FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 19091

FusionGeneSummary for KMT2A_EPS15

check button Fusion gene summary
Fusion gene informationFusion gene name: KMT2A_EPS15
Fusion gene ID: 19091
HgeneTgene
Gene symbol

KMT2A

EPS15

Gene ID

4297

2060

Gene namelysine methyltransferase 2Aepidermal growth factor receptor pathway substrate 15
SynonymsALL-1|CXXC7|HRX|HTRX1|MLL|MLL1|MLL1A|TRX1|WDSTSAF-1P|AF1P|MLLT5
Cytomap

11q23.3

1p32.3

Type of geneprotein-codingprotein-coding
Descriptionhistone-lysine N-methyltransferase 2ACXXC-type zinc finger protein 7lysine (K)-specific methyltransferase 2Alysine N-methyltransferase 2Amixed lineage leukemia 1myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila)trithorax-likeepidermal growth factor receptor substrate 15ALL1 fused gene from chromosome 1protein AF-1p
Modification date2018051920180522
UniProtAcc

Q03164

P42566

Ensembl transtripts involved in fusion geneENST00000534358, ENST00000389506, 
ENST00000354520, ENST00000420751, 
ENST00000371730, ENST00000371733, 
ENST00000396122, ENST00000493793, 
Fusion gene scores* DoF score31 X 72 X 6=133925 X 4 X 4=80
# samples 1296
** MAII scorelog2(129/13392*10)=-3.37592846223973
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(6/80*10)=-0.415037499278844
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: KMT2A [Title/Abstract] AND EPS15 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Transcription factor involved fusion gene, inframe and retained DNA-binding domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneKMT2A

GO:0045944

positive regulation of transcription by RNA polymerase II

20861184

HgeneKMT2A

GO:0051568

histone H3-K4 methylation

19556245

HgeneKMT2A

GO:0065003

protein-containing complex assembly

15199122

HgeneKMT2A

GO:0080182

histone H3-K4 trimethylation

20861184

TgeneEPS15

GO:0048268

clathrin coat assembly

12807910


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
ChiTaRS3.1AY187922KMT2Achr11

118355690

+EPS15chr1

51946988

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000534358ENST00000371730KMT2Achr11

118355690

+EPS15chr1

51946988

-
In-frameENST00000534358ENST00000371733KMT2Achr11

118355690

+EPS15chr1

51946988

-
5CDS-intronENST00000534358ENST00000396122KMT2Achr11

118355690

+EPS15chr1

51946988

-
5CDS-intronENST00000534358ENST00000493793KMT2Achr11

118355690

+EPS15chr1

51946988

-
In-frameENST00000389506ENST00000371730KMT2Achr11

118355690

+EPS15chr1

51946988

-
In-frameENST00000389506ENST00000371733KMT2Achr11

118355690

+EPS15chr1

51946988

-
5CDS-intronENST00000389506ENST00000396122KMT2Achr11

118355690

+EPS15chr1

51946988

-
5CDS-intronENST00000389506ENST00000493793KMT2Achr11

118355690

+EPS15chr1

51946988

-
intron-3CDSENST00000354520ENST00000371730KMT2Achr11

118355690

+EPS15chr1

51946988

-
intron-3CDSENST00000354520ENST00000371733KMT2Achr11

118355690

+EPS15chr1

51946988

-
intron-intronENST00000354520ENST00000396122KMT2Achr11

118355690

+EPS15chr1

51946988

-
intron-intronENST00000354520ENST00000493793KMT2Achr11

118355690

+EPS15chr1

51946988

-
intron-3CDSENST00000420751ENST00000371730KMT2Achr11

118355690

+EPS15chr1

51946988

-
intron-3CDSENST00000420751ENST00000371733KMT2Achr11

118355690

+EPS15chr1

51946988

-
intron-intronENST00000420751ENST00000396122KMT2Achr11

118355690

+EPS15chr1

51946988

-
intron-intronENST00000420751ENST00000493793KMT2Achr11

118355690

+EPS15chr1

51946988

-

Top

FusionProtFeatures for KMT2A_EPS15


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
KMT2A

Q03164

EPS15

P42566

Involved in cell growth regulation. May be involved inthe regulation of mitogenic signals and control of cellproliferation. Involved in the internalization of ligand-induciblereceptors of the receptor tyrosine kinase (RTK) type, inparticular EGFR. Plays a role in the assembly of clathrin-coatedpits (CCPs). Acts as a clathrin adapter required for post-Golgitrafficking. Seems to be involved in CCPs maturation includinginvagination or budding. Involved in endocytosis of integrin beta-1 (ITGB1) and transferrin receptor (TFR); internalization of ITGB1as DAB2-dependent cargo but not TFR seems to require associationwith DAB2. {ECO:0000269|PubMed:16903783,ECO:0000269|PubMed:18362181, ECO:0000269|PubMed:19458185,ECO:0000269|PubMed:22648170}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneKMT2Achr11:118355690chr1:51946988ENST00000389506+1036137_14314443970Compositional biasNote=Poly-Gly
HgeneKMT2Achr11:118355690chr1:51946988ENST00000389506+103617_10214443970Compositional biasNote=Ala/Gly/Ser-rich
HgeneKMT2Achr11:118355690chr1:51946988ENST00000389506+1036561_56414443970Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118355690chr1:51946988ENST00000389506+1036568_57114443970Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118355690chr1:51946988ENST00000534358+1036137_14314443973Compositional biasNote=Poly-Gly
HgeneKMT2Achr11:118355690chr1:51946988ENST00000534358+103617_10214443973Compositional biasNote=Ala/Gly/Ser-rich
HgeneKMT2Achr11:118355690chr1:51946988ENST00000534358+1036561_56414443973Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118355690chr1:51946988ENST00000534358+1036568_57114443973Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118355690chr1:51946988ENST00000389506+1036169_18014443970DNA bindingNote=A.T hook 1
HgeneKMT2Achr11:118355690chr1:51946988ENST00000389506+1036217_22714443970DNA bindingNote=A.T hook 2
HgeneKMT2Achr11:118355690chr1:51946988ENST00000389506+1036301_30914443970DNA bindingNote=A.T hook 3
HgeneKMT2Achr11:118355690chr1:51946988ENST00000534358+1036169_18014443973DNA bindingNote=A.T hook 1
HgeneKMT2Achr11:118355690chr1:51946988ENST00000534358+1036217_22714443973DNA bindingNote=A.T hook 2
HgeneKMT2Achr11:118355690chr1:51946988ENST00000534358+1036301_30914443973DNA bindingNote=A.T hook 3
HgeneKMT2Achr11:118355690chr1:51946988ENST00000389506+10361147_119514443970Zinc fingerCXXC-type
HgeneKMT2Achr11:118355690chr1:51946988ENST00000534358+10361147_119514443973Zinc fingerCXXC-type
TgeneEPS15chr11:118355690chr1:51946988ENST00000371733-025173_18411897Calcium bindingNote=1
TgeneEPS15chr11:118355690chr1:51946988ENST00000371733-025236_24711897Calcium bindingNote=2
TgeneEPS15chr11:118355690chr1:51946988ENST00000371733-025768_85011897Compositional biasNote=Pro-rich
TgeneEPS15chr11:118355690chr1:51946988ENST00000371733-025128_21611897DomainEH 2
TgeneEPS15chr11:118355690chr1:51946988ENST00000371733-02515_10411897DomainEH 1
TgeneEPS15chr11:118355690chr1:51946988ENST00000371733-025160_19511897DomainEF-hand 1
TgeneEPS15chr11:118355690chr1:51946988ENST00000371733-025223_25811897DomainEF-hand 2
TgeneEPS15chr11:118355690chr1:51946988ENST00000371733-025224_31411897DomainEH 3
TgeneEPS15chr11:118355690chr1:51946988ENST00000371733-025851_87011897DomainUIM 1
TgeneEPS15chr11:118355690chr1:51946988ENST00000371733-025877_89611897DomainUIM 2
TgeneEPS15chr11:118355690chr1:51946988ENST00000371733-025768_77411897MotifNote=SH3-binding
TgeneEPS15chr11:118355690chr1:51946988ENST00000371733-025599_82711897RegionNote=15 X 3 AA repeats of D-P-F
TgeneEPS15chr11:118355690chr1:51946988ENST00000371733-025599_60111897RepeatNote=1
TgeneEPS15chr11:118355690chr1:51946988ENST00000371733-025623_62511897RepeatNote=2
TgeneEPS15chr11:118355690chr1:51946988ENST00000371733-025629_63111897RepeatNote=3
TgeneEPS15chr11:118355690chr1:51946988ENST00000371733-025634_63611897RepeatNote=4
TgeneEPS15chr11:118355690chr1:51946988ENST00000371733-025640_64211897RepeatNote=5
TgeneEPS15chr11:118355690chr1:51946988ENST00000371733-025645_64711897RepeatNote=6
TgeneEPS15chr11:118355690chr1:51946988ENST00000371733-025651_65311897RepeatNote=7
TgeneEPS15chr11:118355690chr1:51946988ENST00000371733-025664_66611897RepeatNote=8
TgeneEPS15chr11:118355690chr1:51946988ENST00000371733-025672_67411897RepeatNote=9
TgeneEPS15chr11:118355690chr1:51946988ENST00000371733-025692_69411897RepeatNote=10
TgeneEPS15chr11:118355690chr1:51946988ENST00000371733-025709_71111897RepeatNote=11
TgeneEPS15chr11:118355690chr1:51946988ENST00000371733-025737_73911897RepeatNote=12
TgeneEPS15chr11:118355690chr1:51946988ENST00000371733-025798_80011897RepeatNote=13
TgeneEPS15chr11:118355690chr1:51946988ENST00000371733-025804_80611897RepeatNote=14
TgeneEPS15chr11:118355690chr1:51946988ENST00000371733-025825_82711897RepeatNote=15

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneKMT2Achr11:118355690chr1:51946988ENST00000354520+135137_14303932Compositional biasNote=Poly-Gly
HgeneKMT2Achr11:118355690chr1:51946988ENST00000354520+13517_10203932Compositional biasNote=Ala/Gly/Ser-rich
HgeneKMT2Achr11:118355690chr1:51946988ENST00000354520+135561_56403932Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118355690chr1:51946988ENST00000354520+135568_57103932Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118355690chr1:51946988ENST00000354520+135169_18003932DNA bindingNote=A.T hook 1
HgeneKMT2Achr11:118355690chr1:51946988ENST00000354520+135217_22703932DNA bindingNote=A.T hook 2
HgeneKMT2Achr11:118355690chr1:51946988ENST00000354520+135301_30903932DNA bindingNote=A.T hook 3
HgeneKMT2Achr11:118355690chr1:51946988ENST00000354520+1351703_174803932DomainBromo%3B divergent
HgeneKMT2Achr11:118355690chr1:51946988ENST00000354520+1352018_207403932DomainFYR N-terminal
HgeneKMT2Achr11:118355690chr1:51946988ENST00000354520+1353666_374703932DomainFYR C-terminal
HgeneKMT2Achr11:118355690chr1:51946988ENST00000354520+1353829_394503932DomainSET
HgeneKMT2Achr11:118355690chr1:51946988ENST00000354520+1353953_396903932DomainPost-SET
HgeneKMT2Achr11:118355690chr1:51946988ENST00000389506+10361703_174814443970DomainBromo%3B divergent
HgeneKMT2Achr11:118355690chr1:51946988ENST00000389506+10362018_207414443970DomainFYR N-terminal
HgeneKMT2Achr11:118355690chr1:51946988ENST00000389506+10363666_374714443970DomainFYR C-terminal
HgeneKMT2Achr11:118355690chr1:51946988ENST00000389506+10363829_394514443970DomainSET
HgeneKMT2Achr11:118355690chr1:51946988ENST00000389506+10363953_396914443970DomainPost-SET
HgeneKMT2Achr11:118355690chr1:51946988ENST00000534358+10361703_174814443973DomainBromo%3B divergent
HgeneKMT2Achr11:118355690chr1:51946988ENST00000534358+10362018_207414443973DomainFYR N-terminal
HgeneKMT2Achr11:118355690chr1:51946988ENST00000534358+10363666_374714443973DomainFYR C-terminal
HgeneKMT2Achr11:118355690chr1:51946988ENST00000534358+10363829_394514443973DomainSET
HgeneKMT2Achr11:118355690chr1:51946988ENST00000534358+10363953_396914443973DomainPost-SET
HgeneKMT2Achr11:118355690chr1:51946988ENST00000354520+1353906_390703932RegionS-adenosyl-L-methionine binding
HgeneKMT2Achr11:118355690chr1:51946988ENST00000389506+10363906_390714443970RegionS-adenosyl-L-methionine binding
HgeneKMT2Achr11:118355690chr1:51946988ENST00000534358+10363906_390714443973RegionS-adenosyl-L-methionine binding
HgeneKMT2Achr11:118355690chr1:51946988ENST00000354520+1351147_119503932Zinc fingerCXXC-type
HgeneKMT2Achr11:118355690chr1:51946988ENST00000354520+1351431_148203932Zinc fingerPHD-type 1
HgeneKMT2Achr11:118355690chr1:51946988ENST00000354520+1351479_153303932Zinc fingerPHD-type 2
HgeneKMT2Achr11:118355690chr1:51946988ENST00000354520+1351566_162703932Zinc fingerPHD-type 3
HgeneKMT2Achr11:118355690chr1:51946988ENST00000354520+1351870_191003932Zinc fingerC2HC pre-PHD-type
HgeneKMT2Achr11:118355690chr1:51946988ENST00000354520+1351931_197803932Zinc fingerPHD-type 4
HgeneKMT2Achr11:118355690chr1:51946988ENST00000389506+10361431_148214443970Zinc fingerPHD-type 1
HgeneKMT2Achr11:118355690chr1:51946988ENST00000389506+10361479_153314443970Zinc fingerPHD-type 2
HgeneKMT2Achr11:118355690chr1:51946988ENST00000389506+10361566_162714443970Zinc fingerPHD-type 3
HgeneKMT2Achr11:118355690chr1:51946988ENST00000389506+10361870_191014443970Zinc fingerC2HC pre-PHD-type
HgeneKMT2Achr11:118355690chr1:51946988ENST00000389506+10361931_197814443970Zinc fingerPHD-type 4
HgeneKMT2Achr11:118355690chr1:51946988ENST00000534358+10361431_148214443973Zinc fingerPHD-type 1
HgeneKMT2Achr11:118355690chr1:51946988ENST00000534358+10361479_153314443973Zinc fingerPHD-type 2
HgeneKMT2Achr11:118355690chr1:51946988ENST00000534358+10361566_162714443973Zinc fingerPHD-type 3
HgeneKMT2Achr11:118355690chr1:51946988ENST00000534358+10361870_191014443973Zinc fingerC2HC pre-PHD-type
HgeneKMT2Achr11:118355690chr1:51946988ENST00000534358+10361931_197814443973Zinc fingerPHD-type 4


