTTCAGAA
TGCCCAACAGTCTTTGTGGATGCTGAAACACTGATGTCATGTGGTTTGCTGGAAACACTCAAGTTTGGTGTTTTGGAGTTGCAAGAACAC
CTGGATACATACAATGTGAAAAGAGAAGCCGCTGAGCAGTGGCTAGATGATTGTAAGAGGACATTTGGTGCCAAAGAAGACATGTATAGG
ATAAACACAGATGCACAACAAATGGAAATACTAGCAGAATTGGAGCTCTGCCGAAGATTATACAAATTGCATTTTCAATTGCTGCTTCTG
TTCCAGGCCTACTGTAAACTTATCAACCAAGTAAATACGATAAAAAATGAAGCAGAGGTCATCAACATGTCAGAGGAACTTGCCCAACTG
GAAAGTATCCTCAAAGAAGCTGAGTCCGCTTCCGAAAACGAAGAAATTGACATTTCCAAAGCTGCACAAACTACTATAGAAACTGCCATT
CATTCTTTAATTGAAACTTTGAAAAATAAAGAATTTATATCAGCTGTAGCACAAGTCAAAGCTTTCAGATCTCTCTGGCCCAGTGATATC
TTTGGCAGTTGTGAAGATGACCCTGTACAGACACTGTTACATATATATTTCCATCATCAGACGCTGGGCCAGACAGGAAGCTTTGCAGTT
ATAGGCTCTAACCTGGACATGTCAGAAGCCAACTACAAACTGATGGAACTTAATCTGGAAATAAGAGAGTCTCTACGCATGGTGCAATCA
TACCAACTTCTAGCACAGGCCAAACCAATGGGAAATATGGTGAGCACTGGATTCTGAGACACTTCAGGCCTTTAGGAAAGAAACTAAACT
GAAGATGATGAAGAATATTAACCAAGCACCTTTTATGGACCCTTGCATTCACTGATAACTTTCTGGCAGCATCTACTTTTTAGTGTAACT
AATGTCAAACTGTATCATCAAAAACAAAGATCTGAAAGAAAAAAACATCTGATATTTTAACAGCTGCCAATATCTCCCACAATAACTGCG
TGAAGAAGGAATTTTTTAATTACTTAACCTACGTGAAAAGAAAAGGGCTAAAAGTGATGCCTACAAATACATTACTTTCTGGGGAAAGAA
AAGAATTCCAAGAATGTTTGCAATAATGGCCTCCAATACTGAAACAACCAAAAGCAGGTGAAATGAGGCTGAAATCAAGGCTGTTTCATT
TTAGCTGAAGACCTGCAAAGCTGCTTGGATTTCTAGCAGTTGAAAACCTAACCTGCAATTGATGCTTAATCATCCATCCACATGAACATG
CAGTCAGCTATACGCATCAAGACTCGTTTGCAAAAACCATTGATTTTTCAGTATGTGGGATAAGGGTTTGGGTTTTTTTGTTTTTTGGTC
TGTATAAGGAATTATGTGTGTGTGAGTTGGGATGTATGGATATGTGATAGTCATATTTTCAAGGTATGGATGTTTGGTGATAACGTCTCA
GAGCATGCCTAAAAGAGCACTGCAAGATTATTTTTGAAGAAATGTTATTTTATTAGATCTAACTCTTCATAGTATGTAAATGTTAGAACA
TTTTAATAATATTTTAAAACTGGGCTTTCCCAGTATTTCAAAAAGAAATAATATATCTGTTAACGTTATTGGAATGCTGCTCAGTTCTCT
GATCAGTGCTTATGTTATGATTGTTGATAACTAACCAAAGTAGATGCCTGCAGAGACTTTAAAATGTAAAATAAAGATGTATGCTGCCTG
TCAGCTATTCTCATTAGAAAAGTTTTAACTTATTTTACTCCATATAGAAACTGTAGAGACTAAAACCAGTTATTTTCTTGTACATTTGTG
CCATGCACTGTTGTTATACAAGAATAGGTGTACAAAGCTAAAGAAAAATTGTGGTCATTGATGATGGAATATATGACTTGCAGGCTTTGA
AGTCTGCAGAATTCAAGAAAAGAGCTGCAAATGCATTTTTGTATCTTTATTCAGGACTCACATGCTTTACCCTAAAGAAACCTGGGGCTA
GGGGAAATGAAAGGAAGCCTGAAGACTGACTACCAAAACATGCAATATACTTATTCACTGTCTAAGTCTGTAGTATAACATGAACTGGAG
TCTCTATCCTTTTCTAAAATCGCATTTTGTAAGAAAAGAAAGAAAAAAAAAAAAAAAGAATGTAGTCCCACAACTCCTGATTTGAAAGAA
ACACCTTGTATTTTTTATATACATCTCTTATCCACTGTGACTTTTCTTTTAAACTGGGCTCTGTGATTCCAGAGTTTAGAATGTAGAAAT
GAAATGCTTAGCTTTACCTTTTCTTGGGGGGTGTGGACCCTGCCAGAAATGTAATTACGTATGCTCAAGTGCATTAATTGAAGGCACTGT
GCACACCATTGGACTGCTGACCACAGTTAAACATTTCCAGTAAAATTTCGTAACTGGTCACAGCTCATTCATAATCACTGTATTTTTTGA
CCCTGATAAAGACAATTATTTTGATGGTGTTCTGGTACTGTAATTGGTATCCTTTAAATTATTTAAAACTTTTGGGTGTGGGGCAGGCAG
AGAGGGATGGTGTCCAGAGATACATCACACTTTACATCCTATCTTACTGTCCTCTGTTTTTCTTACCCTCCTTACATCCTTTTTGTTAAA
AATAAAAAGCATTGTAGCTGTTGGTTTGTGTTGTATTTTAACAAAGAATGAATGATTACAGTGTGCATCATTTAGAAACCTTTCAAATGT
TACCTTCTTGAATTGCCCTAGAAAAGAACAAAATTAGTTGACTACCCAACCAAACCTTTCAGTTGATATTTGCTTTTTGTGTTTATTTAT

>In-frame_KMT2A_ENST00000354520_chr11_118355029_+_FRYL_ENST00000537810_chr4_48530355_-_8416nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGACACCAATTATT
GGAAACAAATATGGTGATCAGCACAGTGCGGCTGGAAGAAATGGGAAACCAAAAGTTATTGCTGTCACTAGAAGTACTTCCTCAACTTCT
TCTGGTTCTAATTCTAATGCCTTGGTTCCTGTTAGTTGGAAAAGGCCACAGTTATCACAGCGAAGAACAAGAGAAAAGCTAATGAATGTG
CTTTCTCTCTGTGGTCCAGAATCTGGCCTCCCAAAGAACCCATCAGTTGTATTTTCTTCTAATGAGGATTTGGAAGTCGGTGACCAACAG
ACTAGCCTAATTTCTACAACAGAAGACATAAATCAAGAGGAAGAAGTAGCTGTGGAAGATAATAGCAGTGAACAACAGTTTGGTGTTTTT
AAGGATTTTGACTTTTTAGATGTTGAATTGGAAGATGCAGAGGGTGAAAGTATGGACAATTTCAACTGGGGAGTTCGCAGGCGCTCACTG
GACAGTATTGACAAAGGGGACACTCCATCCCTCCAGGAGTACCAGTGCTCTAGTAGCACCCCCAGCCTGAACCTCACCAATCAGGAGGAT
ACAGATGAGTCCTCGGAAGAAGAAGCGGCACTTACAGCAAGCCAGATACTCTCACGCACACAGATGTTAAACAGTGATTCTGCCACTGAT
GAAACAATACCAGACCATCCTGACTTACTTCTCCAGTCTGAAGATTCCACTGGCAGCATCACAACAGAGGAAGTGCTTCAAATCAGGGAT
GAGACCCCAACTTTGGAGGCTTCTCTAGATAATGCTAACAGCCGGCTGCCTGAGGATACAACTTCAGTATTAAAGGAGGAACATGTTACA
ACCTTTGAAGATGAAGGATCCTATATAATTCAAGAACAGCAGGAATCTCTTGTGTGTCAAGGAATTCTTGATTTAGAAGAAACTGAAATG
CCAGAGCCTCTAGCTCCTGAAAGTTACCCCGAGTCAGTCTGTGAAGAGGATGTTACCTTAGCTCTGAAAGAGCTAGATGAAAGATGTGAA
GAAGAAGAAGCGGATTTCTCCGGACTGTCTAGTCAAGATGAAGAAGAGCAAGATGGTTTTCCAGAAGTACAGACGTCGCCTCTGCCGTCA
CCATTTCTTTCTGCCATCATAGCCGCCTTTCAGCCCGTGGCATATGATGATGAAGAGGAAGCCTGGCGCTGCCACGTCAATCAGATGCTG
TCTGACACCGACGGGTCCTCTGCAGTGTTTACTTTTCATGTGTTTTCTAGGCTGTTTCAGACAATTCAAAGAAAGTTTGGAGAAATAACT
AATGAGGCAGTCAGCTTTCTTGGTGATAGTCTGCAACGCATTGGTACCAAATTTAAAAGTTCCTTGGAAGTGATGATGCTGTGTTCAGAA
TGCCCAACAGTCTTTGTGGATGCTGAAACACTGATGTCATGTGGTTTGCTGGAAACACTCAAGTTTGGTGTTTTGGAGTTGCAAGAACAC
CTGGATACATACAATGTGAAAAGAGAAGCCGCTGAGCAGTGGCTAGATGATTGTAAGAGGACATTTGGTGCCAAAGAAGACATGTATAGG
ATAAACACAGATGCACAACTCAATGAAATACTGGTTGAATTGGAGCTCTGCCGAAGATTATACAAATTGCATTTTCAATTGCTGCTTCTG
TTCCAGGCCTACTGTAAACTTATCAACCAAGTAAATACGATAAAAAATGAAGCAGAGGTCATCAACATGTCAGAGGAACTTGCCCAACTG
GAAAGTATCCTCAAAGAAGCTGAGTCCGCTTCCGAAAACGAAGAAATTGACATTTCCAAAGCTGCACAAACTACTATAGAAACTGCCATT
CATTCTTTAATTGAAACTTTGAAAAATAAAGAATTTATATCAGCTGTAGCACAAGTCAAAGCTTTCAGATCTCTCTGGCCCAGTGATATC
TTTGGCAGTTGTGAAGATGACCCTGTACAGACACTGTTACATATATATTTCCATCATCAGACGCTGGGCCAGACAGGAAGCTTTGCAGTT
ATAGGCTCTAACCTGGACATGTCAGAAGCCAACTACAAACTGATGGAACTTAATCTGGAAATAAGAGAGTCTCTACGCATGGTGCAATCA
TACCAACTTCTAGCACAGGCCAAACCAATGGGAAATATGGTGAGCACTGGATTCTGAGACACTTCAGGCCTTTAGGAAAGAAACTAAACT
GAAGATGATGAAGAATATTAACCAAGCACCTTTTATGGACCCTTGCATTCACTGATAACTTTCTGGCAGCATCTACTTTTTAGTGTAACT
AATGTCAAACTGTATCATCAAAAACAAAGATCTGAAAGAAAAAAACATCTGATATTTTAACAGCTGCCAATATCTCCCACAATAACTGCG
TGAAGAAGGAATTTTTTAATTACTTAACCTACGTGAAAAGAAAAGGGCTAAAAGTGATGCCTACAAATACATTACTTTCTGGGGAAAGAA
AAGAATTCCAAGAATGTTTGCAATAATGGCCTCCAATACTGAAACAACCAAAAGCAGGTGAAATGAGGCTGAAATCAAGGCTGTTTCATT
TTAGCTGAAGACCTGCAAAGCTGCTTGGATTTCTAGCAGTTGAAAACCTAACCTGCAATTGATGCTTAATCATCCATCCACATGAACATG
CAGTCAGCTATACGCATCAAGACTCGTTTGCAAAAACCATTGATTTTTCAGTATGTGGGATAAGGGTTTGGGTTTTTTTGTTTTTTGGTC
TGTATAAGGAATTATGTGTGTGTGAGTTGGGATGTATGGATATGTGATAGTCATATTTTCAAGGTATGGATGTTTGGTGATAACGTCTCA
GAGCATGCCTAAAAGAGCACTGCAAGATTATTTTTGAAGAAATGTTATTTTATTAGATCTAACTCTTCATAGTATGTAAATGTTAGAACA
TTTTAATAATATTTTAAAACTGGGCTTTCCCAGTATTTCAAAAAGAAATAATATATCTGTTAACGTTATTGGAATGCTGCTCAGTTCTCT
GATCAGTGCTTATGTTATGATTGTTGATAACTAACCAAAGTAGATGCCTGCAGAGACTTTAAAATGTAAAATAAAGATGTATGCTGCCTG
TCAGCTATTCTCATTAGAAAAGTTTTAACTTATTTTACTCCATATAGAAACTGTAGAGACTAAAACCAGTTATTTTCTTGTACATTTGTG
CCATGCACTGTTGTTATACAAGAATAGGTGTACAAAGCTAAAGAAAAATTGTGGTCATTGATGATGGAATATATGACTTGCAGGCTTTGA
AGTCTGCAGAATTCAAGAAAAGAGCTGCAAATGCATTTTTGTATCTTTATTCAGGACTCACATGCTTTACCCTAAAGAAACCTGGGGCTA
GGGGAAATGAAAGGAAGCCTGAAGACTGACTACCAAAACATGCAATATACTTATTCACTGTCTAAGTCTGTAGTATAACATGAACTGGAG
TCTCTATCCTTTTCTAAAATCGCATTTTGTAAGAAAAGAAAGAAAAAAAAAAAAAAAGAATGTAGTCCCACAACTCCTGATTTGAAAGAA
ACACCTTGTATTTTTTATATACATCTCTTATCCACTGTGACTTTTCTTTTAAACTGGGCTCTGTGATTCCAGAGTTTAGAATGTAGAAAT
GAAATGCTTAGCTTTACCTTTTCTTGGGGGGTGTGGACCCTGCCAGAAATGTAATTACGTATGCTCAAGTGCATTAATTGAAGGCACTGT
GCACACCATTGGACTGCTGACCACAGTTAAACATTTCCAGTAAAATTTCGTAACTGGTCACAGCTCATTCATAATCACTGTATTTTTTGA
CCCTGATAAAGACAATTATTTTGATGGTGTTCTGGTACTGTAATTGGTATCCTTTAAATTATTTAAAACTTTTGGGTGTGGGGCAGGCAG
AGAGGGATGGTGTCCAGAGATACATCACACTTTACATCCTATCTTACTGTCCTCTGTTTTTCTTACCCTCCTTACATCCTTTTTGTTAAA
AATAAAAAGCATTGTAGCTGTTGGTTTGTGTTGTATTTTAACAAAGAATGAATGATTACAGTGTGCATCATTTAGAAACCTTTCAAATGT
TACCTTCTTGAATTGCCCTAGAAAAGAACAAAATTAGTTGACTACCCAACCAAACCTTTCAGTTGATATTTGCTTTTTGTGTTTATTTAT

>In-frame_KMT2A_ENST00000534358_chr11_118355029_+_FRYL_ENST00000503238_chr4_48530355_-_8441nt
CTGCTTCACTTCACGGGGCGAACATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGG
GGCGCCGGGGCCTAGGGGGCGCCCCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGG
CGCCCCCCTCCCCCCCGGCTGTGGCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAG
CAGCCTCCTCGTCGTCCGCCTCGTCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCG
ACGCGGCGCTGCAGGTCTCGGCCGCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCG
GAGAGGATGAGCAATTCTTAGGTTTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTC
GAAAACCTCGTGGGAGACCTAGAAGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAG
AGACCAAATCTGGAGATAAGATCAAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAA
TCAAAATAACACATGGAAAGGACATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTA
CGTTTCAGCAAGCCACAAAGATTAAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAG
GAAGGAAGGGGGTACAAATTGTACGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTG
AACTGGAAAAGCCCCAGAAAGTCCGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTC
GAAGGATTAAGCCAGTTAGGATTATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGG
CTCAAAAGAAAATTGAAAAAGAAGCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTG
TTGTCAGTGCTATCTCCTCGCGGATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGAT
TAGAGTCTACACCGAATAGTAGATTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGT
CTTCAGACTCCTCTCGATCTAGTAGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGC
GGAGCGATACCCCTGAAGTTCATCCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAG
TGTCGGAGAGAAGTTTTGGATCTAGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTC
CACCTCTGCTGACTCCACCGCCACCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAG
CATCACCATTTTTGCCTGCTTCCACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAA
AGCATTCTAGGTCAGAGCCACAATACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGAC
CCCCTCCACTAACTCCCGAGGACGTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCC
ATTCTGGAACAAGGTTTGATATGCACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTG
AGTCTGTAACCTTGCCTAGTAATCGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTC
CTATTCGATCTGAACCAAGATCTCCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCC
CGTCTTCTGTCTCTTCCTCGTTAAGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCC
TGACTCAGTCTGGGGAATCTGCAGAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTA
CTCCTCTCTTCCCTTGGTTTACCCCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAG
ATGCTGACAAGAGCGTGGAGAAGGACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAA
GGAAAAAGGGATCAGAAATTCAGAGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCA
CTTCATCTTCTGCCAAAAAAGCAACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATA
CAACAGCTGTCAAAACCAAAATACTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCC
TGGAGAAGGAGAAAACCCTCTGCCTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGG
CAGACAAGCTTCCAATGACTGACAAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTC
TTAAACAAACCGACCAGCCCAAAGCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCA
GAAGAGCAGCTGTTGCCCTTGGCCGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAA
AGATTTTGTCTTCCATGGGGAATGATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTA
AACCTGTCACTAGAAACAAGGCACCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGG
TGCCTGAGGACTGTGGTGTTTGTACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAA
AATGTCAGAATCTACAATGGATGCCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCA
GTGAAAAGAAAGACAGCAAAGAGAGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTG
CCCCAAAGAAAAGCAGTAGTGAGCCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAAT
CCAAACAGGCCACCACTCCAGCTTCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAG
GACCGCCAAGAAAAGAAGTTCCCAAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCA
AACAGAAAAAAGTGGCTCCCCGCCCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGA
ATGCAGGCACTTTGAACATCCTCAGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAG
TGGACTTTAAGACACCAATTATTGGAAACAAATATGGTGATCAGCACAGTGCGGCTGGAAGAAATGGGAAACCAAAAGTTATTGCTGTCA
CTAGAAGTACTTCCTCAACTTCTTCTGGTTCTAATTCTAATGCCTTGGTTCCTGTTAGTTGGAAAAGGCCACAGTTATCACAGCGAAGAA
CAAGAGAAAAGCTAATGAATGTGCTTTCTCTCTGTGGTCCAGAATCTGGCCTCCCAAAGAACCCATCAGTTGTATTTTCTTCTAATGAGG
ATTTGGAAGTCGGTGACCAACAGACTAGCCTAATTTCTACAACAGAAGACATAAATCAAGAGGAAGAAGTAGCTGTGGAAGATAATAGCA
GTGAACAACAGTTTGGTGTTTTTAAGGATTTTGACTTTTTAGATGTTGAATTGGAAGATGCAGAGGGTGAAAGTATGGACAATTTCAACT
GGGGAGTTCGCAGGCGCTCACTGGACAGTATTGACAAAGGGGACACTCCATCCCTCCAGGAGTACCAGTGCTCTAGTAGCACCCCCAGCC
TGAACCTCACCAATCAGGAGGATACAGATGAGTCCTCGGAAGAAGAAGCGGCACTTACAGCAAGCCAGATACTCTCACGCACACAGATGT
TAAACAGTGATTCTGCCACTGATGAAACAATACCAGACCATCCTGACTTACTTCTCCAGTCTGAAGATTCCACTGGCAGCATCACAACAG
AGGAAGTGCTTCAAATCAGGGATGAGACCCCAACTTTGGAGGCTTCTCTAGATAATGCTAACAGCCGGCTGCCTGAGGATACAACTTCAG
TATTAAAGGAGGAACATGTTACAACCTTTGAAGATGAAGGATCCTATATAATTCAAGAACAGCAGGAATCTCTTGTGTGTCAAGGAATTC
TTGATTTAGAAGAAACTGAAATGCCAGAGCCTCTAGCTCCTGAAAGTTACCCCGAGTCAGTCTGTGAAGAGGATGTTACCTTAGCTCTGA
AAGAGCTAGATGAAAGATGTGAAGAAGAAGAAGCGGATTTCTCCGGACTGTCTAGTCAAGATGAAGAAGAGCAAGATGGTTTTCCAGAAG
TACAGACGTCGCCTCTGCCGTCACCATTTCTTTCTGCCATCATAGCCGCCTTTCAGCCCGTGGCATATGATGATGAAGAGGAAGCCTGGC
GCTGCCACGTCAATCAGATGCTGTCTGACACCGACGGGTCCTCTGCAGTGTTTACTTTTCATGTGTTTTCTAGGCTGTTTCAGACAATTC
AAAGAAAGTTTGGAGAAATAACTAATGAGGCAGTCAGCTTTCTTGGTGATAGTCTGCAACGCATTGGTACCAAATTTAAAAGTTCCTTGG
AAGTGATGATGCTGTGTTCAGAATGCCCAACAGTCTTTGTGGATGCTGAAACACTGATGTCATGTGGTTTGCTGGAAACACTCAAGTTTG
GTGTTTTGGAGTTGCAAGAACACCTGGATACATACAATGTGAAAAGAGAAGCCGCTGAGCAGTGGCTAGATGATTGTAAGAGGACATTTG
GTGCCAAAGAAGACATGTATAGGATAAACACAGATGCACAACAAATGGAAATACTAGCAGAATTGGAGCTCTGCCGAAGATTATACAAAT
TGCATTTTCAATTGCTGCTTCTGTTCCAGGCCTACTGTAAACTTATCAACCAAGTAAATACGATAAAAAATGAAGCAGAGGTCATCAACA
TGTCAGAGGAACTTGCCCAACTGGAAAGTATCCTCAAAGAAGCTGAGTCCGCTTCCGAAAACGAAGAAATTGACATTTCCAAAGCTGCAC
AAACTACTATAGAAACTGCCATTCATTCTTTAATTGAAACTTTGAAAAATAAAGAATTTATATCAGCTGTAGCACAAGTCAAAGCTTTCA
GATCTCTCTGGCCCAGTGATATCTTTGGCAGTTGTGAAGATGACCCTGTACAGACACTGTTACATATATATTTCCATCATCAGACGCTGG
GCCAGACAGGAAGCTTTGCAGTTATAGGCTCTAACCTGGACATGTCAGAAGCCAACTACAAACTGATGGAACTTAATCTGGAAATAAGAG
AGTCTCTACGCATGGTGCAATCATACCAACTTCTAGCACAGGCCAAACCAATGGGAAATATGGTGAGCACTGGATTCTGAGACACTTCAG
GCCTTTAGGAAAGAAACTAAACTGAAGATGATGAAGAATATTAACCAAGCACCTTTTATGGACCCTTGCATTCACTGATAACTTTCTGGC
AGCATCTACTTTTTAGTGTAACTAATGTCAAACTGTATCATCAAAAACAAAGATCTGAAAGAAAAAAACATCTGATATTTTAACAGCTGC
CAATATCTCCCACAATAACTGCGTGAAGAAGGAATTTTTTAATTACTTAACCTACGTGAAAAGAAAAGGGCTAAAAGTGATGCCTACAAA
TACATTACTTTCTGGGGAAAGAAAAGAATTCCAAGAATGTTTGCAATAATGGCCTCCAATACTGAAACAACCAAAAGCAGGTGAAATGAG
GCTGAAATCAAGGCTGTTTCATTTTAGCTGAAGACCTGCAAAGCTGCTTGGATTTCTAGCAGTTGAAAACCTAACCTGCAATTGATGCTT
AATCATCCATCCACATGAACATGCAGTCAGCTATACGCATCAAGACTCGTTTGCAAAAACCATTGATTTTTCAGTATGTGGGATAAGGGT
TTGGGTTTTTTTGTTTTTTGGTCTGTATAAGGAATTATGTGTGTGTGAGTTGGGATGTATGGATATGTGATAGTCATATTTTCAAGGTAT
GGATGTTTGGTGATAACGTCTCAGAGCATGCCTAAAAGAGCACTGCAAGATTATTTTTGAAGAAATGTTATTTTATTAGATCTAACTCTT
CATAGTATGTAAATGTTAGAACATTTTAATAATATTTTAAAACTGGGCTTTCCCAGTATTTCAAAAAGAAATAATATATCTGTTAACGTT
ATTGGAATGCTGCTCAGTTCTCTGATCAGTGCTTATGTTATGATTGTTGATAACTAACCAAAGTAGATGCCTGCAGAGACTTTAAAATGT
AAAATAAAGATGTATGCTGCCTGTCAGCTATTCTCATTAGAAAAGTTTTAACTTATTTTACTCCATATAGAAACTGTAGAGACTAAAACC
AGTTATTTTCTTGTACATTTGTGCCATGCACTGTTGTTATACAAGAATAGGTGTACAAAGCTAAAGAAAAATTGTGGTCATTGATGATGG
AATATATGACTTGCAGGCTTTGAAGTCTGCAGAATTCAAGAAAAGAGCTGCAAATGCATTTTTGTATCTTTATTCAGGACTCACATGCTT
TACCCTAAAGAAACCTGGGGCTAGGGGAAATGAAAGGAAGCCTGAAGACTGACTACCAAAACATGCAATATACTTATTCACTGTCTAAGT
CTGTAGTATAACATGAACTGGAGTCTCTATCCTTTTCTAAAATCGCATTTTGTAAGAAAAGAAAGAAAAAAAAAAAAAAAGAATGTAGTC
CCACAACTCCTGATTTGAAAGAAACACCTTGTATTTTTTATATACATCTCTTATCCACTGTGACTTTTCTTTTAAACTGGGCTCTGTGAT
TCCAGAGTTTAGAATGTAGAAATGAAATGCTTAGCTTTACCTTTTCTTGGGGGGTGTGGACCCTGCCAGAAATGTAATTACGTATGCTCA
AGTGCATTAATTGAAGGCACTGTGCACACCATTGGACTGCTGACCACAGTTAAACATTTCCAGTAAAATTTCGTAACTGGTCACAGCTCA
TTCATAATCACTGTATTTTTTGACCCTGATAAAGACAATTATTTTGATGGTGTTCTGGTACTGTAATTGGTATCCTTTAAATTATTTAAA
ACTTTTGGGTGTGGGGCAGGCAGAGAGGGATGGTGTCCAGAGATACATCACACTTTACATCCTATCTTACTGTCCTCTGTTTTTCTTACC
CTCCTTACATCCTTTTTGTTAAAAATAAAAAGCATTGTAGCTGTTGGTTTGTGTTGTATTTTAACAAAGAATGAATGATTACAGTGTGCA
TCATTTAGAAACCTTTCAAATGTTACCTTCTTGAATTGCCCTAGAAAAGAACAAAATTAGTTGACTACCCAACCAAACCTTTCAGTTGAT

