FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 19083

FusionGeneSummary for KMT2A_AFF1

check button Fusion gene summary
Fusion gene informationFusion gene name: KMT2A_AFF1
Fusion gene ID: 19083
HgeneTgene
Gene symbol

KMT2A

AFF1

Gene ID

4297

4299

Gene namelysine methyltransferase 2AAF4/FMR2 family member 1
SynonymsALL-1|CXXC7|HRX|HTRX1|MLL|MLL1|MLL1A|TRX1|WDSTSAF4|MLLT2|PBM1
Cytomap

11q23.3

4q21.3-q22.1

Type of geneprotein-codingprotein-coding
Descriptionhistone-lysine N-methyltransferase 2ACXXC-type zinc finger protein 7lysine (K)-specific methyltransferase 2Alysine N-methyltransferase 2Amixed lineage leukemia 1myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila)trithorax-likeAF4/FMR2 family member 1ALL1-fused gene from chromosome 4 proteinmyeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 2pre-B-cell monocytic leukemia partner 1proto-oncogene AF4
Modification date2018051920180523
UniProtAcc

Q03164

P51825

Ensembl transtripts involved in fusion geneENST00000534358, ENST00000389506, 
ENST00000354520, ENST00000420751, 
ENST00000395146, ENST00000307808, 
ENST00000544085, ENST00000511996, 
Fusion gene scores* DoF score31 X 72 X 6=1339210 X 25 X 4=1000
# samples 12931
** MAII scorelog2(129/13392*10)=-3.37592846223973
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(31/1000*10)=-1.68965987938785
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: KMT2A [Title/Abstract] AND AFF1 [Title/Abstract] AND fusion [Title/Abstract]

Frequency of the ETV6-RUNX1, BCR-ABL1, TCF3-PBX1, and MLL-AFF1 fusion genes in Guatemalan pediatric acute lymphoblastic leukemia patients and their ethnic associations. (pmid: 23859904)
Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Transcription factor involved fusion gene, inframe and retained DNA-binding domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneKMT2A

GO:0045944

positive regulation of transcription by RNA polymerase II

20861184

HgeneKMT2A

GO:0051568

histone H3-K4 methylation

19556245

HgeneKMT2A

GO:0065003

protein-containing complex assembly

15199122

HgeneKMT2A

GO:0080182

histone H3-K4 trimethylation

20861184


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
ChiTaRS3.1DQ451148KMT2Achr11