Top

FusionGeneSequence for KMT2A_EPS15


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_KMT2A_ENST00000534358_chr11_118355690_+_EPS15_ENST00000371730_chr1_51946988_-_2196aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDTDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRTSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKTAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALTPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKEDCEAENVWEMGGLGILTSVPITPRVVCFLCASS
GHVELSSGNPVTEKYTRQVDTGNTGRVLASDAAAFLKKSGLPDLILGKIWDLADTDGKGILNKQEFFVALRLVACAQNGLEVSLSSLNLA
VPPPRFHDTSSPLLISGTSAAELPWAVKPEDKAKTDAIFDSLSPVNGFLSGDKVKPVLLNSKLPVDILGRVWELSDIDHDGMLDRDEFAV
AMFLVYCALEKEPVPMSLPPALVPPSKRKTWVVSPAEKAKTDEIFLKTDKDMDGFVSGLEVREIFLKTGLPSTLLAHIWSLCDTKDCGKL
SKDQFALAFHLISQKLIKGIDPPHVLTPEMIPPSDRASLQKNIIGSSPVADFSAIKELDTLNNEIVDLQREKNNVEQDLKEKEDTIKQRT
SEVQDLQDEVQRENTNLQKLQAQKQQVQELLDELDEQKAQLEEQLKEVRKKCAEEAQLARSSPELLPSGVTDENEVTTAVTEKVCSELDN
NRHSKEEDPFNVDSSSLTGPVADTNLDFFQSDPFVGSDPFKDDPFGKIDPFGGDPFKGSDPFASDCFFRQSTDPFATSSTDPFSAANNSS
ITSVETLKHNDPFAPGGTVVAASDSATDPFASVFGNESFGGGFADFSTLSKVNNEDPFRSATSSSVSNVVITKNVFEETSVKSEDEPPAL
PPKIGTPTRPCPLPPGKRSINKLDSPDPFKLNDPFQPFPGNDSPKEKDPEIFCDPFTSATTTTNKEADPSNFANFSATPSEEDMIEWAKR

>In-frame_KMT2A_ENST00000534358_chr11_118355690_+_EPS15_ENST00000371733_chr1_51946988_-_2330aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDTDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRTSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKTAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALTPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKEDCEAENVWEMGGLGILTSVPITPRVVCFLCASS
GHVELSSGNPVTEKYTRQVDTGNTGRVLASDAAAFLKKSGLPDLILGKIWDLADTDGKGILNKQEFFVALRLVACAQNGLEVSLSSLNLA
VPPPRFHDTSSPLLISGTSAAELPWAVKPEDKAKTDAIFDSLSPVNGFLSGDKVKPVLLNSKLPVDILGRVWELSDIDHDGMLDRDEFAV
AMFLVYCALEKEPVPMSLPPALVPPSKRKTWVVSPAEKAKTDEIFLKTDKDMDGFVSGLEVREIFLKTGLPSTLLAHIWSLCDTKDCGKL
SKDQFALAFHLISQKLIKGIDPPHVLTPEMIPPSDRASLQKNIIGSSPVADFSAIKELDTLNNEIVDLQREKNNVEQDLKEKEDTIKQRT
SEVQDLQDEVQRENTNLQKLQAQKQQVQELLDELDEQKAQLEEQLKEVRKKCAEEAQLISSLKAELTSQESQISTYEEELAKAREELSRL
QQETAELEESVESGKAQLEPLQQHLQDSQQEISSMQMKLMEMKDLENHNSQLNWCSSPHSILVNGATDTCSLSTSSSETANLNEHVEGQS
NLESEPIHQESPARSSPELLPSGVTDENEVTTAVTEKVCSELDNNRHSKEEDPFNVDSSSLTGPVADTNLDFFQSDPFVGSDPFKDDPFG
KIDPFGGDPFKGSDPFASDCFFRQSTDPFATSSTDPFSAANNSSITSVETLKHNDPFAPGGTVVAASDSATDPFASVFGNESFGGGFADF
STLSKVNNEDPFRSATSSSVSNVVITKNVFEETSVKSEDEPPALPPKIGTPTRPCPLPPGKRSINKLDSPDPFKLNDPFQPFPGNDSPKE

>In-frame_KMT2A_ENST00000389506_chr11_118355690_+_EPS15_ENST00000371730_chr1_51946988_-_2196aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDTDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRTSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKTAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALTPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKEDCEAENVWEMGGLGILTSVPITPRVVCFLCASS
GHVELSSGNPVTEKYTRQVDTGNTGRVLASDAAAFLKKSGLPDLILGKIWDLADTDGKGILNKQEFFVALRLVACAQNGLEVSLSSLNLA
VPPPRFHDTSSPLLISGTSAAELPWAVKPEDKAKTDAIFDSLSPVNGFLSGDKVKPVLLNSKLPVDILGRVWELSDIDHDGMLDRDEFAV
AMFLVYCALEKEPVPMSLPPALVPPSKRKTWVVSPAEKAKTDEIFLKTDKDMDGFVSGLEVREIFLKTGLPSTLLAHIWSLCDTKDCGKL
SKDQFALAFHLISQKLIKGIDPPHVLTPEMIPPSDRASLQKNIIGSSPVADFSAIKELDTLNNEIVDLQREKNNVEQDLKEKEDTIKQRT
SEVQDLQDEVQRENTNLQKLQAQKQQVQELLDELDEQKAQLEEQLKEVRKKCAEEAQLARSSPELLPSGVTDENEVTTAVTEKVCSELDN
NRHSKEEDPFNVDSSSLTGPVADTNLDFFQSDPFVGSDPFKDDPFGKIDPFGGDPFKGSDPFASDCFFRQSTDPFATSSTDPFSAANNSS
ITSVETLKHNDPFAPGGTVVAASDSATDPFASVFGNESFGGGFADFSTLSKVNNEDPFRSATSSSVSNVVITKNVFEETSVKSEDEPPAL
PPKIGTPTRPCPLPPGKRSINKLDSPDPFKLNDPFQPFPGNDSPKEKDPEIFCDPFTSATTTTNKEADPSNFANFSATPSEEDMIEWAKR

>In-frame_KMT2A_ENST00000389506_chr11_118355690_+_EPS15_ENST00000371733_chr1_51946988_-_2330aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDTDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRTSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKTAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALTPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKEDCEAENVWEMGGLGILTSVPITPRVVCFLCASS
GHVELSSGNPVTEKYTRQVDTGNTGRVLASDAAAFLKKSGLPDLILGKIWDLADTDGKGILNKQEFFVALRLVACAQNGLEVSLSSLNLA
VPPPRFHDTSSPLLISGTSAAELPWAVKPEDKAKTDAIFDSLSPVNGFLSGDKVKPVLLNSKLPVDILGRVWELSDIDHDGMLDRDEFAV
AMFLVYCALEKEPVPMSLPPALVPPSKRKTWVVSPAEKAKTDEIFLKTDKDMDGFVSGLEVREIFLKTGLPSTLLAHIWSLCDTKDCGKL
SKDQFALAFHLISQKLIKGIDPPHVLTPEMIPPSDRASLQKNIIGSSPVADFSAIKELDTLNNEIVDLQREKNNVEQDLKEKEDTIKQRT
SEVQDLQDEVQRENTNLQKLQAQKQQVQELLDELDEQKAQLEEQLKEVRKKCAEEAQLISSLKAELTSQESQISTYEEELAKAREELSRL
QQETAELEESVESGKAQLEPLQQHLQDSQQEISSMQMKLMEMKDLENHNSQLNWCSSPHSILVNGATDTCSLSTSSSETANLNEHVEGQS
NLESEPIHQESPARSSPELLPSGVTDENEVTTAVTEKVCSELDNNRHSKEEDPFNVDSSSLTGPVADTNLDFFQSDPFVGSDPFKDDPFG
KIDPFGGDPFKGSDPFASDCFFRQSTDPFATSSTDPFSAANNSSITSVETLKHNDPFAPGGTVVAASDSATDPFASVFGNESFGGGFADF
STLSKVNNEDPFRSATSSSVSNVVITKNVFEETSVKSEDEPPALPPKIGTPTRPCPLPPGKRSINKLDSPDPFKLNDPFQPFPGNDSPKE