>In-frame_KMT2A_ENST00000534358_chr11_118355029_+_FRYL_ENST00000358350_chr4_48530355_-_8439nt
CTGCTTCACTTCACGGGGCGAACATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGG
GGCGCCGGGGCCTAGGGGGCGCCCCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGG
CGCCCCCCTCCCCCCCGGCTGTGGCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAG
CAGCCTCCTCGTCGTCCGCCTCGTCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCG
ACGCGGCGCTGCAGGTCTCGGCCGCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCG
GAGAGGATGAGCAATTCTTAGGTTTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTC
GAAAACCTCGTGGGAGACCTAGAAGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAG
AGACCAAATCTGGAGATAAGATCAAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAA
TCAAAATAACACATGGAAAGGACATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTA
CGTTTCAGCAAGCCACAAAGATTAAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAG
GAAGGAAGGGGGTACAAATTGTACGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTG
AACTGGAAAAGCCCCAGAAAGTCCGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTC
GAAGGATTAAGCCAGTTAGGATTATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGG
CTCAAAAGAAAATTGAAAAAGAAGCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTG
TTGTCAGTGCTATCTCCTCGCGGATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGAT
TAGAGTCTACACCGAATAGTAGATTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGT
CTTCAGACTCCTCTCGATCTAGTAGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGC
GGAGCGATACCCCTGAAGTTCATCCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAG
TGTCGGAGAGAAGTTTTGGATCTAGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTC
CACCTCTGCTGACTCCACCGCCACCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAG
CATCACCATTTTTGCCTGCTTCCACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAA
AGCATTCTAGGTCAGAGCCACAATACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGAC
CCCCTCCACTAACTCCCGAGGACGTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCC
ATTCTGGAACAAGGTTTGATATGCACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTG
AGTCTGTAACCTTGCCTAGTAATCGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTC
CTATTCGATCTGAACCAAGATCTCCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCC
CGTCTTCTGTCTCTTCCTCGTTAAGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCC
TGACTCAGTCTGGGGAATCTGCAGAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTA
CTCCTCTCTTCCCTTGGTTTACCCCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAG
ATGCTGACAAGAGCGTGGAGAAGGACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAA
GGAAAAAGGGATCAGAAATTCAGAGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCA
CTTCATCTTCTGCCAAAAAAGCAACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATA
CAACAGCTGTCAAAACCAAAATACTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCC
TGGAGAAGGAGAAAACCCTCTGCCTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGG
CAGACAAGCTTCCAATGACTGACAAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTC
TTAAACAAACCGACCAGCCCAAAGCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCA
GAAGAGCAGCTGTTGCCCTTGGCCGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAA
AGATTTTGTCTTCCATGGGGAATGATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTA
AACCTGTCACTAGAAACAAGGCACCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGG
TGCCTGAGGACTGTGGTGTTTGTACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAA
AATGTCAGAATCTACAATGGATGCCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCA
GTGAAAAGAAAGACAGCAAAGAGAGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTG
CCCCAAAGAAAAGCAGTAGTGAGCCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAAT
CCAAACAGGCCACCACTCCAGCTTCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAG
GACCGCCAAGAAAAGAAGTTCCCAAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCA
AACAGAAAAAAGTGGCTCCCCGCCCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGA
ATGCAGGCACTTTGAACATCCTCAGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAG
TGGACTTTAAGACACCAATTATTGGAAACAAATATGGTGATCAGCACAGTGCGGCTGGAAGAAATGGGAAACCAAAAGTTATTGCTGTCA
CTAGAAGTACTTCCTCAACTTCTTCTGGTTCTAATTCTAATGCCTTGGTTCCTGTTAGTTGGAAAAGGCCACAGTTATCACAGCGAAGAA
CAAGAGAAAAGCTAATGAATGTGCTTTCTCTCTGTGGTCCAGAATCTGGCCTCCCAAAGAACCCATCAGTTGTATTTTCTTCTAATGAGG
ATTTGGAAGTCGGTGACCAACAGACTAGCCTAATTTCTACAACAGAAGACATAAATCAAGAGGAAGAAGTAGCTGTGGAAGATAATAGCA
GTGAACAACAGTTTGGTGTTTTTAAGGATTTTGACTTTTTAGATGTTGAATTGGAAGATGCAGAGGGTGAAAGTATGGACAATTTCAACT
GGGGAGTTCGCAGGCGCTCACTGGACAGTATTGACAAAGGGGACACTCCATCCCTCCAGGAGTACCAGTGCTCTAGTAGCACCCCCAGCC
TGAACCTCACCAATCAGGAGGATACAGATGAGTCCTCGGAAGAAGAAGCGGCACTTACAGCAAGCCAGATACTCTCACGCACACAGATGT
TAAACAGTGATTCTGCCACTGATGAAACAATACCAGACCATCCTGACTTACTTCTCCAGTCTGAAGATTCCACTGGCAGCATCACAACAG
AGGAAGTGCTTCAAATCAGGGATGAGACCCCAACTTTGGAGGCTTCTCTAGATAATGCTAACAGCCGGCTGCCTGAGGATACAACTTCAG
TATTAAAGGAGGAACATGTTACAACCTTTGAAGATGAAGGATCCTATATAATTCAAGAACAGCAGGAATCTCTTGTGTGTCAAGGAATTC
TTGATTTAGAAGAAACTGAAATGCCAGAGCCTCTAGCTCCTGAAAGTTACCCCGAGTCAGTCTGTGAAGAGGATGTTACCTTAGCTCTGA
AAGAGCTAGATGAAAGATGTGAAGAAGAAGAAGCGGATTTCTCCGGACTGTCTAGTCAAGATGAAGAAGAGCAAGATGGTTTTCCAGAAG
TACAGACGTCGCCTCTGCCGTCACCATTTCTTTCTGCCATCATAGCCGCCTTTCAGCCCGTGGCATATGATGATGAAGAGGAAGCCTGGC
GCTGCCACGTCAATCAGATGCTGTCTGACACCGACGGGTCCTCTGCAGTGTTTACTTTTCATGTGTTTTCTAGGCTGTTTCAGACAATTC
AAAGAAAGTTTGGAGAAATAACTAATGAGGCAGTCAGCTTTCTTGGTGATAGTCTGCAACGCATTGGTACCAAATTTAAAAGTTCCTTGG
AAGTGATGATGCTGTGTTCAGAATGCCCAACAGTCTTTGTGGATGCTGAAACACTGATGTCATGTGGTTTGCTGGAAACACTCAAGTTTG
GTGTTTTGGAGTTGCAAGAACACCTGGATACATACAATGTGAAAAGAGAAGCCGCTGAGCAGTGGCTAGATGATTGTAAGAGGACATTTG
GTGCCAAAGAAGACATGTATAGGATAAACACAGATGCACAACAAATGGAAATACTAGCAGAATTGGAGCTCTGCCGAAGATTATACAAAT
TGCATTTTCAATTGCTGCTTCTGTTCCAGGCCTACTGTAAACTTATCAACCAAGTAAATACGATAAAAAATGAAGCAGAGGTCATCAACA
TGTCAGAGGAACTTGCCCAACTGGAAAGTATCCTCAAAGAAGCTGAGTCCGCTTCCGAAAACGAAGAAATTGACATTTCCAAAGCTGCAC
AAACTACTATAGAAACTGCCATTCATTCTTTAATTGAAACTTTGAAAAATAAAGAATTTATATCAGCTGTAGCACAAGTCAAAGCTTTCA
GATCTCTCTGGCCCAGTGATATCTTTGGCAGTTGTGAAGATGACCCTGTACAGACACTGTTACATATATATTTCCATCATCAGACGCTGG
GCCAGACAGGAAGCTTTGCAGTTATAGGCTCTAACCTGGACATGTCAGAAGCCAACTACAAACTGATGGAACTTAATCTGGAAATAAGAG
AGTCTCTACGCATGGTGCAATCATACCAACTTCTAGCACAGGCCAAACCAATGGGAAATATGGTGAGCACTGGATTCTGAGACACTTCAG
GCCTTTAGGAAAGAAACTAAACTGAAGATGATGAAGAATATTAACCAAGCACCTTTTATGGACCCTTGCATTCACTGATAACTTTCTGGC
AGCATCTACTTTTTAGTGTAACTAATGTCAAACTGTATCATCAAAAACAAAGATCTGAAAGAAAAAAACATCTGATATTTTAACAGCTGC
CAATATCTCCCACAATAACTGCGTGAAGAAGGAATTTTTTAATTACTTAACCTACGTGAAAAGAAAAGGGCTAAAAGTGATGCCTACAAA
TACATTACTTTCTGGGGAAAGAAAAGAATTCCAAGAATGTTTGCAATAATGGCCTCCAATACTGAAACAACCAAAAGCAGGTGAAATGAG
GCTGAAATCAAGGCTGTTTCATTTTAGCTGAAGACCTGCAAAGCTGCTTGGATTTCTAGCAGTTGAAAACCTAACCTGCAATTGATGCTT
AATCATCCATCCACATGAACATGCAGTCAGCTATACGCATCAAGACTCGTTTGCAAAAACCATTGATTTTTCAGTATGTGGGATAAGGGT
TTGGGTTTTTTTGTTTTTTGGTCTGTATAAGGAATTATGTGTGTGTGAGTTGGGATGTATGGATATGTGATAGTCATATTTTCAAGGTAT
GGATGTTTGGTGATAACGTCTCAGAGCATGCCTAAAAGAGCACTGCAAGATTATTTTTGAAGAAATGTTATTTTATTAGATCTAACTCTT
CATAGTATGTAAATGTTAGAACATTTTAATAATATTTTAAAACTGGGCTTTCCCAGTATTTCAAAAAGAAATAATATATCTGTTAACGTT
ATTGGAATGCTGCTCAGTTCTCTGATCAGTGCTTATGTTATGATTGTTGATAACTAACCAAAGTAGATGCCTGCAGAGACTTTAAAATGT
AAAATAAAGATGTATGCTGCCTGTCAGCTATTCTCATTAGAAAAGTTTTAACTTATTTTACTCCATATAGAAACTGTAGAGACTAAAACC
AGTTATTTTCTTGTACATTTGTGCCATGCACTGTTGTTATACAAGAATAGGTGTACAAAGCTAAAGAAAAATTGTGGTCATTGATGATGG
AATATATGACTTGCAGGCTTTGAAGTCTGCAGAATTCAAGAAAAGAGCTGCAAATGCATTTTTGTATCTTTATTCAGGACTCACATGCTT
TACCCTAAAGAAACCTGGGGCTAGGGGAAATGAAAGGAAGCCTGAAGACTGACTACCAAAACATGCAATATACTTATTCACTGTCTAAGT
CTGTAGTATAACATGAACTGGAGTCTCTATCCTTTTCTAAAATCGCATTTTGTAAGAAAAGAAAGAAAAAAAAAAAAAAAGAATGTAGTC
CCACAACTCCTGATTTGAAAGAAACACCTTGTATTTTTTATATACATCTCTTATCCACTGTGACTTTTCTTTTAAACTGGGCTCTGTGAT
TCCAGAGTTTAGAATGTAGAAATGAAATGCTTAGCTTTACCTTTTCTTGGGGGGTGTGGACCCTGCCAGAAATGTAATTACGTATGCTCA
AGTGCATTAATTGAAGGCACTGTGCACACCATTGGACTGCTGACCACAGTTAAACATTTCCAGTAAAATTTCGTAACTGGTCACAGCTCA
TTCATAATCACTGTATTTTTTGACCCTGATAAAGACAATTATTTTGATGGTGTTCTGGTACTGTAATTGGTATCCTTTAAATTATTTAAA
ACTTTTGGGTGTGGGGCAGGCAGAGAGGGATGGTGTCCAGAGATACATCACACTTTACATCCTATCTTACTGTCCTCTGTTTTTCTTACC
CTCCTTACATCCTTTTTGTTAAAAATAAAAAGCATTGTAGCTGTTGGTTTGTGTTGTATTTTAACAAAGAATGAATGATTACAGTGTGCA
TCATTTAGAAACCTTTCAAATGTTACCTTCTTGAATTGCCCTAGAAAAGAACAAAATTAGTTGACTACCCAACCAAACCTTTCAGTTGAT