118353211

+AFF1chr4

88012943

+
ChiTaRS3.1AM050806KMT2Achr11

118355313

+AFF1chr4

88012229

+
ChiTaRS3.1AF487905KMT2Achr11

118355690

+AFF1chr4

88005270

+
ChiTaRS3.1AM050792KMT2Achr11

118359134

+AFF1chr4

87994732

+
ChiTaRS3.1L22179KMT2Achr11

118355029

+AFF1chr4

88005264

+
ChiTaRS3.1AF492832KMT2Achr11

118355690

+AFF1chr4

88005270

+
ChiTaRS3.1AF177237KMT2Achr11

118353211

+AFF1chr4

88011134

+
ChiTaRS3.1AF024541KMT2Achr11

118353210

+AFF1chr4

88005270

+
ChiTaRS3.1AF031404KMT2Achr11

118355690

+AFF1chr4

88005270

+
ChiTaRS3.1AM050785KMT2Achr11

118355449

+AFF1chr4

88010585

+
ChiTaRS3.1AM050775KMT2Achr11

118354935

+AFF1chr4

88015814

+
ChiTaRS3.1AM050795KMT2Achr11

118355622

-AFF1chr4

87968221

+
ChiTaRS3.1AM050788KMT2Achr11

118355307

+AFF1chr4

87976189

+
ChiTaRS3.1AM050799KMT2Achr11

118355626

+AFF1chr4

88004293

+
ChiTaRS3.1AM050796KMT2Achr11

118359135

+AFF1chr4

87987255

+
ChiTaRS3.1AM050784KMT2Achr11

118355309

+AFF1chr4

87999277

+
ChiTaRS3.1AM050787KMT2Achr11

118355501

+AFF1chr4

87977475

+
ChiTaRS3.1AM050802KMT2Achr11

118355579

+AFF1chr4

87995374

+
ChiTaRS3.1AF177236KMT2Achr11

118353211

+AFF1chr4

88011134

+
ChiTaRS3.1AM050774KMT2Achr11

118355010

+AFF1chr4

87995281

+
ChiTaRS3.1JN169752KMT2Achr11

118359475

+AFF1chr4

88005270

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000534358ENST00000395146KMT2Achr11