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_KMT2A_ENST00000534358_chr11_118355690_+_EPS15_ENST00000371730_chr1_51946988_-_6588nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGGAGGATTGTGAA
GCAGAAAATGTGTGGGAGATGGGAGGCTTAGGAATCTTGACTTCTGTTCCTATAACACCCAGGGTGGTTTGCTTTCTCTGTGCCAGTAGT
GGGCATGTAGAGTTATCAAGTGGGAATCCTGTATATGAAAAATACTATAGACAGGTTGATACAGGCAATACTGGAAGGGTGTTGGCTTCT
GATGCTGCTGCTTTCCTGAAAAAATCAGGGCTTCCAGACTTGATACTTGGAAAGATTTGGGATTTAGCCGACACAGATGGCAAAGGTATC
CTGAACAAACAAGAATTCTTTGTTGCTTTGCGTCTTGTGGCATGTGCCCAGAATGGATTGGAAGTTTCACTAAGTAGTTTGAACCTGGCT
GTTCCTCCACCAAGATTTCATGATACCAGTAGTCCTTTGCTAATCAGTGGAACCTCTGCAGCTGAGCTCCCATGGGCTGTAAAACCTGAA
GATAAGGCCAAATATGATGCAATATTTGATAGTTTAAGCCCAGTGAATGGATTTCTGTCTGGTGATAAAGTGAAACCAGTGTTGCTCAAC
TCTAAGTTACCTGTGGATATCCTTGGAAGAGTTTGGGAGTTGAGTGATATTGACCATGATGGAATGCTTGACAGAGATGAGTTTGCAGTT
GCCATGTTTTTGGTATACTGTGCACTGGAGAAAGAACCTGTGCCAATGTCCTTGCCTCCAGCCTTGGTGCCACCATCTAAGAGAAAAACG
TGGGTTGTATCCCCTGCAGAAAAAGCTAAATATGATGAAATCTTCCTGAAAACTGATAAAGATATGGACGGATTTGTGTCTGGATTGGAG
GTCCGTGAAATATTCTTGAAAACAGGTTTACCTTCTACCTTACTAGCCCATATATGGTCATTATGCGACACAAAGGACTGTGGGAAGCTT
TCAAAGGATCAGTTTGCCTTGGCTTTTCACTTAATCAGTCAGAAGTTAATCAAGGGCATTGATCCTCCTCACGTTCTTACTCCTGAAATG
ATTCCACCATCAGACAGGGCCAGTTTACAAAAGAACATCATAGGATCAAGTCCTGTTGCAGATTTCTCTGCTATTAAGGAACTAGATACT
CTTAACAATGAAATAGTTGACCTACAGAGGGAAAAGAATAATGTGGAACAGGACCTTAAGGAGAAGGAAGATACTATTAAACAGAGGACA
AGTGAGGTTCAGGATCTTCAAGATGAAGTTCAAAGGGAGAATACTAATCTGCAAAAACTACAGGCCCAGAAACAGCAGGTACAGGAACTC
CTTGATGAACTGGATGAGCAGAAAGCCCAGCTGGAGGAGCAACTCAAGGAAGTCAGAAAGAAATGTGCTGAGGAGGCCCAACTGGCAAGA
AGTAGTCCTGAACTACTGCCTTCTGGTGTGACTGATGAAAATGAGGTGACTACAGCTGTTACTGAAAAAGTTTGTTCTGAACTCGACAAT
AATAGACATTCAAAAGAGGAAGATCCATTTAATGTAGACTCAAGTTCGCTGACAGGTCCAGTTGCAGATACAAACTTGGATTTTTTCCAG
TCTGATCCTTTTGTTGGCAGTGATCCTTTCAAGGATGATCCTTTTGGAAAAATCGATCCATTTGGTGGTGATCCTTTCAAAGGTTCAGAT
CCATTTGCATCAGACTGTTTCTTCAGGCAATCTACTGATCCTTTTGCCACTTCAAGCACTGACCCTTTCAGTGCAGCCAACAATAGCAGT
ATTACATCGGTAGAAACGTTGAAGCACAATGATCCTTTTGCTCCTGGTGGAACAGTTGTTGCAGCAAGCGATTCAGCCACAGACCCCTTT
GCTTCTGTTTTTGGGAATGAATCATTTGGAGGTGGATTTGCTGACTTCAGCACATTGTCAAAGGTCAACAATGAAGATCCTTTTCGTTCA
GCCACATCGAGCTCTGTCAGCAACGTAGTGATTACAAAAAATGTATTTGAGGAAACATCGGTCAAAAGTGAAGATGAACCCCCAGCACTG
CCACCAAAGATCGGAACTCCAACAAGACCCTGCCCTCTACCACCTGGGAAAAGATCCATCAACAAATTGGATTCTCCTGATCCCTTTAAA
CTGAATGATCCATTTCAGCCTTTCCCAGGCAACGATAGCCCCAAAGAAAAAGATCCTGAAATATTTTGTGATCCATTCACTTCTGCTACT
ACCACTACCAATAAAGAGGCTGATCCAAGCAATTTTGCCAACTTCAGTGCTTATCCCTCTGAAGAAGATATGATCGAATGGGCCAAGAGG
GAAAGTGAGAGAGAGGAAGAGCAGAGGCTTGCCCGACTAAATCAGCAGGAACAAGAAGACTTAGAACTGGCTATTGCACTCAGCAAATCT

>In-frame_KMT2A_ENST00000534358_chr11_118355690_+_EPS15_ENST00000371733_chr1_51946988_-_6990nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGGAGGATTGTGAA
GCAGAAAATGTGTGGGAGATGGGAGGCTTAGGAATCTTGACTTCTGTTCCTATAACACCCAGGGTGGTTTGCTTTCTCTGTGCCAGTAGT
GGGCATGTAGAGTTATCAAGTGGGAATCCTGTATATGAAAAATACTATAGACAGGTTGATACAGGCAATACTGGAAGGGTGTTGGCTTCT
GATGCTGCTGCTTTCCTGAAAAAATCAGGGCTTCCAGACTTGATACTTGGAAAGATTTGGGATTTAGCCGACACAGATGGCAAAGGTATC
CTGAACAAACAAGAATTCTTTGTTGCTTTGCGTCTTGTGGCATGTGCCCAGAATGGATTGGAAGTTTCACTAAGTAGTTTGAACCTGGCT
GTTCCTCCACCAAGATTTCATGATACCAGTAGTCCTTTGCTAATCAGTGGAACCTCTGCAGCTGAGCTCCCATGGGCTGTAAAACCTGAA
GATAAGGCCAAATATGATGCAATATTTGATAGTTTAAGCCCAGTGAATGGATTTCTGTCTGGTGATAAAGTGAAACCAGTGTTGCTCAAC
TCTAAGTTACCTGTGGATATCCTTGGAAGAGTTTGGGAGTTGAGTGATATTGACCATGATGGAATGCTTGACAGAGATGAGTTTGCAGTT
GCCATGTTTTTGGTATACTGTGCACTGGAGAAAGAACCTGTGCCAATGTCCTTGCCTCCAGCCTTGGTGCCACCATCTAAGAGAAAAACG
TGGGTTGTATCCCCTGCAGAAAAAGCTAAATATGATGAAATCTTCCTGAAAACTGATAAAGATATGGACGGATTTGTGTCTGGATTGGAG
GTCCGTGAAATATTCTTGAAAACAGGTTTACCTTCTACCTTACTAGCCCATATATGGTCATTATGCGACACAAAGGACTGTGGGAAGCTT
TCAAAGGATCAGTTTGCCTTGGCTTTTCACTTAATCAGTCAGAAGTTAATCAAGGGCATTGATCCTCCTCACGTTCTTACTCCTGAAATG
ATTCCACCATCAGACAGGGCCAGTTTACAAAAGAACATCATAGGATCAAGTCCTGTTGCAGATTTCTCTGCTATTAAGGAACTAGATACT
CTTAACAATGAAATAGTTGACCTACAGAGGGAAAAGAATAATGTGGAACAGGACCTTAAGGAGAAGGAAGATACTATTAAACAGAGGACA
AGTGAGGTTCAGGATCTTCAAGATGAAGTTCAAAGGGAGAATACTAATCTGCAAAAACTACAGGCCCAGAAACAGCAGGTACAGGAACTC
CTTGATGAACTGGATGAGCAGAAAGCCCAGCTGGAGGAGCAACTCAAGGAAGTCAGAAAGAAATGTGCTGAGGAGGCCCAACTGATCTCT
TCTCTGAAAGCTGAATTAACTAGTCAGGAATCGCAGATCTCCACTTACGAAGAAGAATTGGCAAAAGCTAGAGAAGAGCTGAGCCGTCTA
CAGCAAGAAACAGCAGAATTGGAGGAGAGTGTAGAGTCAGGGAAGGCTCAGTTGGAACCTCTTCAGCAGCACCTACAAGATTCACAACAG
GAAATTAGTTCAATGCAAATGAAACTGATGGAAATGAAAGATTTGGAAAATCATAATAGTCAGTTAAATTGGTGCAGTAGCCCACACAGC
ATTCTTGTAAACGGAGCTACAGATTATTGCAGCCTCAGCACCAGCAGCAGTGAAACAGCCAACCTTAATGAACATGTTGAAGGCCAGAGC
AACCTAGAGTCTGAGCCCATACACCAGGAATCTCCAGCAAGAAGTAGTCCTGAACTACTGCCTTCTGGTGTGACTGATGAAAATGAGGTG
ACTACAGCTGTTACTGAAAAAGTTTGTTCTGAACTCGACAATAATAGACATTCAAAAGAGGAAGATCCATTTAATGTAGACTCAAGTTCG
CTGACAGGTCCAGTTGCAGATACAAACTTGGATTTTTTCCAGTCTGATCCTTTTGTTGGCAGTGATCCTTTCAAGGATGATCCTTTTGGA
AAAATCGATCCATTTGGTGGTGATCCTTTCAAAGGTTCAGATCCATTTGCATCAGACTGTTTCTTCAGGCAATCTACTGATCCTTTTGCC
ACTTCAAGCACTGACCCTTTCAGTGCAGCCAACAATAGCAGTATTACATCGGTAGAAACGTTGAAGCACAATGATCCTTTTGCTCCTGGT
GGAACAGTTGTTGCAGCAAGCGATTCAGCCACAGACCCCTTTGCTTCTGTTTTTGGGAATGAATCATTTGGAGGTGGATTTGCTGACTTC
AGCACATTGTCAAAGGTCAACAATGAAGATCCTTTTCGTTCAGCCACATCGAGCTCTGTCAGCAACGTAGTGATTACAAAAAATGTATTT
GAGGAAACATCGGTCAAAAGTGAAGATGAACCCCCAGCACTGCCACCAAAGATCGGAACTCCAACAAGACCCTGCCCTCTACCACCTGGG
AAAAGATCCATCAACAAATTGGATTCTCCTGATCCCTTTAAACTGAATGATCCATTTCAGCCTTTCCCAGGCAACGATAGCCCCAAAGAA
AAAGATCCTGAAATATTTTGTGATCCATTCACTTCTGCTACTACCACTACCAATAAAGAGGCTGATCCAAGCAATTTTGCCAACTTCAGT
GCTTATCCCTCTGAAGAAGATATGATCGAATGGGCCAAGAGGGAAAGTGAGAGAGAGGAAGAGCAGAGGCTTGCCCGACTAAATCAGCAG

>In-frame_KMT2A_ENST00000389506_chr11_118355690_+_EPS15_ENST00000371730_chr1_51946988_-_6588nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGGAGGATTGTGAA
GCAGAAAATGTGTGGGAGATGGGAGGCTTAGGAATCTTGACTTCTGTTCCTATAACACCCAGGGTGGTTTGCTTTCTCTGTGCCAGTAGT
GGGCATGTAGAGTTATCAAGTGGGAATCCTGTATATGAAAAATACTATAGACAGGTTGATACAGGCAATACTGGAAGGGTGTTGGCTTCT
GATGCTGCTGCTTTCCTGAAAAAATCAGGGCTTCCAGACTTGATACTTGGAAAGATTTGGGATTTAGCCGACACAGATGGCAAAGGTATC
CTGAACAAACAAGAATTCTTTGTTGCTTTGCGTCTTGTGGCATGTGCCCAGAATGGATTGGAAGTTTCACTAAGTAGTTTGAACCTGGCT
GTTCCTCCACCAAGATTTCATGATACCAGTAGTCCTTTGCTAATCAGTGGAACCTCTGCAGCTGAGCTCCCATGGGCTGTAAAACCTGAA
GATAAGGCCAAATATGATGCAATATTTGATAGTTTAAGCCCAGTGAATGGATTTCTGTCTGGTGATAAAGTGAAACCAGTGTTGCTCAAC
TCTAAGTTACCTGTGGATATCCTTGGAAGAGTTTGGGAGTTGAGTGATATTGACCATGATGGAATGCTTGACAGAGATGAGTTTGCAGTT
GCCATGTTTTTGGTATACTGTGCACTGGAGAAAGAACCTGTGCCAATGTCCTTGCCTCCAGCCTTGGTGCCACCATCTAAGAGAAAAACG
TGGGTTGTATCCCCTGCAGAAAAAGCTAAATATGATGAAATCTTCCTGAAAACTGATAAAGATATGGACGGATTTGTGTCTGGATTGGAG
GTCCGTGAAATATTCTTGAAAACAGGTTTACCTTCTACCTTACTAGCCCATATATGGTCATTATGCGACACAAAGGACTGTGGGAAGCTT
TCAAAGGATCAGTTTGCCTTGGCTTTTCACTTAATCAGTCAGAAGTTAATCAAGGGCATTGATCCTCCTCACGTTCTTACTCCTGAAATG
ATTCCACCATCAGACAGGGCCAGTTTACAAAAGAACATCATAGGATCAAGTCCTGTTGCAGATTTCTCTGCTATTAAGGAACTAGATACT
CTTAACAATGAAATAGTTGACCTACAGAGGGAAAAGAATAATGTGGAACAGGACCTTAAGGAGAAGGAAGATACTATTAAACAGAGGACA
AGTGAGGTTCAGGATCTTCAAGATGAAGTTCAAAGGGAGAATACTAATCTGCAAAAACTACAGGCCCAGAAACAGCAGGTACAGGAACTC
CTTGATGAACTGGATGAGCAGAAAGCCCAGCTGGAGGAGCAACTCAAGGAAGTCAGAAAGAAATGTGCTGAGGAGGCCCAACTGGCAAGA
AGTAGTCCTGAACTACTGCCTTCTGGTGTGACTGATGAAAATGAGGTGACTACAGCTGTTACTGAAAAAGTTTGTTCTGAACTCGACAAT
AATAGACATTCAAAAGAGGAAGATCCATTTAATGTAGACTCAAGTTCGCTGACAGGTCCAGTTGCAGATACAAACTTGGATTTTTTCCAG
TCTGATCCTTTTGTTGGCAGTGATCCTTTCAAGGATGATCCTTTTGGAAAAATCGATCCATTTGGTGGTGATCCTTTCAAAGGTTCAGAT
CCATTTGCATCAGACTGTTTCTTCAGGCAATCTACTGATCCTTTTGCCACTTCAAGCACTGACCCTTTCAGTGCAGCCAACAATAGCAGT
ATTACATCGGTAGAAACGTTGAAGCACAATGATCCTTTTGCTCCTGGTGGAACAGTTGTTGCAGCAAGCGATTCAGCCACAGACCCCTTT
GCTTCTGTTTTTGGGAATGAATCATTTGGAGGTGGATTTGCTGACTTCAGCACATTGTCAAAGGTCAACAATGAAGATCCTTTTCGTTCA
GCCACATCGAGCTCTGTCAGCAACGTAGTGATTACAAAAAATGTATTTGAGGAAACATCGGTCAAAAGTGAAGATGAACCCCCAGCACTG
CCACCAAAGATCGGAACTCCAACAAGACCCTGCCCTCTACCACCTGGGAAAAGATCCATCAACAAATTGGATTCTCCTGATCCCTTTAAA
CTGAATGATCCATTTCAGCCTTTCCCAGGCAACGATAGCCCCAAAGAAAAAGATCCTGAAATATTTTGTGATCCATTCACTTCTGCTACT
ACCACTACCAATAAAGAGGCTGATCCAAGCAATTTTGCCAACTTCAGTGCTTATCCCTCTGAAGAAGATATGATCGAATGGGCCAAGAGG
GAAAGTGAGAGAGAGGAAGAGCAGAGGCTTGCCCGACTAAATCAGCAGGAACAAGAAGACTTAGAACTGGCTATTGCACTCAGCAAATCT