>In-frame_KMT2A_ENST00000534358_chr11_118355029_+_FRYL_ENST00000537810_chr4_48530355_-_8439nt
CTGCTTCACTTCACGGGGCGAACATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGG
GGCGCCGGGGCCTAGGGGGCGCCCCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGG
CGCCCCCCTCCCCCCCGGCTGTGGCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAG
CAGCCTCCTCGTCGTCCGCCTCGTCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCG
ACGCGGCGCTGCAGGTCTCGGCCGCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCG
GAGAGGATGAGCAATTCTTAGGTTTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTC
GAAAACCTCGTGGGAGACCTAGAAGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAG
AGACCAAATCTGGAGATAAGATCAAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAA
TCAAAATAACACATGGAAAGGACATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTA
CGTTTCAGCAAGCCACAAAGATTAAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAG
GAAGGAAGGGGGTACAAATTGTACGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTG
AACTGGAAAAGCCCCAGAAAGTCCGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTC
GAAGGATTAAGCCAGTTAGGATTATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGG
CTCAAAAGAAAATTGAAAAAGAAGCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTG
TTGTCAGTGCTATCTCCTCGCGGATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGAT
TAGAGTCTACACCGAATAGTAGATTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGT
CTTCAGACTCCTCTCGATCTAGTAGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGC
GGAGCGATACCCCTGAAGTTCATCCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAG
TGTCGGAGAGAAGTTTTGGATCTAGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTC
CACCTCTGCTGACTCCACCGCCACCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAG
CATCACCATTTTTGCCTGCTTCCACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAA
AGCATTCTAGGTCAGAGCCACAATACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGAC
CCCCTCCACTAACTCCCGAGGACGTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCC
ATTCTGGAACAAGGTTTGATATGCACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTG
AGTCTGTAACCTTGCCTAGTAATCGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTC
CTATTCGATCTGAACCAAGATCTCCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCC
CGTCTTCTGTCTCTTCCTCGTTAAGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCC
TGACTCAGTCTGGGGAATCTGCAGAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTA
CTCCTCTCTTCCCTTGGTTTACCCCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAG
ATGCTGACAAGAGCGTGGAGAAGGACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAA
GGAAAAAGGGATCAGAAATTCAGAGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCA
CTTCATCTTCTGCCAAAAAAGCAACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATA
CAACAGCTGTCAAAACCAAAATACTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCC
TGGAGAAGGAGAAAACCCTCTGCCTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGG
CAGACAAGCTTCCAATGACTGACAAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTC
TTAAACAAACCGACCAGCCCAAAGCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCA
GAAGAGCAGCTGTTGCCCTTGGCCGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAA
AGATTTTGTCTTCCATGGGGAATGATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTA
AACCTGTCACTAGAAACAAGGCACCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGG
TGCCTGAGGACTGTGGTGTTTGTACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAA
AATGTCAGAATCTACAATGGATGCCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCA
GTGAAAAGAAAGACAGCAAAGAGAGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTG
CCCCAAAGAAAAGCAGTAGTGAGCCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAAT
CCAAACAGGCCACCACTCCAGCTTCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAG
GACCGCCAAGAAAAGAAGTTCCCAAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCA
AACAGAAAAAAGTGGCTCCCCGCCCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGA
ATGCAGGCACTTTGAACATCCTCAGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAG
TGGACTTTAAGACACCAATTATTGGAAACAAATATGGTGATCAGCACAGTGCGGCTGGAAGAAATGGGAAACCAAAAGTTATTGCTGTCA
CTAGAAGTACTTCCTCAACTTCTTCTGGTTCTAATTCTAATGCCTTGGTTCCTGTTAGTTGGAAAAGGCCACAGTTATCACAGCGAAGAA
CAAGAGAAAAGCTAATGAATGTGCTTTCTCTCTGTGGTCCAGAATCTGGCCTCCCAAAGAACCCATCAGTTGTATTTTCTTCTAATGAGG
ATTTGGAAGTCGGTGACCAACAGACTAGCCTAATTTCTACAACAGAAGACATAAATCAAGAGGAAGAAGTAGCTGTGGAAGATAATAGCA
GTGAACAACAGTTTGGTGTTTTTAAGGATTTTGACTTTTTAGATGTTGAATTGGAAGATGCAGAGGGTGAAAGTATGGACAATTTCAACT
GGGGAGTTCGCAGGCGCTCACTGGACAGTATTGACAAAGGGGACACTCCATCCCTCCAGGAGTACCAGTGCTCTAGTAGCACCCCCAGCC
TGAACCTCACCAATCAGGAGGATACAGATGAGTCCTCGGAAGAAGAAGCGGCACTTACAGCAAGCCAGATACTCTCACGCACACAGATGT
TAAACAGTGATTCTGCCACTGATGAAACAATACCAGACCATCCTGACTTACTTCTCCAGTCTGAAGATTCCACTGGCAGCATCACAACAG
AGGAAGTGCTTCAAATCAGGGATGAGACCCCAACTTTGGAGGCTTCTCTAGATAATGCTAACAGCCGGCTGCCTGAGGATACAACTTCAG
TATTAAAGGAGGAACATGTTACAACCTTTGAAGATGAAGGATCCTATATAATTCAAGAACAGCAGGAATCTCTTGTGTGTCAAGGAATTC
TTGATTTAGAAGAAACTGAAATGCCAGAGCCTCTAGCTCCTGAAAGTTACCCCGAGTCAGTCTGTGAAGAGGATGTTACCTTAGCTCTGA
AAGAGCTAGATGAAAGATGTGAAGAAGAAGAAGCGGATTTCTCCGGACTGTCTAGTCAAGATGAAGAAGAGCAAGATGGTTTTCCAGAAG
TACAGACGTCGCCTCTGCCGTCACCATTTCTTTCTGCCATCATAGCCGCCTTTCAGCCCGTGGCATATGATGATGAAGAGGAAGCCTGGC
GCTGCCACGTCAATCAGATGCTGTCTGACACCGACGGGTCCTCTGCAGTGTTTACTTTTCATGTGTTTTCTAGGCTGTTTCAGACAATTC
AAAGAAAGTTTGGAGAAATAACTAATGAGGCAGTCAGCTTTCTTGGTGATAGTCTGCAACGCATTGGTACCAAATTTAAAAGTTCCTTGG
AAGTGATGATGCTGTGTTCAGAATGCCCAACAGTCTTTGTGGATGCTGAAACACTGATGTCATGTGGTTTGCTGGAAACACTCAAGTTTG
GTGTTTTGGAGTTGCAAGAACACCTGGATACATACAATGTGAAAAGAGAAGCCGCTGAGCAGTGGCTAGATGATTGTAAGAGGACATTTG
GTGCCAAAGAAGACATGTATAGGATAAACACAGATGCACAACTCAATGAAATACTGGTTGAATTGGAGCTCTGCCGAAGATTATACAAAT
TGCATTTTCAATTGCTGCTTCTGTTCCAGGCCTACTGTAAACTTATCAACCAAGTAAATACGATAAAAAATGAAGCAGAGGTCATCAACA
TGTCAGAGGAACTTGCCCAACTGGAAAGTATCCTCAAAGAAGCTGAGTCCGCTTCCGAAAACGAAGAAATTGACATTTCCAAAGCTGCAC
AAACTACTATAGAAACTGCCATTCATTCTTTAATTGAAACTTTGAAAAATAAAGAATTTATATCAGCTGTAGCACAAGTCAAAGCTTTCA
GATCTCTCTGGCCCAGTGATATCTTTGGCAGTTGTGAAGATGACCCTGTACAGACACTGTTACATATATATTTCCATCATCAGACGCTGG
GCCAGACAGGAAGCTTTGCAGTTATAGGCTCTAACCTGGACATGTCAGAAGCCAACTACAAACTGATGGAACTTAATCTGGAAATAAGAG
AGTCTCTACGCATGGTGCAATCATACCAACTTCTAGCACAGGCCAAACCAATGGGAAATATGGTGAGCACTGGATTCTGAGACACTTCAG
GCCTTTAGGAAAGAAACTAAACTGAAGATGATGAAGAATATTAACCAAGCACCTTTTATGGACCCTTGCATTCACTGATAACTTTCTGGC
AGCATCTACTTTTTAGTGTAACTAATGTCAAACTGTATCATCAAAAACAAAGATCTGAAAGAAAAAAACATCTGATATTTTAACAGCTGC
CAATATCTCCCACAATAACTGCGTGAAGAAGGAATTTTTTAATTACTTAACCTACGTGAAAAGAAAAGGGCTAAAAGTGATGCCTACAAA
TACATTACTTTCTGGGGAAAGAAAAGAATTCCAAGAATGTTTGCAATAATGGCCTCCAATACTGAAACAACCAAAAGCAGGTGAAATGAG
GCTGAAATCAAGGCTGTTTCATTTTAGCTGAAGACCTGCAAAGCTGCTTGGATTTCTAGCAGTTGAAAACCTAACCTGCAATTGATGCTT
AATCATCCATCCACATGAACATGCAGTCAGCTATACGCATCAAGACTCGTTTGCAAAAACCATTGATTTTTCAGTATGTGGGATAAGGGT
TTGGGTTTTTTTGTTTTTTGGTCTGTATAAGGAATTATGTGTGTGTGAGTTGGGATGTATGGATATGTGATAGTCATATTTTCAAGGTAT
GGATGTTTGGTGATAACGTCTCAGAGCATGCCTAAAAGAGCACTGCAAGATTATTTTTGAAGAAATGTTATTTTATTAGATCTAACTCTT
CATAGTATGTAAATGTTAGAACATTTTAATAATATTTTAAAACTGGGCTTTCCCAGTATTTCAAAAAGAAATAATATATCTGTTAACGTT
ATTGGAATGCTGCTCAGTTCTCTGATCAGTGCTTATGTTATGATTGTTGATAACTAACCAAAGTAGATGCCTGCAGAGACTTTAAAATGT
AAAATAAAGATGTATGCTGCCTGTCAGCTATTCTCATTAGAAAAGTTTTAACTTATTTTACTCCATATAGAAACTGTAGAGACTAAAACC
AGTTATTTTCTTGTACATTTGTGCCATGCACTGTTGTTATACAAGAATAGGTGTACAAAGCTAAAGAAAAATTGTGGTCATTGATGATGG
AATATATGACTTGCAGGCTTTGAAGTCTGCAGAATTCAAGAAAAGAGCTGCAAATGCATTTTTGTATCTTTATTCAGGACTCACATGCTT
TACCCTAAAGAAACCTGGGGCTAGGGGAAATGAAAGGAAGCCTGAAGACTGACTACCAAAACATGCAATATACTTATTCACTGTCTAAGT
CTGTAGTATAACATGAACTGGAGTCTCTATCCTTTTCTAAAATCGCATTTTGTAAGAAAAGAAAGAAAAAAAAAAAAAAAGAATGTAGTC
CCACAACTCCTGATTTGAAAGAAACACCTTGTATTTTTTATATACATCTCTTATCCACTGTGACTTTTCTTTTAAACTGGGCTCTGTGAT
TCCAGAGTTTAGAATGTAGAAATGAAATGCTTAGCTTTACCTTTTCTTGGGGGGTGTGGACCCTGCCAGAAATGTAATTACGTATGCTCA
AGTGCATTAATTGAAGGCACTGTGCACACCATTGGACTGCTGACCACAGTTAAACATTTCCAGTAAAATTTCGTAACTGGTCACAGCTCA
TTCATAATCACTGTATTTTTTGACCCTGATAAAGACAATTATTTTGATGGTGTTCTGGTACTGTAATTGGTATCCTTTAAATTATTTAAA
ACTTTTGGGTGTGGGGCAGGCAGAGAGGGATGGTGTCCAGAGATACATCACACTTTACATCCTATCTTACTGTCCTCTGTTTTTCTTACC
CTCCTTACATCCTTTTTGTTAAAAATAAAAAGCATTGTAGCTGTTGGTTTGTGTTGTATTTTAACAAAGAATGAATGATTACAGTGTGCA
TCATTTAGAAACCTTTCAAATGTTACCTTCTTGAATTGCCCTAGAAAAGAACAAAATTAGTTGACTACCCAACCAAACCTTTCAGTTGAT

>In-frame_KMT2A_ENST00000389506_chr11_118355029_+_FRYL_ENST00000503238_chr4_48530355_-_8418nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGACACCAATTATT
GGAAACAAATATGGTGATCAGCACAGTGCGGCTGGAAGAAATGGGAAACCAAAAGTTATTGCTGTCACTAGAAGTACTTCCTCAACTTCT
TCTGGTTCTAATTCTAATGCCTTGGTTCCTGTTAGTTGGAAAAGGCCACAGTTATCACAGCGAAGAACAAGAGAAAAGCTAATGAATGTG
CTTTCTCTCTGTGGTCCAGAATCTGGCCTCCCAAAGAACCCATCAGTTGTATTTTCTTCTAATGAGGATTTGGAAGTCGGTGACCAACAG
ACTAGCCTAATTTCTACAACAGAAGACATAAATCAAGAGGAAGAAGTAGCTGTGGAAGATAATAGCAGTGAACAACAGTTTGGTGTTTTT
AAGGATTTTGACTTTTTAGATGTTGAATTGGAAGATGCAGAGGGTGAAAGTATGGACAATTTCAACTGGGGAGTTCGCAGGCGCTCACTG
GACAGTATTGACAAAGGGGACACTCCATCCCTCCAGGAGTACCAGTGCTCTAGTAGCACCCCCAGCCTGAACCTCACCAATCAGGAGGAT
ACAGATGAGTCCTCGGAAGAAGAAGCGGCACTTACAGCAAGCCAGATACTCTCACGCACACAGATGTTAAACAGTGATTCTGCCACTGAT
GAAACAATACCAGACCATCCTGACTTACTTCTCCAGTCTGAAGATTCCACTGGCAGCATCACAACAGAGGAAGTGCTTCAAATCAGGGAT
GAGACCCCAACTTTGGAGGCTTCTCTAGATAATGCTAACAGCCGGCTGCCTGAGGATACAACTTCAGTATTAAAGGAGGAACATGTTACA
ACCTTTGAAGATGAAGGATCCTATATAATTCAAGAACAGCAGGAATCTCTTGTGTGTCAAGGAATTCTTGATTTAGAAGAAACTGAAATG
CCAGAGCCTCTAGCTCCTGAAAGTTACCCCGAGTCAGTCTGTGAAGAGGATGTTACCTTAGCTCTGAAAGAGCTAGATGAAAGATGTGAA
GAAGAAGAAGCGGATTTCTCCGGACTGTCTAGTCAAGATGAAGAAGAGCAAGATGGTTTTCCAGAAGTACAGACGTCGCCTCTGCCGTCA
CCATTTCTTTCTGCCATCATAGCCGCCTTTCAGCCCGTGGCATATGATGATGAAGAGGAAGCCTGGCGCTGCCACGTCAATCAGATGCTG
TCTGACACCGACGGGTCCTCTGCAGTGTTTACTTTTCATGTGTTTTCTAGGCTGTTTCAGACAATTCAAAGAAAGTTTGGAGAAATAACT
AATGAGGCAGTCAGCTTTCTTGGTGATAGTCTGCAACGCATTGGTACCAAATTTAAAAGTTCCTTGGAAGTGATGATGCTGTGTTCAGAA
TGCCCAACAGTCTTTGTGGATGCTGAAACACTGATGTCATGTGGTTTGCTGGAAACACTCAAGTTTGGTGTTTTGGAGTTGCAAGAACAC
CTGGATACATACAATGTGAAAAGAGAAGCCGCTGAGCAGTGGCTAGATGATTGTAAGAGGACATTTGGTGCCAAAGAAGACATGTATAGG
ATAAACACAGATGCACAACAAATGGAAATACTAGCAGAATTGGAGCTCTGCCGAAGATTATACAAATTGCATTTTCAATTGCTGCTTCTG
TTCCAGGCCTACTGTAAACTTATCAACCAAGTAAATACGATAAAAAATGAAGCAGAGGTCATCAACATGTCAGAGGAACTTGCCCAACTG
GAAAGTATCCTCAAAGAAGCTGAGTCCGCTTCCGAAAACGAAGAAATTGACATTTCCAAAGCTGCACAAACTACTATAGAAACTGCCATT
CATTCTTTAATTGAAACTTTGAAAAATAAAGAATTTATATCAGCTGTAGCACAAGTCAAAGCTTTCAGATCTCTCTGGCCCAGTGATATC
TTTGGCAGTTGTGAAGATGACCCTGTACAGACACTGTTACATATATATTTCCATCATCAGACGCTGGGCCAGACAGGAAGCTTTGCAGTT
ATAGGCTCTAACCTGGACATGTCAGAAGCCAACTACAAACTGATGGAACTTAATCTGGAAATAAGAGAGTCTCTACGCATGGTGCAATCA
TACCAACTTCTAGCACAGGCCAAACCAATGGGAAATATGGTGAGCACTGGATTCTGAGACACTTCAGGCCTTTAGGAAAGAAACTAAACT
GAAGATGATGAAGAATATTAACCAAGCACCTTTTATGGACCCTTGCATTCACTGATAACTTTCTGGCAGCATCTACTTTTTAGTGTAACT
AATGTCAAACTGTATCATCAAAAACAAAGATCTGAAAGAAAAAAACATCTGATATTTTAACAGCTGCCAATATCTCCCACAATAACTGCG
TGAAGAAGGAATTTTTTAATTACTTAACCTACGTGAAAAGAAAAGGGCTAAAAGTGATGCCTACAAATACATTACTTTCTGGGGAAAGAA
AAGAATTCCAAGAATGTTTGCAATAATGGCCTCCAATACTGAAACAACCAAAAGCAGGTGAAATGAGGCTGAAATCAAGGCTGTTTCATT
TTAGCTGAAGACCTGCAAAGCTGCTTGGATTTCTAGCAGTTGAAAACCTAACCTGCAATTGATGCTTAATCATCCATCCACATGAACATG
CAGTCAGCTATACGCATCAAGACTCGTTTGCAAAAACCATTGATTTTTCAGTATGTGGGATAAGGGTTTGGGTTTTTTTGTTTTTTGGTC
TGTATAAGGAATTATGTGTGTGTGAGTTGGGATGTATGGATATGTGATAGTCATATTTTCAAGGTATGGATGTTTGGTGATAACGTCTCA
GAGCATGCCTAAAAGAGCACTGCAAGATTATTTTTGAAGAAATGTTATTTTATTAGATCTAACTCTTCATAGTATGTAAATGTTAGAACA
TTTTAATAATATTTTAAAACTGGGCTTTCCCAGTATTTCAAAAAGAAATAATATATCTGTTAACGTTATTGGAATGCTGCTCAGTTCTCT
GATCAGTGCTTATGTTATGATTGTTGATAACTAACCAAAGTAGATGCCTGCAGAGACTTTAAAATGTAAAATAAAGATGTATGCTGCCTG
TCAGCTATTCTCATTAGAAAAGTTTTAACTTATTTTACTCCATATAGAAACTGTAGAGACTAAAACCAGTTATTTTCTTGTACATTTGTG
CCATGCACTGTTGTTATACAAGAATAGGTGTACAAAGCTAAAGAAAAATTGTGGTCATTGATGATGGAATATATGACTTGCAGGCTTTGA
AGTCTGCAGAATTCAAGAAAAGAGCTGCAAATGCATTTTTGTATCTTTATTCAGGACTCACATGCTTTACCCTAAAGAAACCTGGGGCTA
GGGGAAATGAAAGGAAGCCTGAAGACTGACTACCAAAACATGCAATATACTTATTCACTGTCTAAGTCTGTAGTATAACATGAACTGGAG
TCTCTATCCTTTTCTAAAATCGCATTTTGTAAGAAAAGAAAGAAAAAAAAAAAAAAAGAATGTAGTCCCACAACTCCTGATTTGAAAGAA
ACACCTTGTATTTTTTATATACATCTCTTATCCACTGTGACTTTTCTTTTAAACTGGGCTCTGTGATTCCAGAGTTTAGAATGTAGAAAT
GAAATGCTTAGCTTTACCTTTTCTTGGGGGGTGTGGACCCTGCCAGAAATGTAATTACGTATGCTCAAGTGCATTAATTGAAGGCACTGT
GCACACCATTGGACTGCTGACCACAGTTAAACATTTCCAGTAAAATTTCGTAACTGGTCACAGCTCATTCATAATCACTGTATTTTTTGA
CCCTGATAAAGACAATTATTTTGATGGTGTTCTGGTACTGTAATTGGTATCCTTTAAATTATTTAAAACTTTTGGGTGTGGGGCAGGCAG
AGAGGGATGGTGTCCAGAGATACATCACACTTTACATCCTATCTTACTGTCCTCTGTTTTTCTTACCCTCCTTACATCCTTTTTGTTAAA
AATAAAAAGCATTGTAGCTGTTGGTTTGTGTTGTATTTTAACAAAGAATGAATGATTACAGTGTGCATCATTTAGAAACCTTTCAAATGT
TACCTTCTTGAATTGCCCTAGAAAAGAACAAAATTAGTTGACTACCCAACCAAACCTTTCAGTTGATATTTGCTTTTTGTGTTTATTTAT

>In-frame_KMT2A_ENST00000389506_chr11_118355029_+_FRYL_ENST00000358350_chr4_48530355_-_8416nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGACACCAATTATT
GGAAACAAATATGGTGATCAGCACAGTGCGGCTGGAAGAAATGGGAAACCAAAAGTTATTGCTGTCACTAGAAGTACTTCCTCAACTTCT
TCTGGTTCTAATTCTAATGCCTTGGTTCCTGTTAGTTGGAAAAGGCCACAGTTATCACAGCGAAGAACAAGAGAAAAGCTAATGAATGTG
CTTTCTCTCTGTGGTCCAGAATCTGGCCTCCCAAAGAACCCATCAGTTGTATTTTCTTCTAATGAGGATTTGGAAGTCGGTGACCAACAG
ACTAGCCTAATTTCTACAACAGAAGACATAAATCAAGAGGAAGAAGTAGCTGTGGAAGATAATAGCAGTGAACAACAGTTTGGTGTTTTT
AAGGATTTTGACTTTTTAGATGTTGAATTGGAAGATGCAGAGGGTGAAAGTATGGACAATTTCAACTGGGGAGTTCGCAGGCGCTCACTG
GACAGTATTGACAAAGGGGACACTCCATCCCTCCAGGAGTACCAGTGCTCTAGTAGCACCCCCAGCCTGAACCTCACCAATCAGGAGGAT
ACAGATGAGTCCTCGGAAGAAGAAGCGGCACTTACAGCAAGCCAGATACTCTCACGCACACAGATGTTAAACAGTGATTCTGCCACTGAT
GAAACAATACCAGACCATCCTGACTTACTTCTCCAGTCTGAAGATTCCACTGGCAGCATCACAACAGAGGAAGTGCTTCAAATCAGGGAT
GAGACCCCAACTTTGGAGGCTTCTCTAGATAATGCTAACAGCCGGCTGCCTGAGGATACAACTTCAGTATTAAAGGAGGAACATGTTACA
ACCTTTGAAGATGAAGGATCCTATATAATTCAAGAACAGCAGGAATCTCTTGTGTGTCAAGGAATTCTTGATTTAGAAGAAACTGAAATG
CCAGAGCCTCTAGCTCCTGAAAGTTACCCCGAGTCAGTCTGTGAAGAGGATGTTACCTTAGCTCTGAAAGAGCTAGATGAAAGATGTGAA
GAAGAAGAAGCGGATTTCTCCGGACTGTCTAGTCAAGATGAAGAAGAGCAAGATGGTTTTCCAGAAGTACAGACGTCGCCTCTGCCGTCA
CCATTTCTTTCTGCCATCATAGCCGCCTTTCAGCCCGTGGCATATGATGATGAAGAGGAAGCCTGGCGCTGCCACGTCAATCAGATGCTG
TCTGACACCGACGGGTCCTCTGCAGTGTTTACTTTTCATGTGTTTTCTAGGCTGTTTCAGACAATTCAAAGAAAGTTTGGAGAAATAACT
AATGAGGCAGTCAGCTTTCTTGGTGATAGTCTGCAACGCATTGGTACCAAATTTAAAAGTTCCTTGGAAGTGATGATGCTGTGTTCAGAA
TGCCCAACAGTCTTTGTGGATGCTGAAACACTGATGTCATGTGGTTTGCTGGAAACACTCAAGTTTGGTGTTTTGGAGTTGCAAGAACAC
CTGGATACATACAATGTGAAAAGAGAAGCCGCTGAGCAGTGGCTAGATGATTGTAAGAGGACATTTGGTGCCAAAGAAGACATGTATAGG
ATAAACACAGATGCACAACAAATGGAAATACTAGCAGAATTGGAGCTCTGCCGAAGATTATACAAATTGCATTTTCAATTGCTGCTTCTG
TTCCAGGCCTACTGTAAACTTATCAACCAAGTAAATACGATAAAAAATGAAGCAGAGGTCATCAACATGTCAGAGGAACTTGCCCAACTG
GAAAGTATCCTCAAAGAAGCTGAGTCCGCTTCCGAAAACGAAGAAATTGACATTTCCAAAGCTGCACAAACTACTATAGAAACTGCCATT
CATTCTTTAATTGAAACTTTGAAAAATAAAGAATTTATATCAGCTGTAGCACAAGTCAAAGCTTTCAGATCTCTCTGGCCCAGTGATATC
TTTGGCAGTTGTGAAGATGACCCTGTACAGACACTGTTACATATATATTTCCATCATCAGACGCTGGGCCAGACAGGAAGCTTTGCAGTT
ATAGGCTCTAACCTGGACATGTCAGAAGCCAACTACAAACTGATGGAACTTAATCTGGAAATAAGAGAGTCTCTACGCATGGTGCAATCA
TACCAACTTCTAGCACAGGCCAAACCAATGGGAAATATGGTGAGCACTGGATTCTGAGACACTTCAGGCCTTTAGGAAAGAAACTAAACT
GAAGATGATGAAGAATATTAACCAAGCACCTTTTATGGACCCTTGCATTCACTGATAACTTTCTGGCAGCATCTACTTTTTAGTGTAACT
AATGTCAAACTGTATCATCAAAAACAAAGATCTGAAAGAAAAAAACATCTGATATTTTAACAGCTGCCAATATCTCCCACAATAACTGCG
TGAAGAAGGAATTTTTTAATTACTTAACCTACGTGAAAAGAAAAGGGCTAAAAGTGATGCCTACAAATACATTACTTTCTGGGGAAAGAA
AAGAATTCCAAGAATGTTTGCAATAATGGCCTCCAATACTGAAACAACCAAAAGCAGGTGAAATGAGGCTGAAATCAAGGCTGTTTCATT
TTAGCTGAAGACCTGCAAAGCTGCTTGGATTTCTAGCAGTTGAAAACCTAACCTGCAATTGATGCTTAATCATCCATCCACATGAACATG
CAGTCAGCTATACGCATCAAGACTCGTTTGCAAAAACCATTGATTTTTCAGTATGTGGGATAAGGGTTTGGGTTTTTTTGTTTTTTGGTC
TGTATAAGGAATTATGTGTGTGTGAGTTGGGATGTATGGATATGTGATAGTCATATTTTCAAGGTATGGATGTTTGGTGATAACGTCTCA
GAGCATGCCTAAAAGAGCACTGCAAGATTATTTTTGAAGAAATGTTATTTTATTAGATCTAACTCTTCATAGTATGTAAATGTTAGAACA
TTTTAATAATATTTTAAAACTGGGCTTTCCCAGTATTTCAAAAAGAAATAATATATCTGTTAACGTTATTGGAATGCTGCTCAGTTCTCT
GATCAGTGCTTATGTTATGATTGTTGATAACTAACCAAAGTAGATGCCTGCAGAGACTTTAAAATGTAAAATAAAGATGTATGCTGCCTG
TCAGCTATTCTCATTAGAAAAGTTTTAACTTATTTTACTCCATATAGAAACTGTAGAGACTAAAACCAGTTATTTTCTTGTACATTTGTG
CCATGCACTGTTGTTATACAAGAATAGGTGTACAAAGCTAAAGAAAAATTGTGGTCATTGATGATGGAATATATGACTTGCAGGCTTTGA
AGTCTGCAGAATTCAAGAAAAGAGCTGCAAATGCATTTTTGTATCTTTATTCAGGACTCACATGCTTTACCCTAAAGAAACCTGGGGCTA
GGGGAAATGAAAGGAAGCCTGAAGACTGACTACCAAAACATGCAATATACTTATTCACTGTCTAAGTCTGTAGTATAACATGAACTGGAG
TCTCTATCCTTTTCTAAAATCGCATTTTGTAAGAAAAGAAAGAAAAAAAAAAAAAAAGAATGTAGTCCCACAACTCCTGATTTGAAAGAA
ACACCTTGTATTTTTTATATACATCTCTTATCCACTGTGACTTTTCTTTTAAACTGGGCTCTGTGATTCCAGAGTTTAGAATGTAGAAAT
GAAATGCTTAGCTTTACCTTTTCTTGGGGGGTGTGGACCCTGCCAGAAATGTAATTACGTATGCTCAAGTGCATTAATTGAAGGCACTGT
GCACACCATTGGACTGCTGACCACAGTTAAACATTTCCAGTAAAATTTCGTAACTGGTCACAGCTCATTCATAATCACTGTATTTTTTGA
CCCTGATAAAGACAATTATTTTGATGGTGTTCTGGTACTGTAATTGGTATCCTTTAAATTATTTAAAACTTTTGGGTGTGGGGCAGGCAG
AGAGGGATGGTGTCCAGAGATACATCACACTTTACATCCTATCTTACTGTCCTCTGTTTTTCTTACCCTCCTTACATCCTTTTTGTTAAA
AATAAAAAGCATTGTAGCTGTTGGTTTGTGTTGTATTTTAACAAAGAATGAATGATTACAGTGTGCATCATTTAGAAACCTTTCAAATGT
TACCTTCTTGAATTGCCCTAGAAAAGAACAAAATTAGTTGACTACCCAACCAAACCTTTCAGTTGATATTTGCTTTTTGTGTTTATTTAT