118353211

+AFF1chr4

88012943

+
In-frameENST00000534358ENST00000307808KMT2Achr11

118353211

+AFF1chr4

88012943

+
In-frameENST00000534358ENST00000544085KMT2Achr11

118353211

+AFF1chr4

88012943

+
5CDS-intronENST00000534358ENST00000511996KMT2Achr11

118353211

+AFF1chr4

88012943

+
In-frameENST00000389506ENST00000395146KMT2Achr11

118353211

+AFF1chr4

88012943

+
In-frameENST00000389506ENST00000307808KMT2Achr11

118353211

+AFF1chr4

88012943

+
In-frameENST00000389506ENST00000544085KMT2Achr11

118353211

+AFF1chr4

88012943

+
5CDS-intronENST00000389506ENST00000511996KMT2Achr11

118353211

+AFF1chr4

88012943

+
In-frameENST00000354520ENST00000395146KMT2Achr11

118353211

+AFF1chr4

88012943

+
In-frameENST00000354520ENST00000307808KMT2Achr11

118353211

+AFF1chr4

88012943

+
In-frameENST00000354520ENST00000544085KMT2Achr11

118353211

+AFF1chr4

88012943

+
5CDS-intronENST00000354520ENST00000511996KMT2Achr11

118353211

+AFF1chr4

88012943

+
intron-3CDSENST00000420751ENST00000395146KMT2Achr11

118353211

+AFF1chr4

88012943

+
intron-3CDSENST00000420751ENST00000307808KMT2Achr11

118353211

+AFF1chr4

88012943

+
intron-3CDSENST00000420751ENST00000544085KMT2Achr11

118353211

+AFF1chr4

88012943

+
intron-intronENST00000420751ENST00000511996KMT2Achr11

118353211

+AFF1chr4

88012943

+
intron-intronENST00000534358ENST00000395146KMT2Achr11

118355313

+AFF1chr4

88012229

+
intron-intronENST00000534358ENST00000307808KMT2Achr11

118355313

+AFF1chr4

88012229

+
intron-intronENST00000534358ENST00000544085KMT2Achr11

118355313

+AFF1chr4

88012229

+
intron-intronENST00000534358ENST00000511996KMT2Achr11

118355313

+AFF1chr4

88012229

+
intron-intronENST00000389506ENST00000395146KMT2Achr11

118355313

+AFF1chr4

88012229

+
intron-intronENST00000389506ENST00000307808KMT2Achr11

118355313

+AFF1chr4

88012229

+
intron-intronENST00000389506ENST00000544085KMT2Achr11

118355313

+AFF1chr4

88012229

+
intron-intronENST00000389506ENST00000511996KMT2Achr11

118355313

+AFF1chr4

88012229

+
intron-intronENST00000354520ENST00000395146KMT2Achr11

118355313

+AFF1chr4

88012229

+
intron-intronENST00000354520ENST00000307808KMT2Achr11

118355313

+AFF1chr4

88012229

+
intron-intronENST00000354520ENST00000544085KMT2Achr11

118355313

+AFF1chr4

88012229

+
intron-intronENST00000354520ENST00000511996KMT2Achr11

118355313

+AFF1chr4

88012229

+
intron-intronENST00000420751ENST00000395146KMT2Achr11

118355313

+AFF1chr4

88012229

+
intron-intronENST00000420751ENST00000307808KMT2Achr11

118355313

+AFF1chr4

88012229

+
intron-intronENST00000420751ENST00000544085KMT2Achr11

118355313

+AFF1chr4

88012229

+
intron-intronENST00000420751ENST00000511996KMT2Achr11

118355313

+AFF1chr4

88012229

+
In-frameENST00000534358ENST00000395146KMT2Achr11

118355690

+AFF1chr4

88005270

+
In-frameENST00000534358ENST00000307808KMT2Achr11

118355690

+AFF1chr4

88005270

+
5CDS-5UTRENST00000534358ENST00000544085KMT2Achr11

118355690

+AFF1chr4

88005270

+
5CDS-intronENST00000534358ENST00000511996KMT2Achr11

118355690

+AFF1chr4

88005270

+
In-frameENST00000389506ENST00000395146KMT2Achr11

118355690

+AFF1chr4

88005270

+
In-frameENST00000389506ENST00000307808KMT2Achr11

118355690

+AFF1chr4

88005270

+
5CDS-5UTRENST00000389506ENST00000544085KMT2Achr11

118355690

+AFF1chr4

88005270

+
5CDS-intronENST00000389506ENST00000511996KMT2Achr11

118355690

+AFF1chr4

88005270

+
intron-3CDSENST00000354520ENST00000395146KMT2Achr11

118355690

+AFF1chr4

88005270

+
intron-3CDSENST00000354520ENST00000307808KMT2Achr11

118355690

+AFF1chr4

88005270

+
intron-5UTRENST00000354520ENST00000544085KMT2Achr11

118355690

+AFF1chr4

88005270

+
intron-intronENST00000354520ENST00000511996KMT2Achr11

118355690

+AFF1chr4

88005270

+
intron-3CDSENST00000420751ENST00000395146KMT2Achr11

118355690

+AFF1chr4

88005270

+
intron-3CDSENST00000420751ENST00000307808KMT2Achr11

118355690

+AFF1chr4

88005270

+
intron-5UTRENST00000420751ENST00000544085KMT2Achr11

118355690

+AFF1chr4

88005270

+
intron-intronENST00000420751ENST00000511996KMT2Achr11

118355690