>In-frame_KMT2A_ENST00000389506_chr11_118355690_+_EPS15_ENST00000371733_chr1_51946988_-_6990nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGGAGGATTGTGAA
GCAGAAAATGTGTGGGAGATGGGAGGCTTAGGAATCTTGACTTCTGTTCCTATAACACCCAGGGTGGTTTGCTTTCTCTGTGCCAGTAGT
GGGCATGTAGAGTTATCAAGTGGGAATCCTGTATATGAAAAATACTATAGACAGGTTGATACAGGCAATACTGGAAGGGTGTTGGCTTCT
GATGCTGCTGCTTTCCTGAAAAAATCAGGGCTTCCAGACTTGATACTTGGAAAGATTTGGGATTTAGCCGACACAGATGGCAAAGGTATC
CTGAACAAACAAGAATTCTTTGTTGCTTTGCGTCTTGTGGCATGTGCCCAGAATGGATTGGAAGTTTCACTAAGTAGTTTGAACCTGGCT
GTTCCTCCACCAAGATTTCATGATACCAGTAGTCCTTTGCTAATCAGTGGAACCTCTGCAGCTGAGCTCCCATGGGCTGTAAAACCTGAA
GATAAGGCCAAATATGATGCAATATTTGATAGTTTAAGCCCAGTGAATGGATTTCTGTCTGGTGATAAAGTGAAACCAGTGTTGCTCAAC
TCTAAGTTACCTGTGGATATCCTTGGAAGAGTTTGGGAGTTGAGTGATATTGACCATGATGGAATGCTTGACAGAGATGAGTTTGCAGTT
GCCATGTTTTTGGTATACTGTGCACTGGAGAAAGAACCTGTGCCAATGTCCTTGCCTCCAGCCTTGGTGCCACCATCTAAGAGAAAAACG
TGGGTTGTATCCCCTGCAGAAAAAGCTAAATATGATGAAATCTTCCTGAAAACTGATAAAGATATGGACGGATTTGTGTCTGGATTGGAG
GTCCGTGAAATATTCTTGAAAACAGGTTTACCTTCTACCTTACTAGCCCATATATGGTCATTATGCGACACAAAGGACTGTGGGAAGCTT
TCAAAGGATCAGTTTGCCTTGGCTTTTCACTTAATCAGTCAGAAGTTAATCAAGGGCATTGATCCTCCTCACGTTCTTACTCCTGAAATG
ATTCCACCATCAGACAGGGCCAGTTTACAAAAGAACATCATAGGATCAAGTCCTGTTGCAGATTTCTCTGCTATTAAGGAACTAGATACT
CTTAACAATGAAATAGTTGACCTACAGAGGGAAAAGAATAATGTGGAACAGGACCTTAAGGAGAAGGAAGATACTATTAAACAGAGGACA
AGTGAGGTTCAGGATCTTCAAGATGAAGTTCAAAGGGAGAATACTAATCTGCAAAAACTACAGGCCCAGAAACAGCAGGTACAGGAACTC
CTTGATGAACTGGATGAGCAGAAAGCCCAGCTGGAGGAGCAACTCAAGGAAGTCAGAAAGAAATGTGCTGAGGAGGCCCAACTGATCTCT
TCTCTGAAAGCTGAATTAACTAGTCAGGAATCGCAGATCTCCACTTACGAAGAAGAATTGGCAAAAGCTAGAGAAGAGCTGAGCCGTCTA
CAGCAAGAAACAGCAGAATTGGAGGAGAGTGTAGAGTCAGGGAAGGCTCAGTTGGAACCTCTTCAGCAGCACCTACAAGATTCACAACAG
GAAATTAGTTCAATGCAAATGAAACTGATGGAAATGAAAGATTTGGAAAATCATAATAGTCAGTTAAATTGGTGCAGTAGCCCACACAGC
ATTCTTGTAAACGGAGCTACAGATTATTGCAGCCTCAGCACCAGCAGCAGTGAAACAGCCAACCTTAATGAACATGTTGAAGGCCAGAGC
AACCTAGAGTCTGAGCCCATACACCAGGAATCTCCAGCAAGAAGTAGTCCTGAACTACTGCCTTCTGGTGTGACTGATGAAAATGAGGTG
ACTACAGCTGTTACTGAAAAAGTTTGTTCTGAACTCGACAATAATAGACATTCAAAAGAGGAAGATCCATTTAATGTAGACTCAAGTTCG
CTGACAGGTCCAGTTGCAGATACAAACTTGGATTTTTTCCAGTCTGATCCTTTTGTTGGCAGTGATCCTTTCAAGGATGATCCTTTTGGA
AAAATCGATCCATTTGGTGGTGATCCTTTCAAAGGTTCAGATCCATTTGCATCAGACTGTTTCTTCAGGCAATCTACTGATCCTTTTGCC
ACTTCAAGCACTGACCCTTTCAGTGCAGCCAACAATAGCAGTATTACATCGGTAGAAACGTTGAAGCACAATGATCCTTTTGCTCCTGGT
GGAACAGTTGTTGCAGCAAGCGATTCAGCCACAGACCCCTTTGCTTCTGTTTTTGGGAATGAATCATTTGGAGGTGGATTTGCTGACTTC
AGCACATTGTCAAAGGTCAACAATGAAGATCCTTTTCGTTCAGCCACATCGAGCTCTGTCAGCAACGTAGTGATTACAAAAAATGTATTT
GAGGAAACATCGGTCAAAAGTGAAGATGAACCCCCAGCACTGCCACCAAAGATCGGAACTCCAACAAGACCCTGCCCTCTACCACCTGGG
AAAAGATCCATCAACAAATTGGATTCTCCTGATCCCTTTAAACTGAATGATCCATTTCAGCCTTTCCCAGGCAACGATAGCCCCAAAGAA
AAAGATCCTGAAATATTTTGTGATCCATTCACTTCTGCTACTACCACTACCAATAAAGAGGCTGATCCAAGCAATTTTGCCAACTTCAGT
GCTTATCCCTCTGAAGAAGATATGATCGAATGGGCCAAGAGGGAAAGTGAGAGAGAGGAAGAGCAGAGGCTTGCCCGACTAAATCAGCAG