>In-frame_KMT2A_ENST00000389506_chr11_118355029_+_FRYL_ENST00000537810_chr4_48530355_-_8416nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGACACCAATTATT
GGAAACAAATATGGTGATCAGCACAGTGCGGCTGGAAGAAATGGGAAACCAAAAGTTATTGCTGTCACTAGAAGTACTTCCTCAACTTCT
TCTGGTTCTAATTCTAATGCCTTGGTTCCTGTTAGTTGGAAAAGGCCACAGTTATCACAGCGAAGAACAAGAGAAAAGCTAATGAATGTG
CTTTCTCTCTGTGGTCCAGAATCTGGCCTCCCAAAGAACCCATCAGTTGTATTTTCTTCTAATGAGGATTTGGAAGTCGGTGACCAACAG
ACTAGCCTAATTTCTACAACAGAAGACATAAATCAAGAGGAAGAAGTAGCTGTGGAAGATAATAGCAGTGAACAACAGTTTGGTGTTTTT
AAGGATTTTGACTTTTTAGATGTTGAATTGGAAGATGCAGAGGGTGAAAGTATGGACAATTTCAACTGGGGAGTTCGCAGGCGCTCACTG
GACAGTATTGACAAAGGGGACACTCCATCCCTCCAGGAGTACCAGTGCTCTAGTAGCACCCCCAGCCTGAACCTCACCAATCAGGAGGAT
ACAGATGAGTCCTCGGAAGAAGAAGCGGCACTTACAGCAAGCCAGATACTCTCACGCACACAGATGTTAAACAGTGATTCTGCCACTGAT
GAAACAATACCAGACCATCCTGACTTACTTCTCCAGTCTGAAGATTCCACTGGCAGCATCACAACAGAGGAAGTGCTTCAAATCAGGGAT
GAGACCCCAACTTTGGAGGCTTCTCTAGATAATGCTAACAGCCGGCTGCCTGAGGATACAACTTCAGTATTAAAGGAGGAACATGTTACA
ACCTTTGAAGATGAAGGATCCTATATAATTCAAGAACAGCAGGAATCTCTTGTGTGTCAAGGAATTCTTGATTTAGAAGAAACTGAAATG
CCAGAGCCTCTAGCTCCTGAAAGTTACCCCGAGTCAGTCTGTGAAGAGGATGTTACCTTAGCTCTGAAAGAGCTAGATGAAAGATGTGAA
GAAGAAGAAGCGGATTTCTCCGGACTGTCTAGTCAAGATGAAGAAGAGCAAGATGGTTTTCCAGAAGTACAGACGTCGCCTCTGCCGTCA
CCATTTCTTTCTGCCATCATAGCCGCCTTTCAGCCCGTGGCATATGATGATGAAGAGGAAGCCTGGCGCTGCCACGTCAATCAGATGCTG
TCTGACACCGACGGGTCCTCTGCAGTGTTTACTTTTCATGTGTTTTCTAGGCTGTTTCAGACAATTCAAAGAAAGTTTGGAGAAATAACT
AATGAGGCAGTCAGCTTTCTTGGTGATAGTCTGCAACGCATTGGTACCAAATTTAAAAGTTCCTTGGAAGTGATGATGCTGTGTTCAGAA
TGCCCAACAGTCTTTGTGGATGCTGAAACACTGATGTCATGTGGTTTGCTGGAAACACTCAAGTTTGGTGTTTTGGAGTTGCAAGAACAC
CTGGATACATACAATGTGAAAAGAGAAGCCGCTGAGCAGTGGCTAGATGATTGTAAGAGGACATTTGGTGCCAAAGAAGACATGTATAGG
ATAAACACAGATGCACAACTCAATGAAATACTGGTTGAATTGGAGCTCTGCCGAAGATTATACAAATTGCATTTTCAATTGCTGCTTCTG
TTCCAGGCCTACTGTAAACTTATCAACCAAGTAAATACGATAAAAAATGAAGCAGAGGTCATCAACATGTCAGAGGAACTTGCCCAACTG
GAAAGTATCCTCAAAGAAGCTGAGTCCGCTTCCGAAAACGAAGAAATTGACATTTCCAAAGCTGCACAAACTACTATAGAAACTGCCATT
CATTCTTTAATTGAAACTTTGAAAAATAAAGAATTTATATCAGCTGTAGCACAAGTCAAAGCTTTCAGATCTCTCTGGCCCAGTGATATC
TTTGGCAGTTGTGAAGATGACCCTGTACAGACACTGTTACATATATATTTCCATCATCAGACGCTGGGCCAGACAGGAAGCTTTGCAGTT
ATAGGCTCTAACCTGGACATGTCAGAAGCCAACTACAAACTGATGGAACTTAATCTGGAAATAAGAGAGTCTCTACGCATGGTGCAATCA
TACCAACTTCTAGCACAGGCCAAACCAATGGGAAATATGGTGAGCACTGGATTCTGAGACACTTCAGGCCTTTAGGAAAGAAACTAAACT
GAAGATGATGAAGAATATTAACCAAGCACCTTTTATGGACCCTTGCATTCACTGATAACTTTCTGGCAGCATCTACTTTTTAGTGTAACT
AATGTCAAACTGTATCATCAAAAACAAAGATCTGAAAGAAAAAAACATCTGATATTTTAACAGCTGCCAATATCTCCCACAATAACTGCG
TGAAGAAGGAATTTTTTAATTACTTAACCTACGTGAAAAGAAAAGGGCTAAAAGTGATGCCTACAAATACATTACTTTCTGGGGAAAGAA
AAGAATTCCAAGAATGTTTGCAATAATGGCCTCCAATACTGAAACAACCAAAAGCAGGTGAAATGAGGCTGAAATCAAGGCTGTTTCATT
TTAGCTGAAGACCTGCAAAGCTGCTTGGATTTCTAGCAGTTGAAAACCTAACCTGCAATTGATGCTTAATCATCCATCCACATGAACATG
CAGTCAGCTATACGCATCAAGACTCGTTTGCAAAAACCATTGATTTTTCAGTATGTGGGATAAGGGTTTGGGTTTTTTTGTTTTTTGGTC
TGTATAAGGAATTATGTGTGTGTGAGTTGGGATGTATGGATATGTGATAGTCATATTTTCAAGGTATGGATGTTTGGTGATAACGTCTCA
GAGCATGCCTAAAAGAGCACTGCAAGATTATTTTTGAAGAAATGTTATTTTATTAGATCTAACTCTTCATAGTATGTAAATGTTAGAACA
TTTTAATAATATTTTAAAACTGGGCTTTCCCAGTATTTCAAAAAGAAATAATATATCTGTTAACGTTATTGGAATGCTGCTCAGTTCTCT
GATCAGTGCTTATGTTATGATTGTTGATAACTAACCAAAGTAGATGCCTGCAGAGACTTTAAAATGTAAAATAAAGATGTATGCTGCCTG
TCAGCTATTCTCATTAGAAAAGTTTTAACTTATTTTACTCCATATAGAAACTGTAGAGACTAAAACCAGTTATTTTCTTGTACATTTGTG
CCATGCACTGTTGTTATACAAGAATAGGTGTACAAAGCTAAAGAAAAATTGTGGTCATTGATGATGGAATATATGACTTGCAGGCTTTGA
AGTCTGCAGAATTCAAGAAAAGAGCTGCAAATGCATTTTTGTATCTTTATTCAGGACTCACATGCTTTACCCTAAAGAAACCTGGGGCTA
GGGGAAATGAAAGGAAGCCTGAAGACTGACTACCAAAACATGCAATATACTTATTCACTGTCTAAGTCTGTAGTATAACATGAACTGGAG
TCTCTATCCTTTTCTAAAATCGCATTTTGTAAGAAAAGAAAGAAAAAAAAAAAAAAAGAATGTAGTCCCACAACTCCTGATTTGAAAGAA
ACACCTTGTATTTTTTATATACATCTCTTATCCACTGTGACTTTTCTTTTAAACTGGGCTCTGTGATTCCAGAGTTTAGAATGTAGAAAT
GAAATGCTTAGCTTTACCTTTTCTTGGGGGGTGTGGACCCTGCCAGAAATGTAATTACGTATGCTCAAGTGCATTAATTGAAGGCACTGT
GCACACCATTGGACTGCTGACCACAGTTAAACATTTCCAGTAAAATTTCGTAACTGGTCACAGCTCATTCATAATCACTGTATTTTTTGA
CCCTGATAAAGACAATTATTTTGATGGTGTTCTGGTACTGTAATTGGTATCCTTTAAATTATTTAAAACTTTTGGGTGTGGGGCAGGCAG
AGAGGGATGGTGTCCAGAGATACATCACACTTTACATCCTATCTTACTGTCCTCTGTTTTTCTTACCCTCCTTACATCCTTTTTGTTAAA
AATAAAAAGCATTGTAGCTGTTGGTTTGTGTTGTATTTTAACAAAGAATGAATGATTACAGTGTGCATCATTTAGAAACCTTTCAAATGT
TACCTTCTTGAATTGCCCTAGAAAAGAACAAAATTAGTTGACTACCCAACCAAACCTTTCAGTTGATATTTGCTTTTTGTGTTTATTTAT

>In-frame_KMT2A_ENST00000354520_chr11_118355029_+_FRYL_ENST00000503238_chr4_48530355_-_8418nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGACACCAATTATT
GGAAACAAATATGGTGATCAGCACAGTGCGGCTGGAAGAAATGGGAAACCAAAAGTTATTGCTGTCACTAGAAGTACTTCCTCAACTTCT
TCTGGTTCTAATTCTAATGCCTTGGTTCCTGTTAGTTGGAAAAGGCCACAGTTATCACAGCGAAGAACAAGAGAAAAGCTAATGAATGTG
CTTTCTCTCTGTGGTCCAGAATCTGGCCTCCCAAAGAACCCATCAGTTGTATTTTCTTCTAATGAGGATTTGGAAGTCGGTGACCAACAG
ACTAGCCTAATTTCTACAACAGAAGACATAAATCAAGAGGAAGAAGTAGCTGTGGAAGATAATAGCAGTGAACAACAGTTTGGTGTTTTT
AAGGATTTTGACTTTTTAGATGTTGAATTGGAAGATGCAGAGGGTGAAAGTATGGACAATTTCAACTGGGGAGTTCGCAGGCGCTCACTG
GACAGTATTGACAAAGGGGACACTCCATCCCTCCAGGAGTACCAGTGCTCTAGTAGCACCCCCAGCCTGAACCTCACCAATCAGGAGGAT
ACAGATGAGTCCTCGGAAGAAGAAGCGGCACTTACAGCAAGCCAGATACTCTCACGCACACAGATGTTAAACAGTGATTCTGCCACTGAT
GAAACAATACCAGACCATCCTGACTTACTTCTCCAGTCTGAAGATTCCACTGGCAGCATCACAACAGAGGAAGTGCTTCAAATCAGGGAT
GAGACCCCAACTTTGGAGGCTTCTCTAGATAATGCTAACAGCCGGCTGCCTGAGGATACAACTTCAGTATTAAAGGAGGAACATGTTACA
ACCTTTGAAGATGAAGGATCCTATATAATTCAAGAACAGCAGGAATCTCTTGTGTGTCAAGGAATTCTTGATTTAGAAGAAACTGAAATG
CCAGAGCCTCTAGCTCCTGAAAGTTACCCCGAGTCAGTCTGTGAAGAGGATGTTACCTTAGCTCTGAAAGAGCTAGATGAAAGATGTGAA
GAAGAAGAAGCGGATTTCTCCGGACTGTCTAGTCAAGATGAAGAAGAGCAAGATGGTTTTCCAGAAGTACAGACGTCGCCTCTGCCGTCA
CCATTTCTTTCTGCCATCATAGCCGCCTTTCAGCCCGTGGCATATGATGATGAAGAGGAAGCCTGGCGCTGCCACGTCAATCAGATGCTG
TCTGACACCGACGGGTCCTCTGCAGTGTTTACTTTTCATGTGTTTTCTAGGCTGTTTCAGACAATTCAAAGAAAGTTTGGAGAAATAACT
AATGAGGCAGTCAGCTTTCTTGGTGATAGTCTGCAACGCATTGGTACCAAATTTAAAAGTTCCTTGGAAGTGATGATGCTGTGTTCAGAA
TGCCCAACAGTCTTTGTGGATGCTGAAACACTGATGTCATGTGGTTTGCTGGAAACACTCAAGTTTGGTGTTTTGGAGTTGCAAGAACAC
CTGGATACATACAATGTGAAAAGAGAAGCCGCTGAGCAGTGGCTAGATGATTGTAAGAGGACATTTGGTGCCAAAGAAGACATGTATAGG
ATAAACACAGATGCACAACAAATGGAAATACTAGCAGAATTGGAGCTCTGCCGAAGATTATACAAATTGCATTTTCAATTGCTGCTTCTG
TTCCAGGCCTACTGTAAACTTATCAACCAAGTAAATACGATAAAAAATGAAGCAGAGGTCATCAACATGTCAGAGGAACTTGCCCAACTG
GAAAGTATCCTCAAAGAAGCTGAGTCCGCTTCCGAAAACGAAGAAATTGACATTTCCAAAGCTGCACAAACTACTATAGAAACTGCCATT
CATTCTTTAATTGAAACTTTGAAAAATAAAGAATTTATATCAGCTGTAGCACAAGTCAAAGCTTTCAGATCTCTCTGGCCCAGTGATATC
TTTGGCAGTTGTGAAGATGACCCTGTACAGACACTGTTACATATATATTTCCATCATCAGACGCTGGGCCAGACAGGAAGCTTTGCAGTT
ATAGGCTCTAACCTGGACATGTCAGAAGCCAACTACAAACTGATGGAACTTAATCTGGAAATAAGAGAGTCTCTACGCATGGTGCAATCA
TACCAACTTCTAGCACAGGCCAAACCAATGGGAAATATGGTGAGCACTGGATTCTGAGACACTTCAGGCCTTTAGGAAAGAAACTAAACT
GAAGATGATGAAGAATATTAACCAAGCACCTTTTATGGACCCTTGCATTCACTGATAACTTTCTGGCAGCATCTACTTTTTAGTGTAACT
AATGTCAAACTGTATCATCAAAAACAAAGATCTGAAAGAAAAAAACATCTGATATTTTAACAGCTGCCAATATCTCCCACAATAACTGCG
TGAAGAAGGAATTTTTTAATTACTTAACCTACGTGAAAAGAAAAGGGCTAAAAGTGATGCCTACAAATACATTACTTTCTGGGGAAAGAA
AAGAATTCCAAGAATGTTTGCAATAATGGCCTCCAATACTGAAACAACCAAAAGCAGGTGAAATGAGGCTGAAATCAAGGCTGTTTCATT
TTAGCTGAAGACCTGCAAAGCTGCTTGGATTTCTAGCAGTTGAAAACCTAACCTGCAATTGATGCTTAATCATCCATCCACATGAACATG
CAGTCAGCTATACGCATCAAGACTCGTTTGCAAAAACCATTGATTTTTCAGTATGTGGGATAAGGGTTTGGGTTTTTTTGTTTTTTGGTC
TGTATAAGGAATTATGTGTGTGTGAGTTGGGATGTATGGATATGTGATAGTCATATTTTCAAGGTATGGATGTTTGGTGATAACGTCTCA
GAGCATGCCTAAAAGAGCACTGCAAGATTATTTTTGAAGAAATGTTATTTTATTAGATCTAACTCTTCATAGTATGTAAATGTTAGAACA
TTTTAATAATATTTTAAAACTGGGCTTTCCCAGTATTTCAAAAAGAAATAATATATCTGTTAACGTTATTGGAATGCTGCTCAGTTCTCT
GATCAGTGCTTATGTTATGATTGTTGATAACTAACCAAAGTAGATGCCTGCAGAGACTTTAAAATGTAAAATAAAGATGTATGCTGCCTG
TCAGCTATTCTCATTAGAAAAGTTTTAACTTATTTTACTCCATATAGAAACTGTAGAGACTAAAACCAGTTATTTTCTTGTACATTTGTG
CCATGCACTGTTGTTATACAAGAATAGGTGTACAAAGCTAAAGAAAAATTGTGGTCATTGATGATGGAATATATGACTTGCAGGCTTTGA
AGTCTGCAGAATTCAAGAAAAGAGCTGCAAATGCATTTTTGTATCTTTATTCAGGACTCACATGCTTTACCCTAAAGAAACCTGGGGCTA
GGGGAAATGAAAGGAAGCCTGAAGACTGACTACCAAAACATGCAATATACTTATTCACTGTCTAAGTCTGTAGTATAACATGAACTGGAG
TCTCTATCCTTTTCTAAAATCGCATTTTGTAAGAAAAGAAAGAAAAAAAAAAAAAAAGAATGTAGTCCCACAACTCCTGATTTGAAAGAA
ACACCTTGTATTTTTTATATACATCTCTTATCCACTGTGACTTTTCTTTTAAACTGGGCTCTGTGATTCCAGAGTTTAGAATGTAGAAAT
GAAATGCTTAGCTTTACCTTTTCTTGGGGGGTGTGGACCCTGCCAGAAATGTAATTACGTATGCTCAAGTGCATTAATTGAAGGCACTGT
GCACACCATTGGACTGCTGACCACAGTTAAACATTTCCAGTAAAATTTCGTAACTGGTCACAGCTCATTCATAATCACTGTATTTTTTGA
CCCTGATAAAGACAATTATTTTGATGGTGTTCTGGTACTGTAATTGGTATCCTTTAAATTATTTAAAACTTTTGGGTGTGGGGCAGGCAG
AGAGGGATGGTGTCCAGAGATACATCACACTTTACATCCTATCTTACTGTCCTCTGTTTTTCTTACCCTCCTTACATCCTTTTTGTTAAA
AATAAAAAGCATTGTAGCTGTTGGTTTGTGTTGTATTTTAACAAAGAATGAATGATTACAGTGTGCATCATTTAGAAACCTTTCAAATGT
TACCTTCTTGAATTGCCCTAGAAAAGAACAAAATTAGTTGACTACCCAACCAAACCTTTCAGTTGATATTTGCTTTTTGTGTTTATTTAT