* Fusion transcript sequences (Full-length transcript).
>In-frame_KMT2A_ENST00000534358_chr11_118355690_+_EPS15_ENST00000371730_chr1_51946988_-_9048nt
CTGCTTCACTTCACGGGGCGAACATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGG
GGCGCCGGGGCCTAGGGGGCGCCCCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGG
CGCCCCCCTCCCCCCCGGCTGTGGCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAG
CAGCCTCCTCGTCGTCCGCCTCGTCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCG
ACGCGGCGCTGCAGGTCTCGGCCGCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCG
GAGAGGATGAGCAATTCTTAGGTTTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTC
GAAAACCTCGTGGGAGACCTAGAAGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAG
AGACCAAATCTGGAGATAAGATCAAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAA
TCAAAATAACACATGGAAAGGACATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTA
CGTTTCAGCAAGCCACAAAGATTAAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAG
GAAGGAAGGGGGTACAAATTGTACGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTG
AACTGGAAAAGCCCCAGAAAGTCCGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTC
GAAGGATTAAGCCAGTTAGGATTATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGG
CTCAAAAGAAAATTGAAAAAGAAGCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTG
TTGTCAGTGCTATCTCCTCGCGGATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGAT
TAGAGTCTACACCGAATAGTAGATTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGT
CTTCAGACTCCTCTCGATCTAGTAGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGC
GGAGCGATACCCCTGAAGTTCATCCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAG
TGTCGGAGAGAAGTTTTGGATCTAGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTC
CACCTCTGCTGACTCCACCGCCACCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAG
CATCACCATTTTTGCCTGCTTCCACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAA
AGCATTCTAGGTCAGAGCCACAATACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGAC
CCCCTCCACTAACTCCCGAGGACGTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCC
ATTCTGGAACAAGGTTTGATATGCACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTG
AGTCTGTAACCTTGCCTAGTAATCGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTC
CTATTCGATCTGAACCAAGATCTCCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCC
CGTCTTCTGTCTCTTCCTCGTTAAGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCC
TGACTCAGTCTGGGGAATCTGCAGAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTA
CTCCTCTCTTCCCTTGGTTTACCCCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAG
ATGCTGACAAGAGCGTGGAGAAGGACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAA
GGAAAAAGGGATCAGAAATTCAGAGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCA
CTTCATCTTCTGCCAAAAAAGCAACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATA
CAACAGCTGTCAAAACCAAAATACTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCC
TGGAGAAGGAGAAAACCCTCTGCCTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGG
CAGACAAGCTTCCAATGACTGACAAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTC
TTAAACAAACCGACCAGCCCAAAGCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCA
GAAGAGCAGCTGTTGCCCTTGGCCGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAA
AGATTTTGTCTTCCATGGGGAATGATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTA
AACCTGTCACTAGAAACAAGGCACCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGG
TGCCTGAGGACTGTGGTGTTTGTACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAA
AATGTCAGAATCTACAATGGATGCCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCA
GTGAAAAGAAAGACAGCAAAGAGAGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTG
CCCCAAAGAAAAGCAGTAGTGAGCCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAAT
CCAAACAGGCCACCACTCCAGCTTCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAG
GACCGCCAAGAAAAGAAGTTCCCAAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCA
AACAGAAAAAAGTGGCTCCCCGCCCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGA
ATGCAGGCACTTTGAACATCCTCAGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAG
TGGACTTTAAGGAGGATTGTGAAGCAGAAAATGTGTGGGAGATGGGAGGCTTAGGAATCTTGACTTCTGTTCCTATAACACCCAGGGTGG
TTTGCTTTCTCTGTGCCAGTAGTGGGCATGTAGAGTTATCAAGTGGGAATCCTGTATATGAAAAATACTATAGACAGGTTGATACAGGCA
ATACTGGAAGGGTGTTGGCTTCTGATGCTGCTGCTTTCCTGAAAAAATCAGGGCTTCCAGACTTGATACTTGGAAAGATTTGGGATTTAG
CCGACACAGATGGCAAAGGTATCCTGAACAAACAAGAATTCTTTGTTGCTTTGCGTCTTGTGGCATGTGCCCAGAATGGATTGGAAGTTT
CACTAAGTAGTTTGAACCTGGCTGTTCCTCCACCAAGATTTCATGATACCAGTAGTCCTTTGCTAATCAGTGGAACCTCTGCAGCTGAGC
TCCCATGGGCTGTAAAACCTGAAGATAAGGCCAAATATGATGCAATATTTGATAGTTTAAGCCCAGTGAATGGATTTCTGTCTGGTGATA
AAGTGAAACCAGTGTTGCTCAACTCTAAGTTACCTGTGGATATCCTTGGAAGAGTTTGGGAGTTGAGTGATATTGACCATGATGGAATGC
TTGACAGAGATGAGTTTGCAGTTGCCATGTTTTTGGTATACTGTGCACTGGAGAAAGAACCTGTGCCAATGTCCTTGCCTCCAGCCTTGG
TGCCACCATCTAAGAGAAAAACGTGGGTTGTATCCCCTGCAGAAAAAGCTAAATATGATGAAATCTTCCTGAAAACTGATAAAGATATGG
ACGGATTTGTGTCTGGATTGGAGGTCCGTGAAATATTCTTGAAAACAGGTTTACCTTCTACCTTACTAGCCCATATATGGTCATTATGCG
ACACAAAGGACTGTGGGAAGCTTTCAAAGGATCAGTTTGCCTTGGCTTTTCACTTAATCAGTCAGAAGTTAATCAAGGGCATTGATCCTC
CTCACGTTCTTACTCCTGAAATGATTCCACCATCAGACAGGGCCAGTTTACAAAAGAACATCATAGGATCAAGTCCTGTTGCAGATTTCT
CTGCTATTAAGGAACTAGATACTCTTAACAATGAAATAGTTGACCTACAGAGGGAAAAGAATAATGTGGAACAGGACCTTAAGGAGAAGG
AAGATACTATTAAACAGAGGACAAGTGAGGTTCAGGATCTTCAAGATGAAGTTCAAAGGGAGAATACTAATCTGCAAAAACTACAGGCCC
AGAAACAGCAGGTACAGGAACTCCTTGATGAACTGGATGAGCAGAAAGCCCAGCTGGAGGAGCAACTCAAGGAAGTCAGAAAGAAATGTG
CTGAGGAGGCCCAACTGGCAAGAAGTAGTCCTGAACTACTGCCTTCTGGTGTGACTGATGAAAATGAGGTGACTACAGCTGTTACTGAAA
AAGTTTGTTCTGAACTCGACAATAATAGACATTCAAAAGAGGAAGATCCATTTAATGTAGACTCAAGTTCGCTGACAGGTCCAGTTGCAG
ATACAAACTTGGATTTTTTCCAGTCTGATCCTTTTGTTGGCAGTGATCCTTTCAAGGATGATCCTTTTGGAAAAATCGATCCATTTGGTG
GTGATCCTTTCAAAGGTTCAGATCCATTTGCATCAGACTGTTTCTTCAGGCAATCTACTGATCCTTTTGCCACTTCAAGCACTGACCCTT
TCAGTGCAGCCAACAATAGCAGTATTACATCGGTAGAAACGTTGAAGCACAATGATCCTTTTGCTCCTGGTGGAACAGTTGTTGCAGCAA
GCGATTCAGCCACAGACCCCTTTGCTTCTGTTTTTGGGAATGAATCATTTGGAGGTGGATTTGCTGACTTCAGCACATTGTCAAAGGTCA
ACAATGAAGATCCTTTTCGTTCAGCCACATCGAGCTCTGTCAGCAACGTAGTGATTACAAAAAATGTATTTGAGGAAACATCGGTCAAAA
GTGAAGATGAACCCCCAGCACTGCCACCAAAGATCGGAACTCCAACAAGACCCTGCCCTCTACCACCTGGGAAAAGATCCATCAACAAAT
TGGATTCTCCTGATCCCTTTAAACTGAATGATCCATTTCAGCCTTTCCCAGGCAACGATAGCCCCAAAGAAAAAGATCCTGAAATATTTT
GTGATCCATTCACTTCTGCTACTACCACTACCAATAAAGAGGCTGATCCAAGCAATTTTGCCAACTTCAGTGCTTATCCCTCTGAAGAAG
ATATGATCGAATGGGCCAAGAGGGAAAGTGAGAGAGAGGAAGAGCAGAGGCTTGCCCGACTAAATCAGCAGGAACAAGAAGACTTAGAAC
TGGCTATTGCACTCAGCAAATCTGAGATATCAGAAGCATGAAGAATTCTCTTGTTCTTTGGCAACAATATAGTATTCTTCTTCCTGAATA
CTGAAACTATTTACAATGTGTATCAAAACTACCTGTGAGCATGGGAATACAAAAGGTTTGAGATTCCTGTAAATGTGACAAAATTTTAGG
ATTTTTTTTTTTTCTTCATTACAGATTCGTCTTTTTTTTTTTTTCTTATAAAAGCCGTAACCCAGTCAGACAAATTCACCTTCACTTAGG
CCCCTGTTCTGGTATACATTTACTGTGAGCTTTTGCCTGCCTGTGCTATTTTACTTGTAAAGCTAGAGCACCCAAGCTTCTGCCTTCTGG
AATATAGAGAAATAGTTTCACCCTGCACTACCCTGTTCTGTAGTTATTCTGATGATAGCCAGTGAGGTTCTTAAAGTTTGCAGTATTCTC
CCCTGATTGGAATGGTTGAGTGAGGGTAAGGGAAAGAATATCTTATTTCTTTTATGATTGGTGCAAATTGGCTAAAGTGCATTTTTAAAT
TTCCTCTACTTAATTTGTTTTTCAGAGATAAGGAAAAATATTTTGCACAGATTTACTCCACTATGGAAAAGGGATGCTGTAGGTTGAACC
ATTATAGCCTCAGATTCGATCTTTTCCTAACTAAAAATATTAAAGCCTCATGTGTGAAATAAATTTTTAAAAAGATTTATCTGGATTTAG
AGAATTTTAGATCAACAGATACCTCTCAGTGTGTTTGCTAATTAATAAAAATCAGTTTCTTACAAATAAAGTTTGTAAGAAAATGTTCAT
TTTAAGTGATAGATAGTGGAGAAAATTTATCACCTAAAATATACCCATCAGTATAAGGCAAGCAAAAGTCTTAACATGGCAGCCATTCTG
CCTTTGCCGTGGCCCTGTCCTGTTTAGTTCTTAGTGGGTTAATTTTTGTACTTTTGCAGAAGAAACTTCAGCAAGCTAGAACTGGAAGGT
ACTTTAATTTTTCATATATATTTGTTTTTTTTTTTTTAATGAAGGCTCATTTACTTGAAATGTAAAAACTTTCACTGAATACAAATAGAA
AAAGTGATGTGTTTTATATCATATTGCTTTTTGTCCATCTTTGTGGTTTAGTTTATTTACTCACTTCATGTTTTTCACCTATAAAATTGT
CAAGCTAGCAAAAAAACTCTTGTTTTTTTAATTGGGAGAGAAGAGACCTGCCAGATTATCAGACCTCTTCATGTTAAAAGACCATCTCCT
GTAAAACTGACCTAGTGGACAAGCTGAATTTGAAATAGACTGTGAAGTAAGCTGTAACTTGTCATTTTAATTTTGTTTAACACGGTTACT
GACTTAGATGATGTATTAAATACCAAGATAAAGAAAAATGCACCTAAAATCTAATTAGAATTCTCTGGGTCAACAAGTCAAGGTGGTATT
GATCTGTGTTAATCTGAGTAACTTATTGCCTAGCCTATAAATAAATTCCAAAATATCCAATTCATTTCTTCTTGAAATGGTGCTTGTTTT
GTTTTCTTTCCATTACACAATTAGACTCCTACAGTTTAAAACAAACTTTAAACCACTATCTTGCACTGCTAACTTTTTTCTACCTTTGTA
AATAGAAACATTTCTGCATAAAAGTCATACATATGAAGCAAGGGCTGAATCATAATCACAAGGCTTAATTTTGATAAACGAATCCAGTGA
CCTAAGGATTTTCTGCAAAATTTGACTGGGAGTTGTGATAGGTGGTATTTTTGTTTATTTTCTTCCTCTTACTCCTTAGGATAAAGGTAA
GTTGACTTGAACAACTTTCTTTTGCACTGGGAAAATAAGCAAATGTTTAAATGCTTCAAAAAAATTTTCAATTAAACTCAAATATTAAAT
ATCTATAACTTATAAACACCAACTTTCAATGTAATAAATGTATCCTAATCTTATGTATGTTTAACTGGATTACATAGATTTTTATCTTTT
GTTAAAATGTGTATACCCCGTGGACCAACATAATATTAAAGTATGTATATATTATATAAATATATATGTATATGTGCTCGCTTGTGTAGG
ATGAATGTCTTAGAGTCGTTTGTGGTATTTTATGTTGTTGACTCTGGCTCCAGGGCCTGTGCTTGAAAAGGACAGATAAGTATTGCCCAG
AGCTAAGTGGCACTACTTACAAAGTTTTAAATGTCTTCTACATACTGATTCATGTTTATTTGAGCTCTCTTTATAGAATTTTCTCTTAAA
GTTTCAAACCTCTAAGTTGTAGCCTGTAATTATGAGAACAGTAAACTTTAAGTAATAATAAAGAATCCCATCCATATATCCAATTTGCAA
TTGAGTTTTGCATGGTTCTCTGATTATGTCCATGCTGTGTCCAAGGAGGAGTAGGTACATACAATCAGCACAGATTAATATATGTAAAGG

>In-frame_KMT2A_ENST00000534358_chr11_118355690_+_EPS15_ENST00000371733_chr1_51946988_-_9450nt
CTGCTTCACTTCACGGGGCGAACATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGG
GGCGCCGGGGCCTAGGGGGCGCCCCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGG
CGCCCCCCTCCCCCCCGGCTGTGGCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAG
CAGCCTCCTCGTCGTCCGCCTCGTCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCG
ACGCGGCGCTGCAGGTCTCGGCCGCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCG
GAGAGGATGAGCAATTCTTAGGTTTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTC
GAAAACCTCGTGGGAGACCTAGAAGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAG
AGACCAAATCTGGAGATAAGATCAAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAA
TCAAAATAACACATGGAAAGGACATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTA
CGTTTCAGCAAGCCACAAAGATTAAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAG
GAAGGAAGGGGGTACAAATTGTACGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTG
AACTGGAAAAGCCCCAGAAAGTCCGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTC
GAAGGATTAAGCCAGTTAGGATTATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGG
CTCAAAAGAAAATTGAAAAAGAAGCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTG
TTGTCAGTGCTATCTCCTCGCGGATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGAT
TAGAGTCTACACCGAATAGTAGATTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGT
CTTCAGACTCCTCTCGATCTAGTAGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGC
GGAGCGATACCCCTGAAGTTCATCCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAG
TGTCGGAGAGAAGTTTTGGATCTAGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTC
CACCTCTGCTGACTCCACCGCCACCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAG
CATCACCATTTTTGCCTGCTTCCACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAA
AGCATTCTAGGTCAGAGCCACAATACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGAC
CCCCTCCACTAACTCCCGAGGACGTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCC
ATTCTGGAACAAGGTTTGATATGCACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTG
AGTCTGTAACCTTGCCTAGTAATCGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTC
CTATTCGATCTGAACCAAGATCTCCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCC
CGTCTTCTGTCTCTTCCTCGTTAAGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCC
TGACTCAGTCTGGGGAATCTGCAGAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTA
CTCCTCTCTTCCCTTGGTTTACCCCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAG
ATGCTGACAAGAGCGTGGAGAAGGACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAA
GGAAAAAGGGATCAGAAATTCAGAGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCA
CTTCATCTTCTGCCAAAAAAGCAACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATA
CAACAGCTGTCAAAACCAAAATACTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCC
TGGAGAAGGAGAAAACCCTCTGCCTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGG
CAGACAAGCTTCCAATGACTGACAAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTC
TTAAACAAACCGACCAGCCCAAAGCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCA
GAAGAGCAGCTGTTGCCCTTGGCCGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAA
AGATTTTGTCTTCCATGGGGAATGATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTA
AACCTGTCACTAGAAACAAGGCACCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGG
TGCCTGAGGACTGTGGTGTTTGTACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAA
AATGTCAGAATCTACAATGGATGCCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCA
GTGAAAAGAAAGACAGCAAAGAGAGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTG
CCCCAAAGAAAAGCAGTAGTGAGCCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAAT
CCAAACAGGCCACCACTCCAGCTTCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAG
GACCGCCAAGAAAAGAAGTTCCCAAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCA
AACAGAAAAAAGTGGCTCCCCGCCCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGA
ATGCAGGCACTTTGAACATCCTCAGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAG
TGGACTTTAAGGAGGATTGTGAAGCAGAAAATGTGTGGGAGATGGGAGGCTTAGGAATCTTGACTTCTGTTCCTATAACACCCAGGGTGG
TTTGCTTTCTCTGTGCCAGTAGTGGGCATGTAGAGTTATCAAGTGGGAATCCTGTATATGAAAAATACTATAGACAGGTTGATACAGGCA
ATACTGGAAGGGTGTTGGCTTCTGATGCTGCTGCTTTCCTGAAAAAATCAGGGCTTCCAGACTTGATACTTGGAAAGATTTGGGATTTAG
CCGACACAGATGGCAAAGGTATCCTGAACAAACAAGAATTCTTTGTTGCTTTGCGTCTTGTGGCATGTGCCCAGAATGGATTGGAAGTTT
CACTAAGTAGTTTGAACCTGGCTGTTCCTCCACCAAGATTTCATGATACCAGTAGTCCTTTGCTAATCAGTGGAACCTCTGCAGCTGAGC
TCCCATGGGCTGTAAAACCTGAAGATAAGGCCAAATATGATGCAATATTTGATAGTTTAAGCCCAGTGAATGGATTTCTGTCTGGTGATA
AAGTGAAACCAGTGTTGCTCAACTCTAAGTTACCTGTGGATATCCTTGGAAGAGTTTGGGAGTTGAGTGATATTGACCATGATGGAATGC
TTGACAGAGATGAGTTTGCAGTTGCCATGTTTTTGGTATACTGTGCACTGGAGAAAGAACCTGTGCCAATGTCCTTGCCTCCAGCCTTGG
TGCCACCATCTAAGAGAAAAACGTGGGTTGTATCCCCTGCAGAAAAAGCTAAATATGATGAAATCTTCCTGAAAACTGATAAAGATATGG
ACGGATTTGTGTCTGGATTGGAGGTCCGTGAAATATTCTTGAAAACAGGTTTACCTTCTACCTTACTAGCCCATATATGGTCATTATGCG
ACACAAAGGACTGTGGGAAGCTTTCAAAGGATCAGTTTGCCTTGGCTTTTCACTTAATCAGTCAGAAGTTAATCAAGGGCATTGATCCTC
CTCACGTTCTTACTCCTGAAATGATTCCACCATCAGACAGGGCCAGTTTACAAAAGAACATCATAGGATCAAGTCCTGTTGCAGATTTCT
CTGCTATTAAGGAACTAGATACTCTTAACAATGAAATAGTTGACCTACAGAGGGAAAAGAATAATGTGGAACAGGACCTTAAGGAGAAGG
AAGATACTATTAAACAGAGGACAAGTGAGGTTCAGGATCTTCAAGATGAAGTTCAAAGGGAGAATACTAATCTGCAAAAACTACAGGCCC
AGAAACAGCAGGTACAGGAACTCCTTGATGAACTGGATGAGCAGAAAGCCCAGCTGGAGGAGCAACTCAAGGAAGTCAGAAAGAAATGTG
CTGAGGAGGCCCAACTGATCTCTTCTCTGAAAGCTGAATTAACTAGTCAGGAATCGCAGATCTCCACTTACGAAGAAGAATTGGCAAAAG
CTAGAGAAGAGCTGAGCCGTCTACAGCAAGAAACAGCAGAATTGGAGGAGAGTGTAGAGTCAGGGAAGGCTCAGTTGGAACCTCTTCAGC
AGCACCTACAAGATTCACAACAGGAAATTAGTTCAATGCAAATGAAACTGATGGAAATGAAAGATTTGGAAAATCATAATAGTCAGTTAA
ATTGGTGCAGTAGCCCACACAGCATTCTTGTAAACGGAGCTACAGATTATTGCAGCCTCAGCACCAGCAGCAGTGAAACAGCCAACCTTA
ATGAACATGTTGAAGGCCAGAGCAACCTAGAGTCTGAGCCCATACACCAGGAATCTCCAGCAAGAAGTAGTCCTGAACTACTGCCTTCTG
GTGTGACTGATGAAAATGAGGTGACTACAGCTGTTACTGAAAAAGTTTGTTCTGAACTCGACAATAATAGACATTCAAAAGAGGAAGATC
CATTTAATGTAGACTCAAGTTCGCTGACAGGTCCAGTTGCAGATACAAACTTGGATTTTTTCCAGTCTGATCCTTTTGTTGGCAGTGATC
CTTTCAAGGATGATCCTTTTGGAAAAATCGATCCATTTGGTGGTGATCCTTTCAAAGGTTCAGATCCATTTGCATCAGACTGTTTCTTCA
GGCAATCTACTGATCCTTTTGCCACTTCAAGCACTGACCCTTTCAGTGCAGCCAACAATAGCAGTATTACATCGGTAGAAACGTTGAAGC
ACAATGATCCTTTTGCTCCTGGTGGAACAGTTGTTGCAGCAAGCGATTCAGCCACAGACCCCTTTGCTTCTGTTTTTGGGAATGAATCAT
TTGGAGGTGGATTTGCTGACTTCAGCACATTGTCAAAGGTCAACAATGAAGATCCTTTTCGTTCAGCCACATCGAGCTCTGTCAGCAACG
TAGTGATTACAAAAAATGTATTTGAGGAAACATCGGTCAAAAGTGAAGATGAACCCCCAGCACTGCCACCAAAGATCGGAACTCCAACAA
GACCCTGCCCTCTACCACCTGGGAAAAGATCCATCAACAAATTGGATTCTCCTGATCCCTTTAAACTGAATGATCCATTTCAGCCTTTCC
CAGGCAACGATAGCCCCAAAGAAAAAGATCCTGAAATATTTTGTGATCCATTCACTTCTGCTACTACCACTACCAATAAAGAGGCTGATC
CAAGCAATTTTGCCAACTTCAGTGCTTATCCCTCTGAAGAAGATATGATCGAATGGGCCAAGAGGGAAAGTGAGAGAGAGGAAGAGCAGA
GGCTTGCCCGACTAAATCAGCAGGAACAAGAAGACTTAGAACTGGCTATTGCACTCAGCAAATCTGAGATATCAGAAGCATGAAGAATTC
TCTTGTTCTTTGGCAACAATATAGTATTCTTCTTCCTGAATACTGAAACTATTTACAATGTGTATCAAAACTACCTGTGAGCATGGGAAT
ACAAAAGGTTTGAGATTCCTGTAAATGTGACAAAATTTTAGGATTTTTTTTTTTTCTTCATTACAGATTCGTCTTTTTTTTTTTTTCTTA
TAAAAGCCGTAACCCAGTCAGACAAATTCACCTTCACTTAGGCCCCTGTTCTGGTATACATTTACTGTGAGCTTTTGCCTGCCTGTGCTA
TTTTACTTGTAAAGCTAGAGCACCCAAGCTTCTGCCTTCTGGAATATAGAGAAATAGTTTCACCCTGCACTACCCTGTTCTGTAGTTATT
CTGATGATAGCCAGTGAGGTTCTTAAAGTTTGCAGTATTCTCCCCTGATTGGAATGGTTGAGTGAGGGTAAGGGAAAGAATATCTTATTT
CTTTTATGATTGGTGCAAATTGGCTAAAGTGCATTTTTAAATTTCCTCTACTTAATTTGTTTTTCAGAGATAAGGAAAAATATTTTGCAC
AGATTTACTCCACTATGGAAAAGGGATGCTGTAGGTTGAACCATTATAGCCTCAGATTCGATCTTTTCCTAACTAAAAATATTAAAGCCT
CATGTGTGAAATAAATTTTTAAAAAGATTTATCTGGATTTAGAGAATTTTAGATCAACAGATACCTCTCAGTGTGTTTGCTAATTAATAA
AAATCAGTTTCTTACAAATAAAGTTTGTAAGAAAATGTTCATTTTAAGTGATAGATAGTGGAGAAAATTTATCACCTAAAATATACCCAT
CAGTATAAGGCAAGCAAAAGTCTTAACATGGCAGCCATTCTGCCTTTGCCGTGGCCCTGTCCTGTTTAGTTCTTAGTGGGTTAATTTTTG
TACTTTTGCAGAAGAAACTTCAGCAAGCTAGAACTGGAAGGTACTTTAATTTTTCATATATATTTGTTTTTTTTTTTTTAATGAAGGCTC
ATTTACTTGAAATGTAAAAACTTTCACTGAATACAAATAGAAAAAGTGATGTGTTTTATATCATATTGCTTTTTGTCCATCTTTGTGGTT
TAGTTTATTTACTCACTTCATGTTTTTCACCTATAAAATTGTCAAGCTAGCAAAAAAACTCTTGTTTTTTTAATTGGGAGAGAAGAGACC
TGCCAGATTATCAGACCTCTTCATGTTAAAAGACCATCTCCTGTAAAACTGACCTAGTGGACAAGCTGAATTTGAAATAGACTGTGAAGT
AAGCTGTAACTTGTCATTTTAATTTTGTTTAACACGGTTACTGACTTAGATGATGTATTAAATACCAAGATAAAGAAAAATGCACCTAAA
ATCTAATTAGAATTCTCTGGGTCAACAAGTCAAGGTGGTATTGATCTGTGTTAATCTGAGTAACTTATTGCCTAGCCTATAAATAAATTC
CAAAATATCCAATTCATTTCTTCTTGAAATGGTGCTTGTTTTGTTTTCTTTCCATTACACAATTAGACTCCTACAGTTTAAAACAAACTT
TAAACCACTATCTTGCACTGCTAACTTTTTTCTACCTTTGTAAATAGAAACATTTCTGCATAAAAGTCATACATATGAAGCAAGGGCTGA
ATCATAATCACAAGGCTTAATTTTGATAAACGAATCCAGTGACCTAAGGATTTTCTGCAAAATTTGACTGGGAGTTGTGATAGGTGGTAT
TTTTGTTTATTTTCTTCCTCTTACTCCTTAGGATAAAGGTAAGTTGACTTGAACAACTTTCTTTTGCACTGGGAAAATAAGCAAATGTTT
AAATGCTTCAAAAAAATTTTCAATTAAACTCAAATATTAAATATCTATAACTTATAAACACCAACTTTCAATGTAATAAATGTATCCTAA
TCTTATGTATGTTTAACTGGATTACATAGATTTTTATCTTTTGTTAAAATGTGTATACCCCGTGGACCAACATAATATTAAAGTATGTAT
ATATTATATAAATATATATGTATATGTGCTCGCTTGTGTAGGATGAATGTCTTAGAGTCGTTTGTGGTATTTTATGTTGTTGACTCTGGC
TCCAGGGCCTGTGCTTGAAAAGGACAGATAAGTATTGCCCAGAGCTAAGTGGCACTACTTACAAAGTTTTAAATGTCTTCTACATACTGA
TTCATGTTTATTTGAGCTCTCTTTATAGAATTTTCTCTTAAAGTTTCAAACCTCTAAGTTGTAGCCTGTAATTATGAGAACAGTAAACTT
TAAGTAATAATAAAGAATCCCATCCATATATCCAATTTGCAATTGAGTTTTGCATGGTTCTCTGATTATGTCCATGCTGTGTCCAAGGAG
GAGTAGGTACATACAATCAGCACAGATTAATATATGTAAAGGGTTTGGGACAGCACCTGGTATAGAATAAATAATAAATGTAAACTATTA