>In-frame_KMT2A_ENST00000354520_chr11_118355029_+_FRYL_ENST00000358350_chr4_48530355_-_8416nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGACACCAATTATT
GGAAACAAATATGGTGATCAGCACAGTGCGGCTGGAAGAAATGGGAAACCAAAAGTTATTGCTGTCACTAGAAGTACTTCCTCAACTTCT
TCTGGTTCTAATTCTAATGCCTTGGTTCCTGTTAGTTGGAAAAGGCCACAGTTATCACAGCGAAGAACAAGAGAAAAGCTAATGAATGTG
CTTTCTCTCTGTGGTCCAGAATCTGGCCTCCCAAAGAACCCATCAGTTGTATTTTCTTCTAATGAGGATTTGGAAGTCGGTGACCAACAG
ACTAGCCTAATTTCTACAACAGAAGACATAAATCAAGAGGAAGAAGTAGCTGTGGAAGATAATAGCAGTGAACAACAGTTTGGTGTTTTT
AAGGATTTTGACTTTTTAGATGTTGAATTGGAAGATGCAGAGGGTGAAAGTATGGACAATTTCAACTGGGGAGTTCGCAGGCGCTCACTG
GACAGTATTGACAAAGGGGACACTCCATCCCTCCAGGAGTACCAGTGCTCTAGTAGCACCCCCAGCCTGAACCTCACCAATCAGGAGGAT
ACAGATGAGTCCTCGGAAGAAGAAGCGGCACTTACAGCAAGCCAGATACTCTCACGCACACAGATGTTAAACAGTGATTCTGCCACTGAT
GAAACAATACCAGACCATCCTGACTTACTTCTCCAGTCTGAAGATTCCACTGGCAGCATCACAACAGAGGAAGTGCTTCAAATCAGGGAT
GAGACCCCAACTTTGGAGGCTTCTCTAGATAATGCTAACAGCCGGCTGCCTGAGGATACAACTTCAGTATTAAAGGAGGAACATGTTACA
ACCTTTGAAGATGAAGGATCCTATATAATTCAAGAACAGCAGGAATCTCTTGTGTGTCAAGGAATTCTTGATTTAGAAGAAACTGAAATG
CCAGAGCCTCTAGCTCCTGAAAGTTACCCCGAGTCAGTCTGTGAAGAGGATGTTACCTTAGCTCTGAAAGAGCTAGATGAAAGATGTGAA
GAAGAAGAAGCGGATTTCTCCGGACTGTCTAGTCAAGATGAAGAAGAGCAAGATGGTTTTCCAGAAGTACAGACGTCGCCTCTGCCGTCA
CCATTTCTTTCTGCCATCATAGCCGCCTTTCAGCCCGTGGCATATGATGATGAAGAGGAAGCCTGGCGCTGCCACGTCAATCAGATGCTG
TCTGACACCGACGGGTCCTCTGCAGTGTTTACTTTTCATGTGTTTTCTAGGCTGTTTCAGACAATTCAAAGAAAGTTTGGAGAAATAACT
AATGAGGCAGTCAGCTTTCTTGGTGATAGTCTGCAACGCATTGGTACCAAATTTAAAAGTTCCTTGGAAGTGATGATGCTGTGTTCAGAA
TGCCCAACAGTCTTTGTGGATGCTGAAACACTGATGTCATGTGGTTTGCTGGAAACACTCAAGTTTGGTGTTTTGGAGTTGCAAGAACAC
CTGGATACATACAATGTGAAAAGAGAAGCCGCTGAGCAGTGGCTAGATGATTGTAAGAGGACATTTGGTGCCAAAGAAGACATGTATAGG
ATAAACACAGATGCACAACAAATGGAAATACTAGCAGAATTGGAGCTCTGCCGAAGATTATACAAATTGCATTTTCAATTGCTGCTTCTG
TTCCAGGCCTACTGTAAACTTATCAACCAAGTAAATACGATAAAAAATGAAGCAGAGGTCATCAACATGTCAGAGGAACTTGCCCAACTG
GAAAGTATCCTCAAAGAAGCTGAGTCCGCTTCCGAAAACGAAGAAATTGACATTTCCAAAGCTGCACAAACTACTATAGAAACTGCCATT
CATTCTTTAATTGAAACTTTGAAAAATAAAGAATTTATATCAGCTGTAGCACAAGTCAAAGCTTTCAGATCTCTCTGGCCCAGTGATATC
TTTGGCAGTTGTGAAGATGACCCTGTACAGACACTGTTACATATATATTTCCATCATCAGACGCTGGGCCAGACAGGAAGCTTTGCAGTT
ATAGGCTCTAACCTGGACATGTCAGAAGCCAACTACAAACTGATGGAACTTAATCTGGAAATAAGAGAGTCTCTACGCATGGTGCAATCA
TACCAACTTCTAGCACAGGCCAAACCAATGGGAAATATGGTGAGCACTGGATTCTGAGACACTTCAGGCCTTTAGGAAAGAAACTAAACT
GAAGATGATGAAGAATATTAACCAAGCACCTTTTATGGACCCTTGCATTCACTGATAACTTTCTGGCAGCATCTACTTTTTAGTGTAACT
AATGTCAAACTGTATCATCAAAAACAAAGATCTGAAAGAAAAAAACATCTGATATTTTAACAGCTGCCAATATCTCCCACAATAACTGCG
TGAAGAAGGAATTTTTTAATTACTTAACCTACGTGAAAAGAAAAGGGCTAAAAGTGATGCCTACAAATACATTACTTTCTGGGGAAAGAA
AAGAATTCCAAGAATGTTTGCAATAATGGCCTCCAATACTGAAACAACCAAAAGCAGGTGAAATGAGGCTGAAATCAAGGCTGTTTCATT
TTAGCTGAAGACCTGCAAAGCTGCTTGGATTTCTAGCAGTTGAAAACCTAACCTGCAATTGATGCTTAATCATCCATCCACATGAACATG
CAGTCAGCTATACGCATCAAGACTCGTTTGCAAAAACCATTGATTTTTCAGTATGTGGGATAAGGGTTTGGGTTTTTTTGTTTTTTGGTC
TGTATAAGGAATTATGTGTGTGTGAGTTGGGATGTATGGATATGTGATAGTCATATTTTCAAGGTATGGATGTTTGGTGATAACGTCTCA
GAGCATGCCTAAAAGAGCACTGCAAGATTATTTTTGAAGAAATGTTATTTTATTAGATCTAACTCTTCATAGTATGTAAATGTTAGAACA
TTTTAATAATATTTTAAAACTGGGCTTTCCCAGTATTTCAAAAAGAAATAATATATCTGTTAACGTTATTGGAATGCTGCTCAGTTCTCT
GATCAGTGCTTATGTTATGATTGTTGATAACTAACCAAAGTAGATGCCTGCAGAGACTTTAAAATGTAAAATAAAGATGTATGCTGCCTG
TCAGCTATTCTCATTAGAAAAGTTTTAACTTATTTTACTCCATATAGAAACTGTAGAGACTAAAACCAGTTATTTTCTTGTACATTTGTG
CCATGCACTGTTGTTATACAAGAATAGGTGTACAAAGCTAAAGAAAAATTGTGGTCATTGATGATGGAATATATGACTTGCAGGCTTTGA
AGTCTGCAGAATTCAAGAAAAGAGCTGCAAATGCATTTTTGTATCTTTATTCAGGACTCACATGCTTTACCCTAAAGAAACCTGGGGCTA
GGGGAAATGAAAGGAAGCCTGAAGACTGACTACCAAAACATGCAATATACTTATTCACTGTCTAAGTCTGTAGTATAACATGAACTGGAG
TCTCTATCCTTTTCTAAAATCGCATTTTGTAAGAAAAGAAAGAAAAAAAAAAAAAAAGAATGTAGTCCCACAACTCCTGATTTGAAAGAA
ACACCTTGTATTTTTTATATACATCTCTTATCCACTGTGACTTTTCTTTTAAACTGGGCTCTGTGATTCCAGAGTTTAGAATGTAGAAAT
GAAATGCTTAGCTTTACCTTTTCTTGGGGGGTGTGGACCCTGCCAGAAATGTAATTACGTATGCTCAAGTGCATTAATTGAAGGCACTGT
GCACACCATTGGACTGCTGACCACAGTTAAACATTTCCAGTAAAATTTCGTAACTGGTCACAGCTCATTCATAATCACTGTATTTTTTGA
CCCTGATAAAGACAATTATTTTGATGGTGTTCTGGTACTGTAATTGGTATCCTTTAAATTATTTAAAACTTTTGGGTGTGGGGCAGGCAG
AGAGGGATGGTGTCCAGAGATACATCACACTTTACATCCTATCTTACTGTCCTCTGTTTTTCTTACCCTCCTTACATCCTTTTTGTTAAA
AATAAAAAGCATTGTAGCTGTTGGTTTGTGTTGTATTTTAACAAAGAATGAATGATTACAGTGTGCATCATTTAGAAACCTTTCAAATGT
TACCTTCTTGAATTGCCCTAGAAAAGAACAAAATTAGTTGACTACCCAACCAAACCTTTCAGTTGATATTTGCTTTTTGTGTTTATTTAT

>In-frame_KMT2A_ENST00000354520_chr11_118355029_+_FRYL_ENST00000537810_chr4_48530355_-_8416nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGACACCAATTATT
GGAAACAAATATGGTGATCAGCACAGTGCGGCTGGAAGAAATGGGAAACCAAAAGTTATTGCTGTCACTAGAAGTACTTCCTCAACTTCT
TCTGGTTCTAATTCTAATGCCTTGGTTCCTGTTAGTTGGAAAAGGCCACAGTTATCACAGCGAAGAACAAGAGAAAAGCTAATGAATGTG
CTTTCTCTCTGTGGTCCAGAATCTGGCCTCCCAAAGAACCCATCAGTTGTATTTTCTTCTAATGAGGATTTGGAAGTCGGTGACCAACAG
ACTAGCCTAATTTCTACAACAGAAGACATAAATCAAGAGGAAGAAGTAGCTGTGGAAGATAATAGCAGTGAACAACAGTTTGGTGTTTTT
AAGGATTTTGACTTTTTAGATGTTGAATTGGAAGATGCAGAGGGTGAAAGTATGGACAATTTCAACTGGGGAGTTCGCAGGCGCTCACTG
GACAGTATTGACAAAGGGGACACTCCATCCCTCCAGGAGTACCAGTGCTCTAGTAGCACCCCCAGCCTGAACCTCACCAATCAGGAGGAT
ACAGATGAGTCCTCGGAAGAAGAAGCGGCACTTACAGCAAGCCAGATACTCTCACGCACACAGATGTTAAACAGTGATTCTGCCACTGAT
GAAACAATACCAGACCATCCTGACTTACTTCTCCAGTCTGAAGATTCCACTGGCAGCATCACAACAGAGGAAGTGCTTCAAATCAGGGAT
GAGACCCCAACTTTGGAGGCTTCTCTAGATAATGCTAACAGCCGGCTGCCTGAGGATACAACTTCAGTATTAAAGGAGGAACATGTTACA
ACCTTTGAAGATGAAGGATCCTATATAATTCAAGAACAGCAGGAATCTCTTGTGTGTCAAGGAATTCTTGATTTAGAAGAAACTGAAATG
CCAGAGCCTCTAGCTCCTGAAAGTTACCCCGAGTCAGTCTGTGAAGAGGATGTTACCTTAGCTCTGAAAGAGCTAGATGAAAGATGTGAA
GAAGAAGAAGCGGATTTCTCCGGACTGTCTAGTCAAGATGAAGAAGAGCAAGATGGTTTTCCAGAAGTACAGACGTCGCCTCTGCCGTCA
CCATTTCTTTCTGCCATCATAGCCGCCTTTCAGCCCGTGGCATATGATGATGAAGAGGAAGCCTGGCGCTGCCACGTCAATCAGATGCTG
TCTGACACCGACGGGTCCTCTGCAGTGTTTACTTTTCATGTGTTTTCTAGGCTGTTTCAGACAATTCAAAGAAAGTTTGGAGAAATAACT
AATGAGGCAGTCAGCTTTCTTGGTGATAGTCTGCAACGCATTGGTACCAAATTTAAAAGTTCCTTGGAAGTGATGATGCTGTGTTCAGAA
TGCCCAACAGTCTTTGTGGATGCTGAAACACTGATGTCATGTGGTTTGCTGGAAACACTCAAGTTTGGTGTTTTGGAGTTGCAAGAACAC
CTGGATACATACAATGTGAAAAGAGAAGCCGCTGAGCAGTGGCTAGATGATTGTAAGAGGACATTTGGTGCCAAAGAAGACATGTATAGG
ATAAACACAGATGCACAACTCAATGAAATACTGGTTGAATTGGAGCTCTGCCGAAGATTATACAAATTGCATTTTCAATTGCTGCTTCTG
TTCCAGGCCTACTGTAAACTTATCAACCAAGTAAATACGATAAAAAATGAAGCAGAGGTCATCAACATGTCAGAGGAACTTGCCCAACTG
GAAAGTATCCTCAAAGAAGCTGAGTCCGCTTCCGAAAACGAAGAAATTGACATTTCCAAAGCTGCACAAACTACTATAGAAACTGCCATT
CATTCTTTAATTGAAACTTTGAAAAATAAAGAATTTATATCAGCTGTAGCACAAGTCAAAGCTTTCAGATCTCTCTGGCCCAGTGATATC
TTTGGCAGTTGTGAAGATGACCCTGTACAGACACTGTTACATATATATTTCCATCATCAGACGCTGGGCCAGACAGGAAGCTTTGCAGTT
ATAGGCTCTAACCTGGACATGTCAGAAGCCAACTACAAACTGATGGAACTTAATCTGGAAATAAGAGAGTCTCTACGCATGGTGCAATCA
TACCAACTTCTAGCACAGGCCAAACCAATGGGAAATATGGTGAGCACTGGATTCTGAGACACTTCAGGCCTTTAGGAAAGAAACTAAACT
GAAGATGATGAAGAATATTAACCAAGCACCTTTTATGGACCCTTGCATTCACTGATAACTTTCTGGCAGCATCTACTTTTTAGTGTAACT
AATGTCAAACTGTATCATCAAAAACAAAGATCTGAAAGAAAAAAACATCTGATATTTTAACAGCTGCCAATATCTCCCACAATAACTGCG
TGAAGAAGGAATTTTTTAATTACTTAACCTACGTGAAAAGAAAAGGGCTAAAAGTGATGCCTACAAATACATTACTTTCTGGGGAAAGAA
AAGAATTCCAAGAATGTTTGCAATAATGGCCTCCAATACTGAAACAACCAAAAGCAGGTGAAATGAGGCTGAAATCAAGGCTGTTTCATT
TTAGCTGAAGACCTGCAAAGCTGCTTGGATTTCTAGCAGTTGAAAACCTAACCTGCAATTGATGCTTAATCATCCATCCACATGAACATG
CAGTCAGCTATACGCATCAAGACTCGTTTGCAAAAACCATTGATTTTTCAGTATGTGGGATAAGGGTTTGGGTTTTTTTGTTTTTTGGTC
TGTATAAGGAATTATGTGTGTGTGAGTTGGGATGTATGGATATGTGATAGTCATATTTTCAAGGTATGGATGTTTGGTGATAACGTCTCA
GAGCATGCCTAAAAGAGCACTGCAAGATTATTTTTGAAGAAATGTTATTTTATTAGATCTAACTCTTCATAGTATGTAAATGTTAGAACA
TTTTAATAATATTTTAAAACTGGGCTTTCCCAGTATTTCAAAAAGAAATAATATATCTGTTAACGTTATTGGAATGCTGCTCAGTTCTCT
GATCAGTGCTTATGTTATGATTGTTGATAACTAACCAAAGTAGATGCCTGCAGAGACTTTAAAATGTAAAATAAAGATGTATGCTGCCTG
TCAGCTATTCTCATTAGAAAAGTTTTAACTTATTTTACTCCATATAGAAACTGTAGAGACTAAAACCAGTTATTTTCTTGTACATTTGTG
CCATGCACTGTTGTTATACAAGAATAGGTGTACAAAGCTAAAGAAAAATTGTGGTCATTGATGATGGAATATATGACTTGCAGGCTTTGA
AGTCTGCAGAATTCAAGAAAAGAGCTGCAAATGCATTTTTGTATCTTTATTCAGGACTCACATGCTTTACCCTAAAGAAACCTGGGGCTA
GGGGAAATGAAAGGAAGCCTGAAGACTGACTACCAAAACATGCAATATACTTATTCACTGTCTAAGTCTGTAGTATAACATGAACTGGAG
TCTCTATCCTTTTCTAAAATCGCATTTTGTAAGAAAAGAAAGAAAAAAAAAAAAAAAGAATGTAGTCCCACAACTCCTGATTTGAAAGAA
ACACCTTGTATTTTTTATATACATCTCTTATCCACTGTGACTTTTCTTTTAAACTGGGCTCTGTGATTCCAGAGTTTAGAATGTAGAAAT
GAAATGCTTAGCTTTACCTTTTCTTGGGGGGTGTGGACCCTGCCAGAAATGTAATTACGTATGCTCAAGTGCATTAATTGAAGGCACTGT
GCACACCATTGGACTGCTGACCACAGTTAAACATTTCCAGTAAAATTTCGTAACTGGTCACAGCTCATTCATAATCACTGTATTTTTTGA
CCCTGATAAAGACAATTATTTTGATGGTGTTCTGGTACTGTAATTGGTATCCTTTAAATTATTTAAAACTTTTGGGTGTGGGGCAGGCAG
AGAGGGATGGTGTCCAGAGATACATCACACTTTACATCCTATCTTACTGTCCTCTGTTTTTCTTACCCTCCTTACATCCTTTTTGTTAAA
AATAAAAAGCATTGTAGCTGTTGGTTTGTGTTGTATTTTAACAAAGAATGAATGATTACAGTGTGCATCATTTAGAAACCTTTCAAATGT
TACCTTCTTGAATTGCCCTAGAAAAGAACAAAATTAGTTGACTACCCAACCAAACCTTTCAGTTGATATTTGCTTTTTGTGTTTATTTAT

>In-frame_KMT2A_ENST00000534358_chr11_118355690_+_FRYL_ENST00000503238_chr4_48530355_-_8555nt
CTGCTTCACTTCACGGGGCGAACATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGG
GGCGCCGGGGCCTAGGGGGCGCCCCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGG
CGCCCCCCTCCCCCCCGGCTGTGGCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAG
CAGCCTCCTCGTCGTCCGCCTCGTCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCG
ACGCGGCGCTGCAGGTCTCGGCCGCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCG
GAGAGGATGAGCAATTCTTAGGTTTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTC
GAAAACCTCGTGGGAGACCTAGAAGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAG
AGACCAAATCTGGAGATAAGATCAAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAA
TCAAAATAACACATGGAAAGGACATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTA
CGTTTCAGCAAGCCACAAAGATTAAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAG
GAAGGAAGGGGGTACAAATTGTACGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTG
AACTGGAAAAGCCCCAGAAAGTCCGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTC
GAAGGATTAAGCCAGTTAGGATTATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGG
CTCAAAAGAAAATTGAAAAAGAAGCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTG
TTGTCAGTGCTATCTCCTCGCGGATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGAT
TAGAGTCTACACCGAATAGTAGATTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGT
CTTCAGACTCCTCTCGATCTAGTAGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGC
GGAGCGATACCCCTGAAGTTCATCCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAG
TGTCGGAGAGAAGTTTTGGATCTAGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTC
CACCTCTGCTGACTCCACCGCCACCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAG
CATCACCATTTTTGCCTGCTTCCACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAA
AGCATTCTAGGTCAGAGCCACAATACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGAC
CCCCTCCACTAACTCCCGAGGACGTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCC
ATTCTGGAACAAGGTTTGATATGCACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTG
AGTCTGTAACCTTGCCTAGTAATCGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTC
CTATTCGATCTGAACCAAGATCTCCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCC
CGTCTTCTGTCTCTTCCTCGTTAAGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCC
TGACTCAGTCTGGGGAATCTGCAGAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTA
CTCCTCTCTTCCCTTGGTTTACCCCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAG
ATGCTGACAAGAGCGTGGAGAAGGACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAA
GGAAAAAGGGATCAGAAATTCAGAGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCA
CTTCATCTTCTGCCAAAAAAGCAACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATA
CAACAGCTGTCAAAACCAAAATACTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCC
TGGAGAAGGAGAAAACCCTCTGCCTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGG
CAGACAAGCTTCCAATGACTGACAAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTC
TTAAACAAACCGACCAGCCCAAAGCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCA
GAAGAGCAGCTGTTGCCCTTGGCCGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAA
AGATTTTGTCTTCCATGGGGAATGATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTA
AACCTGTCACTAGAAACAAGGCACCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGG
TGCCTGAGGACTGTGGTGTTTGTACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAA
AATGTCAGAATCTACAATGGATGCCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCA
GTGAAAAGAAAGACAGCAAAGAGAGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTG
CCCCAAAGAAAAGCAGTAGTGAGCCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAAT
CCAAACAGGCCACCACTCCAGCTTCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAG
GACCGCCAAGAAAAGAAGTTCCCAAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCA
AACAGAAAAAAGTGGCTCCCCGCCCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGA
ATGCAGGCACTTTGAACATCCTCAGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAG
TGGACTTTAAGGAGGATTGTGAAGCAGAAAATGTGTGGGAGATGGGAGGCTTAGGAATCTTGACTTCTGTTCCTATAACACCCAGGGTGG
TTTGCTTTCTCTGTGCCAGTAGTGGGCATGTAGAGACACCAATTATTGGAAACAAATATGGTGATCAGCACAGTGCGGCTGGAAGAAATG
GGAAACCAAAAGTTATTGCTGTCACTAGAAGTACTTCCTCAACTTCTTCTGGTTCTAATTCTAATGCCTTGGTTCCTGTTAGTTGGAAAA
GGCCACAGTTATCACAGCGAAGAACAAGAGAAAAGCTAATGAATGTGCTTTCTCTCTGTGGTCCAGAATCTGGCCTCCCAAAGAACCCAT
CAGTTGTATTTTCTTCTAATGAGGATTTGGAAGTCGGTGACCAACAGACTAGCCTAATTTCTACAACAGAAGACATAAATCAAGAGGAAG
AAGTAGCTGTGGAAGATAATAGCAGTGAACAACAGTTTGGTGTTTTTAAGGATTTTGACTTTTTAGATGTTGAATTGGAAGATGCAGAGG
GTGAAAGTATGGACAATTTCAACTGGGGAGTTCGCAGGCGCTCACTGGACAGTATTGACAAAGGGGACACTCCATCCCTCCAGGAGTACC
AGTGCTCTAGTAGCACCCCCAGCCTGAACCTCACCAATCAGGAGGATACAGATGAGTCCTCGGAAGAAGAAGCGGCACTTACAGCAAGCC
AGATACTCTCACGCACACAGATGTTAAACAGTGATTCTGCCACTGATGAAACAATACCAGACCATCCTGACTTACTTCTCCAGTCTGAAG
ATTCCACTGGCAGCATCACAACAGAGGAAGTGCTTCAAATCAGGGATGAGACCCCAACTTTGGAGGCTTCTCTAGATAATGCTAACAGCC
GGCTGCCTGAGGATACAACTTCAGTATTAAAGGAGGAACATGTTACAACCTTTGAAGATGAAGGATCCTATATAATTCAAGAACAGCAGG
AATCTCTTGTGTGTCAAGGAATTCTTGATTTAGAAGAAACTGAAATGCCAGAGCCTCTAGCTCCTGAAAGTTACCCCGAGTCAGTCTGTG
AAGAGGATGTTACCTTAGCTCTGAAAGAGCTAGATGAAAGATGTGAAGAAGAAGAAGCGGATTTCTCCGGACTGTCTAGTCAAGATGAAG
AAGAGCAAGATGGTTTTCCAGAAGTACAGACGTCGCCTCTGCCGTCACCATTTCTTTCTGCCATCATAGCCGCCTTTCAGCCCGTGGCAT
ATGATGATGAAGAGGAAGCCTGGCGCTGCCACGTCAATCAGATGCTGTCTGACACCGACGGGTCCTCTGCAGTGTTTACTTTTCATGTGT
TTTCTAGGCTGTTTCAGACAATTCAAAGAAAGTTTGGAGAAATAACTAATGAGGCAGTCAGCTTTCTTGGTGATAGTCTGCAACGCATTG
GTACCAAATTTAAAAGTTCCTTGGAAGTGATGATGCTGTGTTCAGAATGCCCAACAGTCTTTGTGGATGCTGAAACACTGATGTCATGTG
GTTTGCTGGAAACACTCAAGTTTGGTGTTTTGGAGTTGCAAGAACACCTGGATACATACAATGTGAAAAGAGAAGCCGCTGAGCAGTGGC
TAGATGATTGTAAGAGGACATTTGGTGCCAAAGAAGACATGTATAGGATAAACACAGATGCACAACAAATGGAAATACTAGCAGAATTGG
AGCTCTGCCGAAGATTATACAAATTGCATTTTCAATTGCTGCTTCTGTTCCAGGCCTACTGTAAACTTATCAACCAAGTAAATACGATAA
AAAATGAAGCAGAGGTCATCAACATGTCAGAGGAACTTGCCCAACTGGAAAGTATCCTCAAAGAAGCTGAGTCCGCTTCCGAAAACGAAG
AAATTGACATTTCCAAAGCTGCACAAACTACTATAGAAACTGCCATTCATTCTTTAATTGAAACTTTGAAAAATAAAGAATTTATATCAG
CTGTAGCACAAGTCAAAGCTTTCAGATCTCTCTGGCCCAGTGATATCTTTGGCAGTTGTGAAGATGACCCTGTACAGACACTGTTACATA
TATATTTCCATCATCAGACGCTGGGCCAGACAGGAAGCTTTGCAGTTATAGGCTCTAACCTGGACATGTCAGAAGCCAACTACAAACTGA
TGGAACTTAATCTGGAAATAAGAGAGTCTCTACGCATGGTGCAATCATACCAACTTCTAGCACAGGCCAAACCAATGGGAAATATGGTGA
GCACTGGATTCTGAGACACTTCAGGCCTTTAGGAAAGAAACTAAACTGAAGATGATGAAGAATATTAACCAAGCACCTTTTATGGACCCT
TGCATTCACTGATAACTTTCTGGCAGCATCTACTTTTTAGTGTAACTAATGTCAAACTGTATCATCAAAAACAAAGATCTGAAAGAAAAA
AACATCTGATATTTTAACAGCTGCCAATATCTCCCACAATAACTGCGTGAAGAAGGAATTTTTTAATTACTTAACCTACGTGAAAAGAAA
AGGGCTAAAAGTGATGCCTACAAATACATTACTTTCTGGGGAAAGAAAAGAATTCCAAGAATGTTTGCAATAATGGCCTCCAATACTGAA
ACAACCAAAAGCAGGTGAAATGAGGCTGAAATCAAGGCTGTTTCATTTTAGCTGAAGACCTGCAAAGCTGCTTGGATTTCTAGCAGTTGA
AAACCTAACCTGCAATTGATGCTTAATCATCCATCCACATGAACATGCAGTCAGCTATACGCATCAAGACTCGTTTGCAAAAACCATTGA
TTTTTCAGTATGTGGGATAAGGGTTTGGGTTTTTTTGTTTTTTGGTCTGTATAAGGAATTATGTGTGTGTGAGTTGGGATGTATGGATAT
GTGATAGTCATATTTTCAAGGTATGGATGTTTGGTGATAACGTCTCAGAGCATGCCTAAAAGAGCACTGCAAGATTATTTTTGAAGAAAT
GTTATTTTATTAGATCTAACTCTTCATAGTATGTAAATGTTAGAACATTTTAATAATATTTTAAAACTGGGCTTTCCCAGTATTTCAAAA
AGAAATAATATATCTGTTAACGTTATTGGAATGCTGCTCAGTTCTCTGATCAGTGCTTATGTTATGATTGTTGATAACTAACCAAAGTAG
ATGCCTGCAGAGACTTTAAAATGTAAAATAAAGATGTATGCTGCCTGTCAGCTATTCTCATTAGAAAAGTTTTAACTTATTTTACTCCAT
ATAGAAACTGTAGAGACTAAAACCAGTTATTTTCTTGTACATTTGTGCCATGCACTGTTGTTATACAAGAATAGGTGTACAAAGCTAAAG
AAAAATTGTGGTCATTGATGATGGAATATATGACTTGCAGGCTTTGAAGTCTGCAGAATTCAAGAAAAGAGCTGCAAATGCATTTTTGTA
TCTTTATTCAGGACTCACATGCTTTACCCTAAAGAAACCTGGGGCTAGGGGAAATGAAAGGAAGCCTGAAGACTGACTACCAAAACATGC
AATATACTTATTCACTGTCTAAGTCTGTAGTATAACATGAACTGGAGTCTCTATCCTTTTCTAAAATCGCATTTTGTAAGAAAAGAAAGA
AAAAAAAAAAAAAAGAATGTAGTCCCACAACTCCTGATTTGAAAGAAACACCTTGTATTTTTTATATACATCTCTTATCCACTGTGACTT
TTCTTTTAAACTGGGCTCTGTGATTCCAGAGTTTAGAATGTAGAAATGAAATGCTTAGCTTTACCTTTTCTTGGGGGGTGTGGACCCTGC
CAGAAATGTAATTACGTATGCTCAAGTGCATTAATTGAAGGCACTGTGCACACCATTGGACTGCTGACCACAGTTAAACATTTCCAGTAA
AATTTCGTAACTGGTCACAGCTCATTCATAATCACTGTATTTTTTGACCCTGATAAAGACAATTATTTTGATGGTGTTCTGGTACTGTAA
TTGGTATCCTTTAAATTATTTAAAACTTTTGGGTGTGGGGCAGGCAGAGAGGGATGGTGTCCAGAGATACATCACACTTTACATCCTATC
TTACTGTCCTCTGTTTTTCTTACCCTCCTTACATCCTTTTTGTTAAAAATAAAAAGCATTGTAGCTGTTGGTTTGTGTTGTATTTTAACA
AAGAATGAATGATTACAGTGTGCATCATTTAGAAACCTTTCAAATGTTACCTTCTTGAATTGCCCTAGAAAAGAACAAAATTAGTTGACT
ACCCAACCAAACCTTTCAGTTGATATTTGCTTTTTGTGTTTATTTATATGTAACTAAGTCTATTAATATAATAAAAATGAATATACCTGC

>In-frame_KMT2A_ENST00000534358_chr11_118355690_+_FRYL_ENST00000358350_chr4_48530355_-_8553nt
CTGCTTCACTTCACGGGGCGAACATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGG
GGCGCCGGGGCCTAGGGGGCGCCCCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGG
CGCCCCCCTCCCCCCCGGCTGTGGCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAG
CAGCCTCCTCGTCGTCCGCCTCGTCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCG
ACGCGGCGCTGCAGGTCTCGGCCGCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCG
GAGAGGATGAGCAATTCTTAGGTTTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTC
GAAAACCTCGTGGGAGACCTAGAAGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAG
AGACCAAATCTGGAGATAAGATCAAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAA
TCAAAATAACACATGGAAAGGACATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTA
CGTTTCAGCAAGCCACAAAGATTAAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAG
GAAGGAAGGGGGTACAAATTGTACGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTG
AACTGGAAAAGCCCCAGAAAGTCCGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTC
GAAGGATTAAGCCAGTTAGGATTATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGG
CTCAAAAGAAAATTGAAAAAGAAGCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTG
TTGTCAGTGCTATCTCCTCGCGGATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGAT
TAGAGTCTACACCGAATAGTAGATTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGT
CTTCAGACTCCTCTCGATCTAGTAGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGC
GGAGCGATACCCCTGAAGTTCATCCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAG
TGTCGGAGAGAAGTTTTGGATCTAGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTC
CACCTCTGCTGACTCCACCGCCACCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAG
CATCACCATTTTTGCCTGCTTCCACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAA
AGCATTCTAGGTCAGAGCCACAATACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGAC
CCCCTCCACTAACTCCCGAGGACGTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCC
ATTCTGGAACAAGGTTTGATATGCACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTG
AGTCTGTAACCTTGCCTAGTAATCGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTC
CTATTCGATCTGAACCAAGATCTCCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCC
CGTCTTCTGTCTCTTCCTCGTTAAGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCC
TGACTCAGTCTGGGGAATCTGCAGAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTA
CTCCTCTCTTCCCTTGGTTTACCCCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAG
ATGCTGACAAGAGCGTGGAGAAGGACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAA
GGAAAAAGGGATCAGAAATTCAGAGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCA
CTTCATCTTCTGCCAAAAAAGCAACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATA
CAACAGCTGTCAAAACCAAAATACTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCC
TGGAGAAGGAGAAAACCCTCTGCCTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGG
CAGACAAGCTTCCAATGACTGACAAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTC
TTAAACAAACCGACCAGCCCAAAGCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCA
GAAGAGCAGCTGTTGCCCTTGGCCGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAA
AGATTTTGTCTTCCATGGGGAATGATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTA
AACCTGTCACTAGAAACAAGGCACCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGG
TGCCTGAGGACTGTGGTGTTTGTACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAA
AATGTCAGAATCTACAATGGATGCCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCA
GTGAAAAGAAAGACAGCAAAGAGAGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTG
CCCCAAAGAAAAGCAGTAGTGAGCCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAAT
CCAAACAGGCCACCACTCCAGCTTCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAG
GACCGCCAAGAAAAGAAGTTCCCAAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCA
AACAGAAAAAAGTGGCTCCCCGCCCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGA
ATGCAGGCACTTTGAACATCCTCAGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAG
TGGACTTTAAGGAGGATTGTGAAGCAGAAAATGTGTGGGAGATGGGAGGCTTAGGAATCTTGACTTCTGTTCCTATAACACCCAGGGTGG
TTTGCTTTCTCTGTGCCAGTAGTGGGCATGTAGAGACACCAATTATTGGAAACAAATATGGTGATCAGCACAGTGCGGCTGGAAGAAATG
GGAAACCAAAAGTTATTGCTGTCACTAGAAGTACTTCCTCAACTTCTTCTGGTTCTAATTCTAATGCCTTGGTTCCTGTTAGTTGGAAAA
GGCCACAGTTATCACAGCGAAGAACAAGAGAAAAGCTAATGAATGTGCTTTCTCTCTGTGGTCCAGAATCTGGCCTCCCAAAGAACCCAT
CAGTTGTATTTTCTTCTAATGAGGATTTGGAAGTCGGTGACCAACAGACTAGCCTAATTTCTACAACAGAAGACATAAATCAAGAGGAAG
AAGTAGCTGTGGAAGATAATAGCAGTGAACAACAGTTTGGTGTTTTTAAGGATTTTGACTTTTTAGATGTTGAATTGGAAGATGCAGAGG
GTGAAAGTATGGACAATTTCAACTGGGGAGTTCGCAGGCGCTCACTGGACAGTATTGACAAAGGGGACACTCCATCCCTCCAGGAGTACC
AGTGCTCTAGTAGCACCCCCAGCCTGAACCTCACCAATCAGGAGGATACAGATGAGTCCTCGGAAGAAGAAGCGGCACTTACAGCAAGCC
AGATACTCTCACGCACACAGATGTTAAACAGTGATTCTGCCACTGATGAAACAATACCAGACCATCCTGACTTACTTCTCCAGTCTGAAG
ATTCCACTGGCAGCATCACAACAGAGGAAGTGCTTCAAATCAGGGATGAGACCCCAACTTTGGAGGCTTCTCTAGATAATGCTAACAGCC
GGCTGCCTGAGGATACAACTTCAGTATTAAAGGAGGAACATGTTACAACCTTTGAAGATGAAGGATCCTATATAATTCAAGAACAGCAGG
AATCTCTTGTGTGTCAAGGAATTCTTGATTTAGAAGAAACTGAAATGCCAGAGCCTCTAGCTCCTGAAAGTTACCCCGAGTCAGTCTGTG
AAGAGGATGTTACCTTAGCTCTGAAAGAGCTAGATGAAAGATGTGAAGAAGAAGAAGCGGATTTCTCCGGACTGTCTAGTCAAGATGAAG
AAGAGCAAGATGGTTTTCCAGAAGTACAGACGTCGCCTCTGCCGTCACCATTTCTTTCTGCCATCATAGCCGCCTTTCAGCCCGTGGCAT
ATGATGATGAAGAGGAAGCCTGGCGCTGCCACGTCAATCAGATGCTGTCTGACACCGACGGGTCCTCTGCAGTGTTTACTTTTCATGTGT
TTTCTAGGCTGTTTCAGACAATTCAAAGAAAGTTTGGAGAAATAACTAATGAGGCAGTCAGCTTTCTTGGTGATAGTCTGCAACGCATTG
GTACCAAATTTAAAAGTTCCTTGGAAGTGATGATGCTGTGTTCAGAATGCCCAACAGTCTTTGTGGATGCTGAAACACTGATGTCATGTG
GTTTGCTGGAAACACTCAAGTTTGGTGTTTTGGAGTTGCAAGAACACCTGGATACATACAATGTGAAAAGAGAAGCCGCTGAGCAGTGGC
TAGATGATTGTAAGAGGACATTTGGTGCCAAAGAAGACATGTATAGGATAAACACAGATGCACAACAAATGGAAATACTAGCAGAATTGG
AGCTCTGCCGAAGATTATACAAATTGCATTTTCAATTGCTGCTTCTGTTCCAGGCCTACTGTAAACTTATCAACCAAGTAAATACGATAA
AAAATGAAGCAGAGGTCATCAACATGTCAGAGGAACTTGCCCAACTGGAAAGTATCCTCAAAGAAGCTGAGTCCGCTTCCGAAAACGAAG
AAATTGACATTTCCAAAGCTGCACAAACTACTATAGAAACTGCCATTCATTCTTTAATTGAAACTTTGAAAAATAAAGAATTTATATCAG
CTGTAGCACAAGTCAAAGCTTTCAGATCTCTCTGGCCCAGTGATATCTTTGGCAGTTGTGAAGATGACCCTGTACAGACACTGTTACATA
TATATTTCCATCATCAGACGCTGGGCCAGACAGGAAGCTTTGCAGTTATAGGCTCTAACCTGGACATGTCAGAAGCCAACTACAAACTGA
TGGAACTTAATCTGGAAATAAGAGAGTCTCTACGCATGGTGCAATCATACCAACTTCTAGCACAGGCCAAACCAATGGGAAATATGGTGA
GCACTGGATTCTGAGACACTTCAGGCCTTTAGGAAAGAAACTAAACTGAAGATGATGAAGAATATTAACCAAGCACCTTTTATGGACCCT
TGCATTCACTGATAACTTTCTGGCAGCATCTACTTTTTAGTGTAACTAATGTCAAACTGTATCATCAAAAACAAAGATCTGAAAGAAAAA
AACATCTGATATTTTAACAGCTGCCAATATCTCCCACAATAACTGCGTGAAGAAGGAATTTTTTAATTACTTAACCTACGTGAAAAGAAA
AGGGCTAAAAGTGATGCCTACAAATACATTACTTTCTGGGGAAAGAAAAGAATTCCAAGAATGTTTGCAATAATGGCCTCCAATACTGAA
ACAACCAAAAGCAGGTGAAATGAGGCTGAAATCAAGGCTGTTTCATTTTAGCTGAAGACCTGCAAAGCTGCTTGGATTTCTAGCAGTTGA
AAACCTAACCTGCAATTGATGCTTAATCATCCATCCACATGAACATGCAGTCAGCTATACGCATCAAGACTCGTTTGCAAAAACCATTGA
TTTTTCAGTATGTGGGATAAGGGTTTGGGTTTTTTTGTTTTTTGGTCTGTATAAGGAATTATGTGTGTGTGAGTTGGGATGTATGGATAT
GTGATAGTCATATTTTCAAGGTATGGATGTTTGGTGATAACGTCTCAGAGCATGCCTAAAAGAGCACTGCAAGATTATTTTTGAAGAAAT
GTTATTTTATTAGATCTAACTCTTCATAGTATGTAAATGTTAGAACATTTTAATAATATTTTAAAACTGGGCTTTCCCAGTATTTCAAAA
AGAAATAATATATCTGTTAACGTTATTGGAATGCTGCTCAGTTCTCTGATCAGTGCTTATGTTATGATTGTTGATAACTAACCAAAGTAG
ATGCCTGCAGAGACTTTAAAATGTAAAATAAAGATGTATGCTGCCTGTCAGCTATTCTCATTAGAAAAGTTTTAACTTATTTTACTCCAT
ATAGAAACTGTAGAGACTAAAACCAGTTATTTTCTTGTACATTTGTGCCATGCACTGTTGTTATACAAGAATAGGTGTACAAAGCTAAAG
AAAAATTGTGGTCATTGATGATGGAATATATGACTTGCAGGCTTTGAAGTCTGCAGAATTCAAGAAAAGAGCTGCAAATGCATTTTTGTA
TCTTTATTCAGGACTCACATGCTTTACCCTAAAGAAACCTGGGGCTAGGGGAAATGAAAGGAAGCCTGAAGACTGACTACCAAAACATGC
AATATACTTATTCACTGTCTAAGTCTGTAGTATAACATGAACTGGAGTCTCTATCCTTTTCTAAAATCGCATTTTGTAAGAAAAGAAAGA
AAAAAAAAAAAAAAGAATGTAGTCCCACAACTCCTGATTTGAAAGAAACACCTTGTATTTTTTATATACATCTCTTATCCACTGTGACTT
TTCTTTTAAACTGGGCTCTGTGATTCCAGAGTTTAGAATGTAGAAATGAAATGCTTAGCTTTACCTTTTCTTGGGGGGTGTGGACCCTGC
CAGAAATGTAATTACGTATGCTCAAGTGCATTAATTGAAGGCACTGTGCACACCATTGGACTGCTGACCACAGTTAAACATTTCCAGTAA
AATTTCGTAACTGGTCACAGCTCATTCATAATCACTGTATTTTTTGACCCTGATAAAGACAATTATTTTGATGGTGTTCTGGTACTGTAA
TTGGTATCCTTTAAATTATTTAAAACTTTTGGGTGTGGGGCAGGCAGAGAGGGATGGTGTCCAGAGATACATCACACTTTACATCCTATC
TTACTGTCCTCTGTTTTTCTTACCCTCCTTACATCCTTTTTGTTAAAAATAAAAAGCATTGTAGCTGTTGGTTTGTGTTGTATTTTAACA
AAGAATGAATGATTACAGTGTGCATCATTTAGAAACCTTTCAAATGTTACCTTCTTGAATTGCCCTAGAAAAGAACAAAATTAGTTGACT
ACCCAACCAAACCTTTCAGTTGATATTTGCTTTTTGTGTTTATTTATATGTAACTAAGTCTATTAATATAATAAAAATGAATATACCTGC