>In-frame_KMT2A_ENST00000389506_chr11_118355690_+_EPS15_ENST00000371730_chr1_51946988_-_9025nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGGAGGATTGTGAA
GCAGAAAATGTGTGGGAGATGGGAGGCTTAGGAATCTTGACTTCTGTTCCTATAACACCCAGGGTGGTTTGCTTTCTCTGTGCCAGTAGT
GGGCATGTAGAGTTATCAAGTGGGAATCCTGTATATGAAAAATACTATAGACAGGTTGATACAGGCAATACTGGAAGGGTGTTGGCTTCT
GATGCTGCTGCTTTCCTGAAAAAATCAGGGCTTCCAGACTTGATACTTGGAAAGATTTGGGATTTAGCCGACACAGATGGCAAAGGTATC
CTGAACAAACAAGAATTCTTTGTTGCTTTGCGTCTTGTGGCATGTGCCCAGAATGGATTGGAAGTTTCACTAAGTAGTTTGAACCTGGCT
GTTCCTCCACCAAGATTTCATGATACCAGTAGTCCTTTGCTAATCAGTGGAACCTCTGCAGCTGAGCTCCCATGGGCTGTAAAACCTGAA
GATAAGGCCAAATATGATGCAATATTTGATAGTTTAAGCCCAGTGAATGGATTTCTGTCTGGTGATAAAGTGAAACCAGTGTTGCTCAAC
TCTAAGTTACCTGTGGATATCCTTGGAAGAGTTTGGGAGTTGAGTGATATTGACCATGATGGAATGCTTGACAGAGATGAGTTTGCAGTT
GCCATGTTTTTGGTATACTGTGCACTGGAGAAAGAACCTGTGCCAATGTCCTTGCCTCCAGCCTTGGTGCCACCATCTAAGAGAAAAACG
TGGGTTGTATCCCCTGCAGAAAAAGCTAAATATGATGAAATCTTCCTGAAAACTGATAAAGATATGGACGGATTTGTGTCTGGATTGGAG
GTCCGTGAAATATTCTTGAAAACAGGTTTACCTTCTACCTTACTAGCCCATATATGGTCATTATGCGACACAAAGGACTGTGGGAAGCTT
TCAAAGGATCAGTTTGCCTTGGCTTTTCACTTAATCAGTCAGAAGTTAATCAAGGGCATTGATCCTCCTCACGTTCTTACTCCTGAAATG
ATTCCACCATCAGACAGGGCCAGTTTACAAAAGAACATCATAGGATCAAGTCCTGTTGCAGATTTCTCTGCTATTAAGGAACTAGATACT
CTTAACAATGAAATAGTTGACCTACAGAGGGAAAAGAATAATGTGGAACAGGACCTTAAGGAGAAGGAAGATACTATTAAACAGAGGACA
AGTGAGGTTCAGGATCTTCAAGATGAAGTTCAAAGGGAGAATACTAATCTGCAAAAACTACAGGCCCAGAAACAGCAGGTACAGGAACTC
CTTGATGAACTGGATGAGCAGAAAGCCCAGCTGGAGGAGCAACTCAAGGAAGTCAGAAAGAAATGTGCTGAGGAGGCCCAACTGGCAAGA
AGTAGTCCTGAACTACTGCCTTCTGGTGTGACTGATGAAAATGAGGTGACTACAGCTGTTACTGAAAAAGTTTGTTCTGAACTCGACAAT
AATAGACATTCAAAAGAGGAAGATCCATTTAATGTAGACTCAAGTTCGCTGACAGGTCCAGTTGCAGATACAAACTTGGATTTTTTCCAG
TCTGATCCTTTTGTTGGCAGTGATCCTTTCAAGGATGATCCTTTTGGAAAAATCGATCCATTTGGTGGTGATCCTTTCAAAGGTTCAGAT
CCATTTGCATCAGACTGTTTCTTCAGGCAATCTACTGATCCTTTTGCCACTTCAAGCACTGACCCTTTCAGTGCAGCCAACAATAGCAGT
ATTACATCGGTAGAAACGTTGAAGCACAATGATCCTTTTGCTCCTGGTGGAACAGTTGTTGCAGCAAGCGATTCAGCCACAGACCCCTTT
GCTTCTGTTTTTGGGAATGAATCATTTGGAGGTGGATTTGCTGACTTCAGCACATTGTCAAAGGTCAACAATGAAGATCCTTTTCGTTCA
GCCACATCGAGCTCTGTCAGCAACGTAGTGATTACAAAAAATGTATTTGAGGAAACATCGGTCAAAAGTGAAGATGAACCCCCAGCACTG
CCACCAAAGATCGGAACTCCAACAAGACCCTGCCCTCTACCACCTGGGAAAAGATCCATCAACAAATTGGATTCTCCTGATCCCTTTAAA
CTGAATGATCCATTTCAGCCTTTCCCAGGCAACGATAGCCCCAAAGAAAAAGATCCTGAAATATTTTGTGATCCATTCACTTCTGCTACT
ACCACTACCAATAAAGAGGCTGATCCAAGCAATTTTGCCAACTTCAGTGCTTATCCCTCTGAAGAAGATATGATCGAATGGGCCAAGAGG
GAAAGTGAGAGAGAGGAAGAGCAGAGGCTTGCCCGACTAAATCAGCAGGAACAAGAAGACTTAGAACTGGCTATTGCACTCAGCAAATCT
GAGATATCAGAAGCATGAAGAATTCTCTTGTTCTTTGGCAACAATATAGTATTCTTCTTCCTGAATACTGAAACTATTTACAATGTGTAT
CAAAACTACCTGTGAGCATGGGAATACAAAAGGTTTGAGATTCCTGTAAATGTGACAAAATTTTAGGATTTTTTTTTTTTCTTCATTACA
GATTCGTCTTTTTTTTTTTTTCTTATAAAAGCCGTAACCCAGTCAGACAAATTCACCTTCACTTAGGCCCCTGTTCTGGTATACATTTAC
TGTGAGCTTTTGCCTGCCTGTGCTATTTTACTTGTAAAGCTAGAGCACCCAAGCTTCTGCCTTCTGGAATATAGAGAAATAGTTTCACCC
TGCACTACCCTGTTCTGTAGTTATTCTGATGATAGCCAGTGAGGTTCTTAAAGTTTGCAGTATTCTCCCCTGATTGGAATGGTTGAGTGA
GGGTAAGGGAAAGAATATCTTATTTCTTTTATGATTGGTGCAAATTGGCTAAAGTGCATTTTTAAATTTCCTCTACTTAATTTGTTTTTC
AGAGATAAGGAAAAATATTTTGCACAGATTTACTCCACTATGGAAAAGGGATGCTGTAGGTTGAACCATTATAGCCTCAGATTCGATCTT
TTCCTAACTAAAAATATTAAAGCCTCATGTGTGAAATAAATTTTTAAAAAGATTTATCTGGATTTAGAGAATTTTAGATCAACAGATACC
TCTCAGTGTGTTTGCTAATTAATAAAAATCAGTTTCTTACAAATAAAGTTTGTAAGAAAATGTTCATTTTAAGTGATAGATAGTGGAGAA
AATTTATCACCTAAAATATACCCATCAGTATAAGGCAAGCAAAAGTCTTAACATGGCAGCCATTCTGCCTTTGCCGTGGCCCTGTCCTGT
TTAGTTCTTAGTGGGTTAATTTTTGTACTTTTGCAGAAGAAACTTCAGCAAGCTAGAACTGGAAGGTACTTTAATTTTTCATATATATTT
GTTTTTTTTTTTTTAATGAAGGCTCATTTACTTGAAATGTAAAAACTTTCACTGAATACAAATAGAAAAAGTGATGTGTTTTATATCATA
TTGCTTTTTGTCCATCTTTGTGGTTTAGTTTATTTACTCACTTCATGTTTTTCACCTATAAAATTGTCAAGCTAGCAAAAAAACTCTTGT
TTTTTTAATTGGGAGAGAAGAGACCTGCCAGATTATCAGACCTCTTCATGTTAAAAGACCATCTCCTGTAAAACTGACCTAGTGGACAAG
CTGAATTTGAAATAGACTGTGAAGTAAGCTGTAACTTGTCATTTTAATTTTGTTTAACACGGTTACTGACTTAGATGATGTATTAAATAC
CAAGATAAAGAAAAATGCACCTAAAATCTAATTAGAATTCTCTGGGTCAACAAGTCAAGGTGGTATTGATCTGTGTTAATCTGAGTAACT
TATTGCCTAGCCTATAAATAAATTCCAAAATATCCAATTCATTTCTTCTTGAAATGGTGCTTGTTTTGTTTTCTTTCCATTACACAATTA
GACTCCTACAGTTTAAAACAAACTTTAAACCACTATCTTGCACTGCTAACTTTTTTCTACCTTTGTAAATAGAAACATTTCTGCATAAAA
GTCATACATATGAAGCAAGGGCTGAATCATAATCACAAGGCTTAATTTTGATAAACGAATCCAGTGACCTAAGGATTTTCTGCAAAATTT
GACTGGGAGTTGTGATAGGTGGTATTTTTGTTTATTTTCTTCCTCTTACTCCTTAGGATAAAGGTAAGTTGACTTGAACAACTTTCTTTT
GCACTGGGAAAATAAGCAAATGTTTAAATGCTTCAAAAAAATTTTCAATTAAACTCAAATATTAAATATCTATAACTTATAAACACCAAC
TTTCAATGTAATAAATGTATCCTAATCTTATGTATGTTTAACTGGATTACATAGATTTTTATCTTTTGTTAAAATGTGTATACCCCGTGG
ACCAACATAATATTAAAGTATGTATATATTATATAAATATATATGTATATGTGCTCGCTTGTGTAGGATGAATGTCTTAGAGTCGTTTGT
GGTATTTTATGTTGTTGACTCTGGCTCCAGGGCCTGTGCTTGAAAAGGACAGATAAGTATTGCCCAGAGCTAAGTGGCACTACTTACAAA
GTTTTAAATGTCTTCTACATACTGATTCATGTTTATTTGAGCTCTCTTTATAGAATTTTCTCTTAAAGTTTCAAACCTCTAAGTTGTAGC
CTGTAATTATGAGAACAGTAAACTTTAAGTAATAATAAAGAATCCCATCCATATATCCAATTTGCAATTGAGTTTTGCATGGTTCTCTGA
TTATGTCCATGCTGTGTCCAAGGAGGAGTAGGTACATACAATCAGCACAGATTAATATATGTAAAGGGTTTGGGACAGCACCTGGTATAG

>In-frame_KMT2A_ENST00000389506_chr11_118355690_+_EPS15_ENST00000371733_chr1_51946988_-_9427nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGGAGGATTGTGAA
GCAGAAAATGTGTGGGAGATGGGAGGCTTAGGAATCTTGACTTCTGTTCCTATAACACCCAGGGTGGTTTGCTTTCTCTGTGCCAGTAGT
GGGCATGTAGAGTTATCAAGTGGGAATCCTGTATATGAAAAATACTATAGACAGGTTGATACAGGCAATACTGGAAGGGTGTTGGCTTCT
GATGCTGCTGCTTTCCTGAAAAAATCAGGGCTTCCAGACTTGATACTTGGAAAGATTTGGGATTTAGCCGACACAGATGGCAAAGGTATC
CTGAACAAACAAGAATTCTTTGTTGCTTTGCGTCTTGTGGCATGTGCCCAGAATGGATTGGAAGTTTCACTAAGTAGTTTGAACCTGGCT
GTTCCTCCACCAAGATTTCATGATACCAGTAGTCCTTTGCTAATCAGTGGAACCTCTGCAGCTGAGCTCCCATGGGCTGTAAAACCTGAA
GATAAGGCCAAATATGATGCAATATTTGATAGTTTAAGCCCAGTGAATGGATTTCTGTCTGGTGATAAAGTGAAACCAGTGTTGCTCAAC
TCTAAGTTACCTGTGGATATCCTTGGAAGAGTTTGGGAGTTGAGTGATATTGACCATGATGGAATGCTTGACAGAGATGAGTTTGCAGTT
GCCATGTTTTTGGTATACTGTGCACTGGAGAAAGAACCTGTGCCAATGTCCTTGCCTCCAGCCTTGGTGCCACCATCTAAGAGAAAAACG
TGGGTTGTATCCCCTGCAGAAAAAGCTAAATATGATGAAATCTTCCTGAAAACTGATAAAGATATGGACGGATTTGTGTCTGGATTGGAG
GTCCGTGAAATATTCTTGAAAACAGGTTTACCTTCTACCTTACTAGCCCATATATGGTCATTATGCGACACAAAGGACTGTGGGAAGCTT
TCAAAGGATCAGTTTGCCTTGGCTTTTCACTTAATCAGTCAGAAGTTAATCAAGGGCATTGATCCTCCTCACGTTCTTACTCCTGAAATG
ATTCCACCATCAGACAGGGCCAGTTTACAAAAGAACATCATAGGATCAAGTCCTGTTGCAGATTTCTCTGCTATTAAGGAACTAGATACT
CTTAACAATGAAATAGTTGACCTACAGAGGGAAAAGAATAATGTGGAACAGGACCTTAAGGAGAAGGAAGATACTATTAAACAGAGGACA
AGTGAGGTTCAGGATCTTCAAGATGAAGTTCAAAGGGAGAATACTAATCTGCAAAAACTACAGGCCCAGAAACAGCAGGTACAGGAACTC
CTTGATGAACTGGATGAGCAGAAAGCCCAGCTGGAGGAGCAACTCAAGGAAGTCAGAAAGAAATGTGCTGAGGAGGCCCAACTGATCTCT
TCTCTGAAAGCTGAATTAACTAGTCAGGAATCGCAGATCTCCACTTACGAAGAAGAATTGGCAAAAGCTAGAGAAGAGCTGAGCCGTCTA
CAGCAAGAAACAGCAGAATTGGAGGAGAGTGTAGAGTCAGGGAAGGCTCAGTTGGAACCTCTTCAGCAGCACCTACAAGATTCACAACAG
GAAATTAGTTCAATGCAAATGAAACTGATGGAAATGAAAGATTTGGAAAATCATAATAGTCAGTTAAATTGGTGCAGTAGCCCACACAGC
ATTCTTGTAAACGGAGCTACAGATTATTGCAGCCTCAGCACCAGCAGCAGTGAAACAGCCAACCTTAATGAACATGTTGAAGGCCAGAGC
AACCTAGAGTCTGAGCCCATACACCAGGAATCTCCAGCAAGAAGTAGTCCTGAACTACTGCCTTCTGGTGTGACTGATGAAAATGAGGTG
ACTACAGCTGTTACTGAAAAAGTTTGTTCTGAACTCGACAATAATAGACATTCAAAAGAGGAAGATCCATTTAATGTAGACTCAAGTTCG
CTGACAGGTCCAGTTGCAGATACAAACTTGGATTTTTTCCAGTCTGATCCTTTTGTTGGCAGTGATCCTTTCAAGGATGATCCTTTTGGA
AAAATCGATCCATTTGGTGGTGATCCTTTCAAAGGTTCAGATCCATTTGCATCAGACTGTTTCTTCAGGCAATCTACTGATCCTTTTGCC
ACTTCAAGCACTGACCCTTTCAGTGCAGCCAACAATAGCAGTATTACATCGGTAGAAACGTTGAAGCACAATGATCCTTTTGCTCCTGGT
GGAACAGTTGTTGCAGCAAGCGATTCAGCCACAGACCCCTTTGCTTCTGTTTTTGGGAATGAATCATTTGGAGGTGGATTTGCTGACTTC
AGCACATTGTCAAAGGTCAACAATGAAGATCCTTTTCGTTCAGCCACATCGAGCTCTGTCAGCAACGTAGTGATTACAAAAAATGTATTT
GAGGAAACATCGGTCAAAAGTGAAGATGAACCCCCAGCACTGCCACCAAAGATCGGAACTCCAACAAGACCCTGCCCTCTACCACCTGGG
AAAAGATCCATCAACAAATTGGATTCTCCTGATCCCTTTAAACTGAATGATCCATTTCAGCCTTTCCCAGGCAACGATAGCCCCAAAGAA
AAAGATCCTGAAATATTTTGTGATCCATTCACTTCTGCTACTACCACTACCAATAAAGAGGCTGATCCAAGCAATTTTGCCAACTTCAGT
GCTTATCCCTCTGAAGAAGATATGATCGAATGGGCCAAGAGGGAAAGTGAGAGAGAGGAAGAGCAGAGGCTTGCCCGACTAAATCAGCAG
GAACAAGAAGACTTAGAACTGGCTATTGCACTCAGCAAATCTGAGATATCAGAAGCATGAAGAATTCTCTTGTTCTTTGGCAACAATATA
GTATTCTTCTTCCTGAATACTGAAACTATTTACAATGTGTATCAAAACTACCTGTGAGCATGGGAATACAAAAGGTTTGAGATTCCTGTA
AATGTGACAAAATTTTAGGATTTTTTTTTTTTCTTCATTACAGATTCGTCTTTTTTTTTTTTTCTTATAAAAGCCGTAACCCAGTCAGAC
AAATTCACCTTCACTTAGGCCCCTGTTCTGGTATACATTTACTGTGAGCTTTTGCCTGCCTGTGCTATTTTACTTGTAAAGCTAGAGCAC
CCAAGCTTCTGCCTTCTGGAATATAGAGAAATAGTTTCACCCTGCACTACCCTGTTCTGTAGTTATTCTGATGATAGCCAGTGAGGTTCT
TAAAGTTTGCAGTATTCTCCCCTGATTGGAATGGTTGAGTGAGGGTAAGGGAAAGAATATCTTATTTCTTTTATGATTGGTGCAAATTGG
CTAAAGTGCATTTTTAAATTTCCTCTACTTAATTTGTTTTTCAGAGATAAGGAAAAATATTTTGCACAGATTTACTCCACTATGGAAAAG
GGATGCTGTAGGTTGAACCATTATAGCCTCAGATTCGATCTTTTCCTAACTAAAAATATTAAAGCCTCATGTGTGAAATAAATTTTTAAA
AAGATTTATCTGGATTTAGAGAATTTTAGATCAACAGATACCTCTCAGTGTGTTTGCTAATTAATAAAAATCAGTTTCTTACAAATAAAG
TTTGTAAGAAAATGTTCATTTTAAGTGATAGATAGTGGAGAAAATTTATCACCTAAAATATACCCATCAGTATAAGGCAAGCAAAAGTCT
TAACATGGCAGCCATTCTGCCTTTGCCGTGGCCCTGTCCTGTTTAGTTCTTAGTGGGTTAATTTTTGTACTTTTGCAGAAGAAACTTCAG
CAAGCTAGAACTGGAAGGTACTTTAATTTTTCATATATATTTGTTTTTTTTTTTTTAATGAAGGCTCATTTACTTGAAATGTAAAAACTT
TCACTGAATACAAATAGAAAAAGTGATGTGTTTTATATCATATTGCTTTTTGTCCATCTTTGTGGTTTAGTTTATTTACTCACTTCATGT
TTTTCACCTATAAAATTGTCAAGCTAGCAAAAAAACTCTTGTTTTTTTAATTGGGAGAGAAGAGACCTGCCAGATTATCAGACCTCTTCA
TGTTAAAAGACCATCTCCTGTAAAACTGACCTAGTGGACAAGCTGAATTTGAAATAGACTGTGAAGTAAGCTGTAACTTGTCATTTTAAT
TTTGTTTAACACGGTTACTGACTTAGATGATGTATTAAATACCAAGATAAAGAAAAATGCACCTAAAATCTAATTAGAATTCTCTGGGTC
AACAAGTCAAGGTGGTATTGATCTGTGTTAATCTGAGTAACTTATTGCCTAGCCTATAAATAAATTCCAAAATATCCAATTCATTTCTTC
TTGAAATGGTGCTTGTTTTGTTTTCTTTCCATTACACAATTAGACTCCTACAGTTTAAAACAAACTTTAAACCACTATCTTGCACTGCTA
ACTTTTTTCTACCTTTGTAAATAGAAACATTTCTGCATAAAAGTCATACATATGAAGCAAGGGCTGAATCATAATCACAAGGCTTAATTT
TGATAAACGAATCCAGTGACCTAAGGATTTTCTGCAAAATTTGACTGGGAGTTGTGATAGGTGGTATTTTTGTTTATTTTCTTCCTCTTA
CTCCTTAGGATAAAGGTAAGTTGACTTGAACAACTTTCTTTTGCACTGGGAAAATAAGCAAATGTTTAAATGCTTCAAAAAAATTTTCAA
TTAAACTCAAATATTAAATATCTATAACTTATAAACACCAACTTTCAATGTAATAAATGTATCCTAATCTTATGTATGTTTAACTGGATT
ACATAGATTTTTATCTTTTGTTAAAATGTGTATACCCCGTGGACCAACATAATATTAAAGTATGTATATATTATATAAATATATATGTAT
ATGTGCTCGCTTGTGTAGGATGAATGTCTTAGAGTCGTTTGTGGTATTTTATGTTGTTGACTCTGGCTCCAGGGCCTGTGCTTGAAAAGG
ACAGATAAGTATTGCCCAGAGCTAAGTGGCACTACTTACAAAGTTTTAAATGTCTTCTACATACTGATTCATGTTTATTTGAGCTCTCTT
TATAGAATTTTCTCTTAAAGTTTCAAACCTCTAAGTTGTAGCCTGTAATTATGAGAACAGTAAACTTTAAGTAATAATAAAGAATCCCAT
CCATATATCCAATTTGCAATTGAGTTTTGCATGGTTCTCTGATTATGTCCATGCTGTGTCCAAGGAGGAGTAGGTACATACAATCAGCAC


Top

FusionGenePPI for KMT2A_EPS15


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
KMT2APPIE, PPP1R15A, KMT2A, ASH2L, HCFC1, HCFC2, MEN1, RBBP5, WDR5, AVP, INS, OXT, MAP3K5, HDAC1, CTBP1, CBX4, BMI1, CREBBP, SMARCB1, CXXC1, MYB, CTNNB1, SNW1, E2F2, E2F4, E2F6, PSIP1, MLLT4, POLR2A, KAT8, RNF2, TP53, SBF1, MTM1, SET, HIST1H3A, HIST1H4A, KAT6A, ELL, AFF1, AFF4, CDK9, CCNT1, CTR9, LEO1, PAF1, CDC73, WDR61, MLLT3, DOT1L, SKP2, HIST3H3, SVIL, HIST2H3C, SIN3A, MLLT1, RUNX1, CBFB, H3F3A, SIRT7, ASB2, TCEB1, TCEB2, CBX8, TOP1, TAF6, NCL, HECW2, LGR4, CSNK2A2, SENP3, SYMPK, PKN1, PIH1D1, KRAS, TAF1, CHD3, SMARCA2, SMARCC2, SMARCC1, HDAC2, RBBP4, RBBP7, TBP, MBD3, SAP30, RAN, TAF9, TASP1, HIST1H2BG, EWSR1, DYNLT1, KIF11, ING4, ZNF131, ASB7EPS15RNF11, SNAP91, AGFG1, NAGPA, STON2, HGS, AP2A2, DNM2, AP2A1, EGFR, CLINT1, EPN1, SCAMP1, STAM2, GRB2, CRK, RAB11FIP2, REPS2, UBE2D1, UBE2D2, UBE2D3, UBE2H, UBE2E1, SLC6A3, PARK2, USP8, CD4, EPS15, OCLN, UBQLN1, UBC, NEDD4, GJA1, TGFB1, FCHO2, ITSN1, ITSN2, ELAVL1, RAD23A, UBQLN2, EPN3, SH3BP4, AP1B1, NUMB, SPG20, TFAP2A, ABL1, AP2B1, IQGAP1, KRT85, KRT1, KRT10, KRT2, AP2M1, KRT14, KRT86, KRT5, KRT6A, KRT16, KRT9, HSPA8, KRT35, HSPA9, KRT17, KRT33B, KRT83, BMP2K, KRT34, KRT82, NONO, KRT38, KRT75, KRT79, PRDX1, KRT36, KRT32, MAP4, HSPA1L, HSPA1B, KRT37, HSPA5, KRT73, AP2S1, NECAP2, TRAF2, MCCC2, KRT4, ACTB, KRT3, VPRBP, TUBB, HIST4H4, PCCB, KRTAP9-3, NECAP1, VSIG8, CCT3, CRKL, FN1, VCAM1, LAPTM5, ITGA4, OPTN, RABL6, EPHA2, CORO7, AGFG2, SLC25A41, AURKA, SPC25, NTRK1, TMEM17, XPO1, CAPZA2, CLTB, CLTC, DBN1, FLNA, GAK, MYH9, PPP1CB, PICALM, PDLIM7, SYNPO, MAPRE1, LIMA1, GTSE1, ANLN, MYO19, MAPK14, AP1G1, MYO6, SPOPL, SGIP1, FCHO1, CDH1, RUNDC3A, LSR, STAMBPL1, CCDC172, OXCT1, MTNR1A, RNF26


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneKMT2Achr11:118355690chr1:51946988ENST00000354520+1351584_160003932histone H3K4me3
HgeneKMT2Achr11:118355690chr1:51946988ENST00000389506+10361584_160014443970histone H3K4me3
HgeneKMT2Achr11:118355690chr1:51946988ENST00000534358+10361584_160014443973histone H3K4me3
HgeneKMT2Achr11:118355690chr1:51946988ENST00000354520+1353764_377103932WDR5
HgeneKMT2Achr11:118355690chr1:51946988ENST00000389506+10363764_377114443970WDR5
HgeneKMT2Achr11:118355690chr1:51946988ENST00000534358+10363764_377114443973WDR5
TgeneEPS15chr11:118355690chr1:51946988ENST00000371733-0252_33011897DAB2


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for KMT2A_EPS15


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for KMT2A_EPS15


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneKMT2AC0023418leukemia2CTD_human
HgeneKMT2AC0023467Leukemia, Myelocytic, Acute2CTD_human
HgeneKMT2AC0023470Myeloid Leukemia2CTD_human
HgeneKMT2AC1961102Precursor Cell Lymphoblastic Leukemia Lymphoma2CTD_human
HgeneKMT2AC0001418Adenocarcinoma1CTD_human
HgeneKMT2AC0005695Bladder Neoplasm1CTD_human
HgeneKMT2AC0007138Carcinoma, Transitional Cell1CTD_human
HgeneKMT2AC0008625Chromosome Aberrations1CTD_human
HgeneKMT2AC0023448Lymphoid leukemia1CTD_human
HgeneKMT2AC0023465Acute monocytic leukemia1CTD_human
HgeneKMT2AC0023479Acute myelomonocytic leukemia1CTD_human
HgeneKMT2AC0036341Schizophrenia1PSYGENET
HgeneKMT2AC0038356Stomach Neoplasms1CTD_human
HgeneKMT2AC0149925Small cell carcinoma of lung1CTD_human
HgeneKMT2AC2239176Liver carcinoma1CTD_human