>In-frame_KMT2A_ENST00000534358_chr11_118355690_+_FRYL_ENST00000537810_chr4_48530355_-_8553nt
CTGCTTCACTTCACGGGGCGAACATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGG
GGCGCCGGGGCCTAGGGGGCGCCCCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGG
CGCCCCCCTCCCCCCCGGCTGTGGCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAG
CAGCCTCCTCGTCGTCCGCCTCGTCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCG
ACGCGGCGCTGCAGGTCTCGGCCGCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCG
GAGAGGATGAGCAATTCTTAGGTTTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTC
GAAAACCTCGTGGGAGACCTAGAAGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAG
AGACCAAATCTGGAGATAAGATCAAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAA
TCAAAATAACACATGGAAAGGACATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTA
CGTTTCAGCAAGCCACAAAGATTAAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAG
GAAGGAAGGGGGTACAAATTGTACGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTG
AACTGGAAAAGCCCCAGAAAGTCCGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTC
GAAGGATTAAGCCAGTTAGGATTATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGG
CTCAAAAGAAAATTGAAAAAGAAGCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTG
TTGTCAGTGCTATCTCCTCGCGGATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGAT
TAGAGTCTACACCGAATAGTAGATTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGT
CTTCAGACTCCTCTCGATCTAGTAGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGC
GGAGCGATACCCCTGAAGTTCATCCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAG
TGTCGGAGAGAAGTTTTGGATCTAGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTC
CACCTCTGCTGACTCCACCGCCACCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAG
CATCACCATTTTTGCCTGCTTCCACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAA
AGCATTCTAGGTCAGAGCCACAATACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGAC
CCCCTCCACTAACTCCCGAGGACGTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCC
ATTCTGGAACAAGGTTTGATATGCACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTG
AGTCTGTAACCTTGCCTAGTAATCGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTC
CTATTCGATCTGAACCAAGATCTCCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCC
CGTCTTCTGTCTCTTCCTCGTTAAGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCC
TGACTCAGTCTGGGGAATCTGCAGAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTA
CTCCTCTCTTCCCTTGGTTTACCCCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAG
ATGCTGACAAGAGCGTGGAGAAGGACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAA
GGAAAAAGGGATCAGAAATTCAGAGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCA
CTTCATCTTCTGCCAAAAAAGCAACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATA
CAACAGCTGTCAAAACCAAAATACTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCC
TGGAGAAGGAGAAAACCCTCTGCCTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGG
CAGACAAGCTTCCAATGACTGACAAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTC
TTAAACAAACCGACCAGCCCAAAGCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCA
GAAGAGCAGCTGTTGCCCTTGGCCGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAA
AGATTTTGTCTTCCATGGGGAATGATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTA
AACCTGTCACTAGAAACAAGGCACCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGG
TGCCTGAGGACTGTGGTGTTTGTACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAA
AATGTCAGAATCTACAATGGATGCCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCA
GTGAAAAGAAAGACAGCAAAGAGAGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTG
CCCCAAAGAAAAGCAGTAGTGAGCCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAAT
CCAAACAGGCCACCACTCCAGCTTCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAG
GACCGCCAAGAAAAGAAGTTCCCAAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCA
AACAGAAAAAAGTGGCTCCCCGCCCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGA
ATGCAGGCACTTTGAACATCCTCAGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAG
TGGACTTTAAGGAGGATTGTGAAGCAGAAAATGTGTGGGAGATGGGAGGCTTAGGAATCTTGACTTCTGTTCCTATAACACCCAGGGTGG
TTTGCTTTCTCTGTGCCAGTAGTGGGCATGTAGAGACACCAATTATTGGAAACAAATATGGTGATCAGCACAGTGCGGCTGGAAGAAATG
GGAAACCAAAAGTTATTGCTGTCACTAGAAGTACTTCCTCAACTTCTTCTGGTTCTAATTCTAATGCCTTGGTTCCTGTTAGTTGGAAAA
GGCCACAGTTATCACAGCGAAGAACAAGAGAAAAGCTAATGAATGTGCTTTCTCTCTGTGGTCCAGAATCTGGCCTCCCAAAGAACCCAT
CAGTTGTATTTTCTTCTAATGAGGATTTGGAAGTCGGTGACCAACAGACTAGCCTAATTTCTACAACAGAAGACATAAATCAAGAGGAAG
AAGTAGCTGTGGAAGATAATAGCAGTGAACAACAGTTTGGTGTTTTTAAGGATTTTGACTTTTTAGATGTTGAATTGGAAGATGCAGAGG
GTGAAAGTATGGACAATTTCAACTGGGGAGTTCGCAGGCGCTCACTGGACAGTATTGACAAAGGGGACACTCCATCCCTCCAGGAGTACC
AGTGCTCTAGTAGCACCCCCAGCCTGAACCTCACCAATCAGGAGGATACAGATGAGTCCTCGGAAGAAGAAGCGGCACTTACAGCAAGCC
AGATACTCTCACGCACACAGATGTTAAACAGTGATTCTGCCACTGATGAAACAATACCAGACCATCCTGACTTACTTCTCCAGTCTGAAG
ATTCCACTGGCAGCATCACAACAGAGGAAGTGCTTCAAATCAGGGATGAGACCCCAACTTTGGAGGCTTCTCTAGATAATGCTAACAGCC
GGCTGCCTGAGGATACAACTTCAGTATTAAAGGAGGAACATGTTACAACCTTTGAAGATGAAGGATCCTATATAATTCAAGAACAGCAGG
AATCTCTTGTGTGTCAAGGAATTCTTGATTTAGAAGAAACTGAAATGCCAGAGCCTCTAGCTCCTGAAAGTTACCCCGAGTCAGTCTGTG
AAGAGGATGTTACCTTAGCTCTGAAAGAGCTAGATGAAAGATGTGAAGAAGAAGAAGCGGATTTCTCCGGACTGTCTAGTCAAGATGAAG
AAGAGCAAGATGGTTTTCCAGAAGTACAGACGTCGCCTCTGCCGTCACCATTTCTTTCTGCCATCATAGCCGCCTTTCAGCCCGTGGCAT
ATGATGATGAAGAGGAAGCCTGGCGCTGCCACGTCAATCAGATGCTGTCTGACACCGACGGGTCCTCTGCAGTGTTTACTTTTCATGTGT
TTTCTAGGCTGTTTCAGACAATTCAAAGAAAGTTTGGAGAAATAACTAATGAGGCAGTCAGCTTTCTTGGTGATAGTCTGCAACGCATTG
GTACCAAATTTAAAAGTTCCTTGGAAGTGATGATGCTGTGTTCAGAATGCCCAACAGTCTTTGTGGATGCTGAAACACTGATGTCATGTG
GTTTGCTGGAAACACTCAAGTTTGGTGTTTTGGAGTTGCAAGAACACCTGGATACATACAATGTGAAAAGAGAAGCCGCTGAGCAGTGGC
TAGATGATTGTAAGAGGACATTTGGTGCCAAAGAAGACATGTATAGGATAAACACAGATGCACAACTCAATGAAATACTGGTTGAATTGG
AGCTCTGCCGAAGATTATACAAATTGCATTTTCAATTGCTGCTTCTGTTCCAGGCCTACTGTAAACTTATCAACCAAGTAAATACGATAA
AAAATGAAGCAGAGGTCATCAACATGTCAGAGGAACTTGCCCAACTGGAAAGTATCCTCAAAGAAGCTGAGTCCGCTTCCGAAAACGAAG
AAATTGACATTTCCAAAGCTGCACAAACTACTATAGAAACTGCCATTCATTCTTTAATTGAAACTTTGAAAAATAAAGAATTTATATCAG
CTGTAGCACAAGTCAAAGCTTTCAGATCTCTCTGGCCCAGTGATATCTTTGGCAGTTGTGAAGATGACCCTGTACAGACACTGTTACATA
TATATTTCCATCATCAGACGCTGGGCCAGACAGGAAGCTTTGCAGTTATAGGCTCTAACCTGGACATGTCAGAAGCCAACTACAAACTGA
TGGAACTTAATCTGGAAATAAGAGAGTCTCTACGCATGGTGCAATCATACCAACTTCTAGCACAGGCCAAACCAATGGGAAATATGGTGA
GCACTGGATTCTGAGACACTTCAGGCCTTTAGGAAAGAAACTAAACTGAAGATGATGAAGAATATTAACCAAGCACCTTTTATGGACCCT
TGCATTCACTGATAACTTTCTGGCAGCATCTACTTTTTAGTGTAACTAATGTCAAACTGTATCATCAAAAACAAAGATCTGAAAGAAAAA
AACATCTGATATTTTAACAGCTGCCAATATCTCCCACAATAACTGCGTGAAGAAGGAATTTTTTAATTACTTAACCTACGTGAAAAGAAA
AGGGCTAAAAGTGATGCCTACAAATACATTACTTTCTGGGGAAAGAAAAGAATTCCAAGAATGTTTGCAATAATGGCCTCCAATACTGAA
ACAACCAAAAGCAGGTGAAATGAGGCTGAAATCAAGGCTGTTTCATTTTAGCTGAAGACCTGCAAAGCTGCTTGGATTTCTAGCAGTTGA
AAACCTAACCTGCAATTGATGCTTAATCATCCATCCACATGAACATGCAGTCAGCTATACGCATCAAGACTCGTTTGCAAAAACCATTGA
TTTTTCAGTATGTGGGATAAGGGTTTGGGTTTTTTTGTTTTTTGGTCTGTATAAGGAATTATGTGTGTGTGAGTTGGGATGTATGGATAT
GTGATAGTCATATTTTCAAGGTATGGATGTTTGGTGATAACGTCTCAGAGCATGCCTAAAAGAGCACTGCAAGATTATTTTTGAAGAAAT
GTTATTTTATTAGATCTAACTCTTCATAGTATGTAAATGTTAGAACATTTTAATAATATTTTAAAACTGGGCTTTCCCAGTATTTCAAAA
AGAAATAATATATCTGTTAACGTTATTGGAATGCTGCTCAGTTCTCTGATCAGTGCTTATGTTATGATTGTTGATAACTAACCAAAGTAG
ATGCCTGCAGAGACTTTAAAATGTAAAATAAAGATGTATGCTGCCTGTCAGCTATTCTCATTAGAAAAGTTTTAACTTATTTTACTCCAT
ATAGAAACTGTAGAGACTAAAACCAGTTATTTTCTTGTACATTTGTGCCATGCACTGTTGTTATACAAGAATAGGTGTACAAAGCTAAAG
AAAAATTGTGGTCATTGATGATGGAATATATGACTTGCAGGCTTTGAAGTCTGCAGAATTCAAGAAAAGAGCTGCAAATGCATTTTTGTA
TCTTTATTCAGGACTCACATGCTTTACCCTAAAGAAACCTGGGGCTAGGGGAAATGAAAGGAAGCCTGAAGACTGACTACCAAAACATGC
AATATACTTATTCACTGTCTAAGTCTGTAGTATAACATGAACTGGAGTCTCTATCCTTTTCTAAAATCGCATTTTGTAAGAAAAGAAAGA
AAAAAAAAAAAAAAGAATGTAGTCCCACAACTCCTGATTTGAAAGAAACACCTTGTATTTTTTATATACATCTCTTATCCACTGTGACTT
TTCTTTTAAACTGGGCTCTGTGATTCCAGAGTTTAGAATGTAGAAATGAAATGCTTAGCTTTACCTTTTCTTGGGGGGTGTGGACCCTGC
CAGAAATGTAATTACGTATGCTCAAGTGCATTAATTGAAGGCACTGTGCACACCATTGGACTGCTGACCACAGTTAAACATTTCCAGTAA
AATTTCGTAACTGGTCACAGCTCATTCATAATCACTGTATTTTTTGACCCTGATAAAGACAATTATTTTGATGGTGTTCTGGTACTGTAA
TTGGTATCCTTTAAATTATTTAAAACTTTTGGGTGTGGGGCAGGCAGAGAGGGATGGTGTCCAGAGATACATCACACTTTACATCCTATC
TTACTGTCCTCTGTTTTTCTTACCCTCCTTACATCCTTTTTGTTAAAAATAAAAAGCATTGTAGCTGTTGGTTTGTGTTGTATTTTAACA
AAGAATGAATGATTACAGTGTGCATCATTTAGAAACCTTTCAAATGTTACCTTCTTGAATTGCCCTAGAAAAGAACAAAATTAGTTGACT
ACCCAACCAAACCTTTCAGTTGATATTTGCTTTTTGTGTTTATTTATATGTAACTAAGTCTATTAATATAATAAAAATGAATATACCTGC

>In-frame_KMT2A_ENST00000389506_chr11_118355690_+_FRYL_ENST00000503238_chr4_48530355_-_8532nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGGAGGATTGTGAA
GCAGAAAATGTGTGGGAGATGGGAGGCTTAGGAATCTTGACTTCTGTTCCTATAACACCCAGGGTGGTTTGCTTTCTCTGTGCCAGTAGT
GGGCATGTAGAGACACCAATTATTGGAAACAAATATGGTGATCAGCACAGTGCGGCTGGAAGAAATGGGAAACCAAAAGTTATTGCTGTC
ACTAGAAGTACTTCCTCAACTTCTTCTGGTTCTAATTCTAATGCCTTGGTTCCTGTTAGTTGGAAAAGGCCACAGTTATCACAGCGAAGA
ACAAGAGAAAAGCTAATGAATGTGCTTTCTCTCTGTGGTCCAGAATCTGGCCTCCCAAAGAACCCATCAGTTGTATTTTCTTCTAATGAG
GATTTGGAAGTCGGTGACCAACAGACTAGCCTAATTTCTACAACAGAAGACATAAATCAAGAGGAAGAAGTAGCTGTGGAAGATAATAGC
AGTGAACAACAGTTTGGTGTTTTTAAGGATTTTGACTTTTTAGATGTTGAATTGGAAGATGCAGAGGGTGAAAGTATGGACAATTTCAAC
TGGGGAGTTCGCAGGCGCTCACTGGACAGTATTGACAAAGGGGACACTCCATCCCTCCAGGAGTACCAGTGCTCTAGTAGCACCCCCAGC
CTGAACCTCACCAATCAGGAGGATACAGATGAGTCCTCGGAAGAAGAAGCGGCACTTACAGCAAGCCAGATACTCTCACGCACACAGATG
TTAAACAGTGATTCTGCCACTGATGAAACAATACCAGACCATCCTGACTTACTTCTCCAGTCTGAAGATTCCACTGGCAGCATCACAACA
GAGGAAGTGCTTCAAATCAGGGATGAGACCCCAACTTTGGAGGCTTCTCTAGATAATGCTAACAGCCGGCTGCCTGAGGATACAACTTCA
GTATTAAAGGAGGAACATGTTACAACCTTTGAAGATGAAGGATCCTATATAATTCAAGAACAGCAGGAATCTCTTGTGTGTCAAGGAATT
CTTGATTTAGAAGAAACTGAAATGCCAGAGCCTCTAGCTCCTGAAAGTTACCCCGAGTCAGTCTGTGAAGAGGATGTTACCTTAGCTCTG
AAAGAGCTAGATGAAAGATGTGAAGAAGAAGAAGCGGATTTCTCCGGACTGTCTAGTCAAGATGAAGAAGAGCAAGATGGTTTTCCAGAA
GTACAGACGTCGCCTCTGCCGTCACCATTTCTTTCTGCCATCATAGCCGCCTTTCAGCCCGTGGCATATGATGATGAAGAGGAAGCCTGG
CGCTGCCACGTCAATCAGATGCTGTCTGACACCGACGGGTCCTCTGCAGTGTTTACTTTTCATGTGTTTTCTAGGCTGTTTCAGACAATT
CAAAGAAAGTTTGGAGAAATAACTAATGAGGCAGTCAGCTTTCTTGGTGATAGTCTGCAACGCATTGGTACCAAATTTAAAAGTTCCTTG
GAAGTGATGATGCTGTGTTCAGAATGCCCAACAGTCTTTGTGGATGCTGAAACACTGATGTCATGTGGTTTGCTGGAAACACTCAAGTTT
GGTGTTTTGGAGTTGCAAGAACACCTGGATACATACAATGTGAAAAGAGAAGCCGCTGAGCAGTGGCTAGATGATTGTAAGAGGACATTT
GGTGCCAAAGAAGACATGTATAGGATAAACACAGATGCACAACAAATGGAAATACTAGCAGAATTGGAGCTCTGCCGAAGATTATACAAA
TTGCATTTTCAATTGCTGCTTCTGTTCCAGGCCTACTGTAAACTTATCAACCAAGTAAATACGATAAAAAATGAAGCAGAGGTCATCAAC
ATGTCAGAGGAACTTGCCCAACTGGAAAGTATCCTCAAAGAAGCTGAGTCCGCTTCCGAAAACGAAGAAATTGACATTTCCAAAGCTGCA
CAAACTACTATAGAAACTGCCATTCATTCTTTAATTGAAACTTTGAAAAATAAAGAATTTATATCAGCTGTAGCACAAGTCAAAGCTTTC
AGATCTCTCTGGCCCAGTGATATCTTTGGCAGTTGTGAAGATGACCCTGTACAGACACTGTTACATATATATTTCCATCATCAGACGCTG
GGCCAGACAGGAAGCTTTGCAGTTATAGGCTCTAACCTGGACATGTCAGAAGCCAACTACAAACTGATGGAACTTAATCTGGAAATAAGA
GAGTCTCTACGCATGGTGCAATCATACCAACTTCTAGCACAGGCCAAACCAATGGGAAATATGGTGAGCACTGGATTCTGAGACACTTCA
GGCCTTTAGGAAAGAAACTAAACTGAAGATGATGAAGAATATTAACCAAGCACCTTTTATGGACCCTTGCATTCACTGATAACTTTCTGG
CAGCATCTACTTTTTAGTGTAACTAATGTCAAACTGTATCATCAAAAACAAAGATCTGAAAGAAAAAAACATCTGATATTTTAACAGCTG
CCAATATCTCCCACAATAACTGCGTGAAGAAGGAATTTTTTAATTACTTAACCTACGTGAAAAGAAAAGGGCTAAAAGTGATGCCTACAA
ATACATTACTTTCTGGGGAAAGAAAAGAATTCCAAGAATGTTTGCAATAATGGCCTCCAATACTGAAACAACCAAAAGCAGGTGAAATGA
GGCTGAAATCAAGGCTGTTTCATTTTAGCTGAAGACCTGCAAAGCTGCTTGGATTTCTAGCAGTTGAAAACCTAACCTGCAATTGATGCT
TAATCATCCATCCACATGAACATGCAGTCAGCTATACGCATCAAGACTCGTTTGCAAAAACCATTGATTTTTCAGTATGTGGGATAAGGG
TTTGGGTTTTTTTGTTTTTTGGTCTGTATAAGGAATTATGTGTGTGTGAGTTGGGATGTATGGATATGTGATAGTCATATTTTCAAGGTA
TGGATGTTTGGTGATAACGTCTCAGAGCATGCCTAAAAGAGCACTGCAAGATTATTTTTGAAGAAATGTTATTTTATTAGATCTAACTCT
TCATAGTATGTAAATGTTAGAACATTTTAATAATATTTTAAAACTGGGCTTTCCCAGTATTTCAAAAAGAAATAATATATCTGTTAACGT
TATTGGAATGCTGCTCAGTTCTCTGATCAGTGCTTATGTTATGATTGTTGATAACTAACCAAAGTAGATGCCTGCAGAGACTTTAAAATG
TAAAATAAAGATGTATGCTGCCTGTCAGCTATTCTCATTAGAAAAGTTTTAACTTATTTTACTCCATATAGAAACTGTAGAGACTAAAAC
CAGTTATTTTCTTGTACATTTGTGCCATGCACTGTTGTTATACAAGAATAGGTGTACAAAGCTAAAGAAAAATTGTGGTCATTGATGATG
GAATATATGACTTGCAGGCTTTGAAGTCTGCAGAATTCAAGAAAAGAGCTGCAAATGCATTTTTGTATCTTTATTCAGGACTCACATGCT
TTACCCTAAAGAAACCTGGGGCTAGGGGAAATGAAAGGAAGCCTGAAGACTGACTACCAAAACATGCAATATACTTATTCACTGTCTAAG
TCTGTAGTATAACATGAACTGGAGTCTCTATCCTTTTCTAAAATCGCATTTTGTAAGAAAAGAAAGAAAAAAAAAAAAAAAGAATGTAGT
CCCACAACTCCTGATTTGAAAGAAACACCTTGTATTTTTTATATACATCTCTTATCCACTGTGACTTTTCTTTTAAACTGGGCTCTGTGA
TTCCAGAGTTTAGAATGTAGAAATGAAATGCTTAGCTTTACCTTTTCTTGGGGGGTGTGGACCCTGCCAGAAATGTAATTACGTATGCTC
AAGTGCATTAATTGAAGGCACTGTGCACACCATTGGACTGCTGACCACAGTTAAACATTTCCAGTAAAATTTCGTAACTGGTCACAGCTC
ATTCATAATCACTGTATTTTTTGACCCTGATAAAGACAATTATTTTGATGGTGTTCTGGTACTGTAATTGGTATCCTTTAAATTATTTAA
AACTTTTGGGTGTGGGGCAGGCAGAGAGGGATGGTGTCCAGAGATACATCACACTTTACATCCTATCTTACTGTCCTCTGTTTTTCTTAC
CCTCCTTACATCCTTTTTGTTAAAAATAAAAAGCATTGTAGCTGTTGGTTTGTGTTGTATTTTAACAAAGAATGAATGATTACAGTGTGC
ATCATTTAGAAACCTTTCAAATGTTACCTTCTTGAATTGCCCTAGAAAAGAACAAAATTAGTTGACTACCCAACCAAACCTTTCAGTTGA

>In-frame_KMT2A_ENST00000389506_chr11_118355690_+_FRYL_ENST00000358350_chr4_48530355_-_8530nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGGAGGATTGTGAA
GCAGAAAATGTGTGGGAGATGGGAGGCTTAGGAATCTTGACTTCTGTTCCTATAACACCCAGGGTGGTTTGCTTTCTCTGTGCCAGTAGT
GGGCATGTAGAGACACCAATTATTGGAAACAAATATGGTGATCAGCACAGTGCGGCTGGAAGAAATGGGAAACCAAAAGTTATTGCTGTC
ACTAGAAGTACTTCCTCAACTTCTTCTGGTTCTAATTCTAATGCCTTGGTTCCTGTTAGTTGGAAAAGGCCACAGTTATCACAGCGAAGA
ACAAGAGAAAAGCTAATGAATGTGCTTTCTCTCTGTGGTCCAGAATCTGGCCTCCCAAAGAACCCATCAGTTGTATTTTCTTCTAATGAG
GATTTGGAAGTCGGTGACCAACAGACTAGCCTAATTTCTACAACAGAAGACATAAATCAAGAGGAAGAAGTAGCTGTGGAAGATAATAGC
AGTGAACAACAGTTTGGTGTTTTTAAGGATTTTGACTTTTTAGATGTTGAATTGGAAGATGCAGAGGGTGAAAGTATGGACAATTTCAAC
TGGGGAGTTCGCAGGCGCTCACTGGACAGTATTGACAAAGGGGACACTCCATCCCTCCAGGAGTACCAGTGCTCTAGTAGCACCCCCAGC
CTGAACCTCACCAATCAGGAGGATACAGATGAGTCCTCGGAAGAAGAAGCGGCACTTACAGCAAGCCAGATACTCTCACGCACACAGATG
TTAAACAGTGATTCTGCCACTGATGAAACAATACCAGACCATCCTGACTTACTTCTCCAGTCTGAAGATTCCACTGGCAGCATCACAACA
GAGGAAGTGCTTCAAATCAGGGATGAGACCCCAACTTTGGAGGCTTCTCTAGATAATGCTAACAGCCGGCTGCCTGAGGATACAACTTCA
GTATTAAAGGAGGAACATGTTACAACCTTTGAAGATGAAGGATCCTATATAATTCAAGAACAGCAGGAATCTCTTGTGTGTCAAGGAATT
CTTGATTTAGAAGAAACTGAAATGCCAGAGCCTCTAGCTCCTGAAAGTTACCCCGAGTCAGTCTGTGAAGAGGATGTTACCTTAGCTCTG
AAAGAGCTAGATGAAAGATGTGAAGAAGAAGAAGCGGATTTCTCCGGACTGTCTAGTCAAGATGAAGAAGAGCAAGATGGTTTTCCAGAA
GTACAGACGTCGCCTCTGCCGTCACCATTTCTTTCTGCCATCATAGCCGCCTTTCAGCCCGTGGCATATGATGATGAAGAGGAAGCCTGG
CGCTGCCACGTCAATCAGATGCTGTCTGACACCGACGGGTCCTCTGCAGTGTTTACTTTTCATGTGTTTTCTAGGCTGTTTCAGACAATT
CAAAGAAAGTTTGGAGAAATAACTAATGAGGCAGTCAGCTTTCTTGGTGATAGTCTGCAACGCATTGGTACCAAATTTAAAAGTTCCTTG
GAAGTGATGATGCTGTGTTCAGAATGCCCAACAGTCTTTGTGGATGCTGAAACACTGATGTCATGTGGTTTGCTGGAAACACTCAAGTTT
GGTGTTTTGGAGTTGCAAGAACACCTGGATACATACAATGTGAAAAGAGAAGCCGCTGAGCAGTGGCTAGATGATTGTAAGAGGACATTT
GGTGCCAAAGAAGACATGTATAGGATAAACACAGATGCACAACAAATGGAAATACTAGCAGAATTGGAGCTCTGCCGAAGATTATACAAA
TTGCATTTTCAATTGCTGCTTCTGTTCCAGGCCTACTGTAAACTTATCAACCAAGTAAATACGATAAAAAATGAAGCAGAGGTCATCAAC
ATGTCAGAGGAACTTGCCCAACTGGAAAGTATCCTCAAAGAAGCTGAGTCCGCTTCCGAAAACGAAGAAATTGACATTTCCAAAGCTGCA
CAAACTACTATAGAAACTGCCATTCATTCTTTAATTGAAACTTTGAAAAATAAAGAATTTATATCAGCTGTAGCACAAGTCAAAGCTTTC
AGATCTCTCTGGCCCAGTGATATCTTTGGCAGTTGTGAAGATGACCCTGTACAGACACTGTTACATATATATTTCCATCATCAGACGCTG
GGCCAGACAGGAAGCTTTGCAGTTATAGGCTCTAACCTGGACATGTCAGAAGCCAACTACAAACTGATGGAACTTAATCTGGAAATAAGA
GAGTCTCTACGCATGGTGCAATCATACCAACTTCTAGCACAGGCCAAACCAATGGGAAATATGGTGAGCACTGGATTCTGAGACACTTCA
GGCCTTTAGGAAAGAAACTAAACTGAAGATGATGAAGAATATTAACCAAGCACCTTTTATGGACCCTTGCATTCACTGATAACTTTCTGG
CAGCATCTACTTTTTAGTGTAACTAATGTCAAACTGTATCATCAAAAACAAAGATCTGAAAGAAAAAAACATCTGATATTTTAACAGCTG
CCAATATCTCCCACAATAACTGCGTGAAGAAGGAATTTTTTAATTACTTAACCTACGTGAAAAGAAAAGGGCTAAAAGTGATGCCTACAA
ATACATTACTTTCTGGGGAAAGAAAAGAATTCCAAGAATGTTTGCAATAATGGCCTCCAATACTGAAACAACCAAAAGCAGGTGAAATGA
GGCTGAAATCAAGGCTGTTTCATTTTAGCTGAAGACCTGCAAAGCTGCTTGGATTTCTAGCAGTTGAAAACCTAACCTGCAATTGATGCT
TAATCATCCATCCACATGAACATGCAGTCAGCTATACGCATCAAGACTCGTTTGCAAAAACCATTGATTTTTCAGTATGTGGGATAAGGG
TTTGGGTTTTTTTGTTTTTTGGTCTGTATAAGGAATTATGTGTGTGTGAGTTGGGATGTATGGATATGTGATAGTCATATTTTCAAGGTA
TGGATGTTTGGTGATAACGTCTCAGAGCATGCCTAAAAGAGCACTGCAAGATTATTTTTGAAGAAATGTTATTTTATTAGATCTAACTCT
TCATAGTATGTAAATGTTAGAACATTTTAATAATATTTTAAAACTGGGCTTTCCCAGTATTTCAAAAAGAAATAATATATCTGTTAACGT
TATTGGAATGCTGCTCAGTTCTCTGATCAGTGCTTATGTTATGATTGTTGATAACTAACCAAAGTAGATGCCTGCAGAGACTTTAAAATG
TAAAATAAAGATGTATGCTGCCTGTCAGCTATTCTCATTAGAAAAGTTTTAACTTATTTTACTCCATATAGAAACTGTAGAGACTAAAAC
CAGTTATTTTCTTGTACATTTGTGCCATGCACTGTTGTTATACAAGAATAGGTGTACAAAGCTAAAGAAAAATTGTGGTCATTGATGATG
GAATATATGACTTGCAGGCTTTGAAGTCTGCAGAATTCAAGAAAAGAGCTGCAAATGCATTTTTGTATCTTTATTCAGGACTCACATGCT
TTACCCTAAAGAAACCTGGGGCTAGGGGAAATGAAAGGAAGCCTGAAGACTGACTACCAAAACATGCAATATACTTATTCACTGTCTAAG
TCTGTAGTATAACATGAACTGGAGTCTCTATCCTTTTCTAAAATCGCATTTTGTAAGAAAAGAAAGAAAAAAAAAAAAAAAGAATGTAGT
CCCACAACTCCTGATTTGAAAGAAACACCTTGTATTTTTTATATACATCTCTTATCCACTGTGACTTTTCTTTTAAACTGGGCTCTGTGA
TTCCAGAGTTTAGAATGTAGAAATGAAATGCTTAGCTTTACCTTTTCTTGGGGGGTGTGGACCCTGCCAGAAATGTAATTACGTATGCTC
AAGTGCATTAATTGAAGGCACTGTGCACACCATTGGACTGCTGACCACAGTTAAACATTTCCAGTAAAATTTCGTAACTGGTCACAGCTC
ATTCATAATCACTGTATTTTTTGACCCTGATAAAGACAATTATTTTGATGGTGTTCTGGTACTGTAATTGGTATCCTTTAAATTATTTAA
AACTTTTGGGTGTGGGGCAGGCAGAGAGGGATGGTGTCCAGAGATACATCACACTTTACATCCTATCTTACTGTCCTCTGTTTTTCTTAC
CCTCCTTACATCCTTTTTGTTAAAAATAAAAAGCATTGTAGCTGTTGGTTTGTGTTGTATTTTAACAAAGAATGAATGATTACAGTGTGC
ATCATTTAGAAACCTTTCAAATGTTACCTTCTTGAATTGCCCTAGAAAAGAACAAAATTAGTTGACTACCCAACCAAACCTTTCAGTTGA

>In-frame_KMT2A_ENST00000389506_chr11_118355690_+_FRYL_ENST00000537810_chr4_48530355_-_8530nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGGAGGATTGTGAA
GCAGAAAATGTGTGGGAGATGGGAGGCTTAGGAATCTTGACTTCTGTTCCTATAACACCCAGGGTGGTTTGCTTTCTCTGTGCCAGTAGT
GGGCATGTAGAGACACCAATTATTGGAAACAAATATGGTGATCAGCACAGTGCGGCTGGAAGAAATGGGAAACCAAAAGTTATTGCTGTC
ACTAGAAGTACTTCCTCAACTTCTTCTGGTTCTAATTCTAATGCCTTGGTTCCTGTTAGTTGGAAAAGGCCACAGTTATCACAGCGAAGA
ACAAGAGAAAAGCTAATGAATGTGCTTTCTCTCTGTGGTCCAGAATCTGGCCTCCCAAAGAACCCATCAGTTGTATTTTCTTCTAATGAG
GATTTGGAAGTCGGTGACCAACAGACTAGCCTAATTTCTACAACAGAAGACATAAATCAAGAGGAAGAAGTAGCTGTGGAAGATAATAGC
AGTGAACAACAGTTTGGTGTTTTTAAGGATTTTGACTTTTTAGATGTTGAATTGGAAGATGCAGAGGGTGAAAGTATGGACAATTTCAAC
TGGGGAGTTCGCAGGCGCTCACTGGACAGTATTGACAAAGGGGACACTCCATCCCTCCAGGAGTACCAGTGCTCTAGTAGCACCCCCAGC
CTGAACCTCACCAATCAGGAGGATACAGATGAGTCCTCGGAAGAAGAAGCGGCACTTACAGCAAGCCAGATACTCTCACGCACACAGATG
TTAAACAGTGATTCTGCCACTGATGAAACAATACCAGACCATCCTGACTTACTTCTCCAGTCTGAAGATTCCACTGGCAGCATCACAACA
GAGGAAGTGCTTCAAATCAGGGATGAGACCCCAACTTTGGAGGCTTCTCTAGATAATGCTAACAGCCGGCTGCCTGAGGATACAACTTCA
GTATTAAAGGAGGAACATGTTACAACCTTTGAAGATGAAGGATCCTATATAATTCAAGAACAGCAGGAATCTCTTGTGTGTCAAGGAATT
CTTGATTTAGAAGAAACTGAAATGCCAGAGCCTCTAGCTCCTGAAAGTTACCCCGAGTCAGTCTGTGAAGAGGATGTTACCTTAGCTCTG
AAAGAGCTAGATGAAAGATGTGAAGAAGAAGAAGCGGATTTCTCCGGACTGTCTAGTCAAGATGAAGAAGAGCAAGATGGTTTTCCAGAA
GTACAGACGTCGCCTCTGCCGTCACCATTTCTTTCTGCCATCATAGCCGCCTTTCAGCCCGTGGCATATGATGATGAAGAGGAAGCCTGG
CGCTGCCACGTCAATCAGATGCTGTCTGACACCGACGGGTCCTCTGCAGTGTTTACTTTTCATGTGTTTTCTAGGCTGTTTCAGACAATT
CAAAGAAAGTTTGGAGAAATAACTAATGAGGCAGTCAGCTTTCTTGGTGATAGTCTGCAACGCATTGGTACCAAATTTAAAAGTTCCTTG
GAAGTGATGATGCTGTGTTCAGAATGCCCAACAGTCTTTGTGGATGCTGAAACACTGATGTCATGTGGTTTGCTGGAAACACTCAAGTTT
GGTGTTTTGGAGTTGCAAGAACACCTGGATACATACAATGTGAAAAGAGAAGCCGCTGAGCAGTGGCTAGATGATTGTAAGAGGACATTT
GGTGCCAAAGAAGACATGTATAGGATAAACACAGATGCACAACTCAATGAAATACTGGTTGAATTGGAGCTCTGCCGAAGATTATACAAA
TTGCATTTTCAATTGCTGCTTCTGTTCCAGGCCTACTGTAAACTTATCAACCAAGTAAATACGATAAAAAATGAAGCAGAGGTCATCAAC
ATGTCAGAGGAACTTGCCCAACTGGAAAGTATCCTCAAAGAAGCTGAGTCCGCTTCCGAAAACGAAGAAATTGACATTTCCAAAGCTGCA
CAAACTACTATAGAAACTGCCATTCATTCTTTAATTGAAACTTTGAAAAATAAAGAATTTATATCAGCTGTAGCACAAGTCAAAGCTTTC
AGATCTCTCTGGCCCAGTGATATCTTTGGCAGTTGTGAAGATGACCCTGTACAGACACTGTTACATATATATTTCCATCATCAGACGCTG
GGCCAGACAGGAAGCTTTGCAGTTATAGGCTCTAACCTGGACATGTCAGAAGCCAACTACAAACTGATGGAACTTAATCTGGAAATAAGA
GAGTCTCTACGCATGGTGCAATCATACCAACTTCTAGCACAGGCCAAACCAATGGGAAATATGGTGAGCACTGGATTCTGAGACACTTCA
GGCCTTTAGGAAAGAAACTAAACTGAAGATGATGAAGAATATTAACCAAGCACCTTTTATGGACCCTTGCATTCACTGATAACTTTCTGG
CAGCATCTACTTTTTAGTGTAACTAATGTCAAACTGTATCATCAAAAACAAAGATCTGAAAGAAAAAAACATCTGATATTTTAACAGCTG
CCAATATCTCCCACAATAACTGCGTGAAGAAGGAATTTTTTAATTACTTAACCTACGTGAAAAGAAAAGGGCTAAAAGTGATGCCTACAA
ATACATTACTTTCTGGGGAAAGAAAAGAATTCCAAGAATGTTTGCAATAATGGCCTCCAATACTGAAACAACCAAAAGCAGGTGAAATGA
GGCTGAAATCAAGGCTGTTTCATTTTAGCTGAAGACCTGCAAAGCTGCTTGGATTTCTAGCAGTTGAAAACCTAACCTGCAATTGATGCT
TAATCATCCATCCACATGAACATGCAGTCAGCTATACGCATCAAGACTCGTTTGCAAAAACCATTGATTTTTCAGTATGTGGGATAAGGG
TTTGGGTTTTTTTGTTTTTTGGTCTGTATAAGGAATTATGTGTGTGTGAGTTGGGATGTATGGATATGTGATAGTCATATTTTCAAGGTA
TGGATGTTTGGTGATAACGTCTCAGAGCATGCCTAAAAGAGCACTGCAAGATTATTTTTGAAGAAATGTTATTTTATTAGATCTAACTCT
TCATAGTATGTAAATGTTAGAACATTTTAATAATATTTTAAAACTGGGCTTTCCCAGTATTTCAAAAAGAAATAATATATCTGTTAACGT
TATTGGAATGCTGCTCAGTTCTCTGATCAGTGCTTATGTTATGATTGTTGATAACTAACCAAAGTAGATGCCTGCAGAGACTTTAAAATG
TAAAATAAAGATGTATGCTGCCTGTCAGCTATTCTCATTAGAAAAGTTTTAACTTATTTTACTCCATATAGAAACTGTAGAGACTAAAAC
CAGTTATTTTCTTGTACATTTGTGCCATGCACTGTTGTTATACAAGAATAGGTGTACAAAGCTAAAGAAAAATTGTGGTCATTGATGATG
GAATATATGACTTGCAGGCTTTGAAGTCTGCAGAATTCAAGAAAAGAGCTGCAAATGCATTTTTGTATCTTTATTCAGGACTCACATGCT
TTACCCTAAAGAAACCTGGGGCTAGGGGAAATGAAAGGAAGCCTGAAGACTGACTACCAAAACATGCAATATACTTATTCACTGTCTAAG
TCTGTAGTATAACATGAACTGGAGTCTCTATCCTTTTCTAAAATCGCATTTTGTAAGAAAAGAAAGAAAAAAAAAAAAAAAGAATGTAGT
CCCACAACTCCTGATTTGAAAGAAACACCTTGTATTTTTTATATACATCTCTTATCCACTGTGACTTTTCTTTTAAACTGGGCTCTGTGA
TTCCAGAGTTTAGAATGTAGAAATGAAATGCTTAGCTTTACCTTTTCTTGGGGGGTGTGGACCCTGCCAGAAATGTAATTACGTATGCTC
AAGTGCATTAATTGAAGGCACTGTGCACACCATTGGACTGCTGACCACAGTTAAACATTTCCAGTAAAATTTCGTAACTGGTCACAGCTC
ATTCATAATCACTGTATTTTTTGACCCTGATAAAGACAATTATTTTGATGGTGTTCTGGTACTGTAATTGGTATCCTTTAAATTATTTAA
AACTTTTGGGTGTGGGGCAGGCAGAGAGGGATGGTGTCCAGAGATACATCACACTTTACATCCTATCTTACTGTCCTCTGTTTTTCTTAC
CCTCCTTACATCCTTTTTGTTAAAAATAAAAAGCATTGTAGCTGTTGGTTTGTGTTGTATTTTAACAAAGAATGAATGATTACAGTGTGC
ATCATTTAGAAACCTTTCAAATGTTACCTTCTTGAATTGCCCTAGAAAAGAACAAAATTAGTTGACTACCCAACCAAACCTTTCAGTTGA


Top

FusionGenePPI for KMT2A_FRYL


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
KMT2APPIE, PPP1R15A, KMT2A, ASH2L, HCFC1, HCFC2, MEN1, RBBP5, WDR5, AVP, INS, OXT, MAP3K5, HDAC1, CTBP1, CBX4, BMI1, CREBBP, SMARCB1, CXXC1, MYB, CTNNB1, SNW1, E2F2, E2F4, E2F6, PSIP1, MLLT4, POLR2A, KAT8, RNF2, TP53, SBF1, MTM1, SET, HIST1H3A, HIST1H4A, KAT6A, ELL, AFF1, AFF4, CDK9, CCNT1, CTR9, LEO1, PAF1, CDC73, WDR61, MLLT3, DOT1L, SKP2, HIST3H3, SVIL, HIST2H3C, SIN3A, MLLT1, RUNX1, CBFB, H3F3A, SIRT7, ASB2, TCEB1, TCEB2, CBX8, TOP1, TAF6, NCL, HECW2, LGR4, CSNK2A2, SENP3, SYMPK, PKN1, PIH1D1, KRAS, TAF1, CHD3, SMARCA2, SMARCC2, SMARCC1, HDAC2, RBBP4, RBBP7, TBP, MBD3, SAP30, RAN, TAF9, TASP1, HIST1H2BG, EWSR1, DYNLT1, KIF11, ING4, ZNF131, ASB7FRYLHOMER3, YWHAG, BAK1, YWHAB, DISC1, SIRT7, GRK5, NOTCH1, MMS19, PELI2, SLMAP, ABCF1, KIAA0930, MARK2, POLH, YWHAH, TACC3, PDZK1, FRY, HOMER1, FLNC, RNF138, FAM78B


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneKMT2Achr11:118355029chr4:48530355ENST00000354520+9351584_160014063932histone H3K4me3
HgeneKMT2Achr11:118355029chr4:48530355ENST00000389506+9361584_160014063970histone H3K4me3
HgeneKMT2Achr11:118355029chr4:48530355ENST00000534358+9361584_160014063973histone H3K4me3
HgeneKMT2Achr11:118355690chr4:48530355ENST00000354520+1351584_160003932histone H3K4me3
HgeneKMT2Achr11:118355690chr4:48530355ENST00000389506+10361584_160014443970histone H3K4me3
HgeneKMT2Achr11:118355690chr4:48530355ENST00000534358+10361584_160014443973histone H3K4me3
HgeneKMT2Achr11:118355029chr4:48530355ENST00000354520+9353764_377114063932WDR5
HgeneKMT2Achr11:118355029chr4:48530355ENST00000389506+9363764_377114063970WDR5
HgeneKMT2Achr11:118355029chr4:48530355ENST00000534358+9363764_377114063973WDR5
HgeneKMT2Achr11:118355690chr4:48530355ENST00000354520+1353764_377103932WDR5
HgeneKMT2Achr11:118355690chr4:48530355ENST00000389506+10363764_377114443970WDR5
HgeneKMT2Achr11:118355690chr4:48530355ENST00000534358+10363764_377114443973WDR5


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for KMT2A_FRYL


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for KMT2A_FRYL


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneKMT2AC0023418leukemia2CTD_human
HgeneKMT2AC0023467Leukemia, Myelocytic, Acute2CTD_human
HgeneKMT2AC0023470Myeloid Leukemia2CTD_human
HgeneKMT2AC1961102Precursor Cell Lymphoblastic Leukemia Lymphoma2CTD_human
HgeneKMT2AC0001418Adenocarcinoma1CTD_human
HgeneKMT2AC0005695Bladder Neoplasm1CTD_human
HgeneKMT2AC0007138Carcinoma, Transitional Cell1CTD_human
HgeneKMT2AC0008625Chromosome Aberrations1CTD_human
HgeneKMT2AC0023448Lymphoid leukemia1CTD_human
HgeneKMT2AC0023465Acute monocytic leukemia1CTD_human
HgeneKMT2AC0023479Acute myelomonocytic leukemia1CTD_human
HgeneKMT2AC0036341Schizophrenia1PSYGENET
HgeneKMT2AC0038356Stomach Neoplasms1CTD_human
HgeneKMT2AC0149925Small cell carcinoma of lung1CTD_human
HgeneKMT2AC2239176Liver carcinoma1CTD_human