+AFF1chr4

88005270

+
intron-intronENST00000534358ENST00000395146KMT2Achr11

118359134

+AFF1chr4

87994732

+
intron-intronENST00000534358ENST00000307808KMT2Achr11

118359134

+AFF1chr4

87994732

+
intron-intronENST00000534358ENST00000544085KMT2Achr11

118359134

+AFF1chr4

87994732

+
intron-intronENST00000534358ENST00000511996KMT2Achr11

118359134

+AFF1chr4

87994732

+
intron-intronENST00000389506ENST00000395146KMT2Achr11

118359134

+AFF1chr4

87994732

+
intron-intronENST00000389506ENST00000307808KMT2Achr11

118359134

+AFF1chr4

87994732

+
intron-intronENST00000389506ENST00000544085KMT2Achr11

118359134

+AFF1chr4

87994732

+
intron-intronENST00000389506ENST00000511996KMT2Achr11

118359134

+AFF1chr4

87994732

+
intron-intronENST00000354520ENST00000395146KMT2Achr11

118359134

+AFF1chr4

87994732

+
intron-intronENST00000354520ENST00000307808KMT2Achr11

118359134

+AFF1chr4

87994732

+
intron-intronENST00000354520ENST00000544085KMT2Achr11

118359134

+AFF1chr4

87994732

+
intron-intronENST00000354520ENST00000511996KMT2Achr11

118359134

+AFF1chr4

87994732

+
intron-intronENST00000420751ENST00000395146KMT2Achr11

118359134

+AFF1chr4

87994732

+
intron-intronENST00000420751ENST00000307808KMT2Achr11

118359134

+AFF1chr4

87994732

+
intron-intronENST00000420751ENST00000544085KMT2Achr11

118359134

+AFF1chr4

87994732

+
intron-intronENST00000420751ENST00000511996KMT2Achr11

118359134

+AFF1chr4

87994732

+
5CDS-intronENST00000534358ENST00000395146KMT2Achr11

118355029

+AFF1chr4

88005264

+
5CDS-intronENST00000534358ENST00000307808KMT2Achr11

118355029

+AFF1chr4

88005264

+
5CDS-intronENST00000534358ENST00000544085KMT2Achr11

118355029

+AFF1chr4

88005264

+
5CDS-intronENST00000534358ENST00000511996KMT2Achr11

118355029

+AFF1chr4

88005264

+
5CDS-intronENST00000389506ENST00000395146KMT2Achr11

118355029

+AFF1chr4

88005264

+
5CDS-intronENST00000389506ENST00000307808KMT2Achr11

118355029

+AFF1chr4

88005264

+
5CDS-intronENST00000389506ENST00000544085KMT2Achr11

118355029

+AFF1chr4

88005264

+
5CDS-intronENST00000389506ENST00000511996KMT2Achr11

118355029

+AFF1chr4

88005264

+
5CDS-intronENST00000354520ENST00000395146KMT2Achr11

118355029

+AFF1chr4

88005264

+
5CDS-intronENST00000354520ENST00000307808KMT2Achr11

118355029

+AFF1chr4

88005264

+
5CDS-intronENST00000354520ENST00000544085KMT2Achr11

118355029

+AFF1chr4

88005264

+
5CDS-intronENST00000354520ENST00000511996KMT2Achr11

118355029

+AFF1chr4

88005264

+
3UTR-intronENST00000420751ENST00000395146KMT2Achr11

118355029

+AFF1chr4

88005264

+
3UTR-intronENST00000420751ENST00000307808KMT2Achr11

118355029

+AFF1chr4

88005264

+
3UTR-intronENST00000420751ENST00000544085KMT2Achr11

118355029

+AFF1chr4

88005264

+
3UTR-intronENST00000420751ENST00000511996KMT2Achr11

118355029

+AFF1chr4

88005264

+
In-frameENST00000534358ENST00000395146KMT2Achr11

118353211

+AFF1chr4

88011134

+
In-frameENST00000534358ENST00000307808KMT2Achr11

118353211

+AFF1chr4

88011134

+
5CDS-5UTRENST00000534358ENST00000544085KMT2Achr11

118353211

+AFF1chr4

88011134

+
5CDS-intronENST00000534358ENST00000511996KMT2Achr11

118353211

+AFF1chr4

88011134

+
In-frameENST00000389506ENST00000395146KMT2Achr11

118353211

+AFF1chr4

88011134

+
In-frameENST00000389506ENST00000307808KMT2Achr11

118353211

+AFF1chr4

88011134

+
5CDS-5UTRENST00000389506ENST00000544085KMT2Achr11

118353211

+AFF1chr4

88011134

+
5CDS-intronENST00000389506ENST00000511996KMT2Achr11

118353211

+AFF1chr4

88011134

+
In-frameENST00000354520ENST00000395146KMT2Achr11

118353211

+AFF1chr4

88011134

+
In-frameENST00000354520ENST00000307808KMT2Achr11

118353211

+AFF1chr4

88011134

+
5CDS-5UTRENST00000354520ENST00000544085KMT2Achr11

118353211

+AFF1chr4

88011134

+
5CDS-intronENST00000354520ENST00000511996KMT2Achr11

118353211

+AFF1chr4

88011134

+
intron-3CDSENST00000420751ENST00000395146KMT2Achr11

118353211

+AFF1chr4

88011134

+
intron-3CDSENST00000420751ENST00000307808KMT2Achr11

118353211

+AFF1chr4

88011134

+
intron-5UTRENST00000420751ENST00000544085KMT2Achr11

118353211

+AFF1chr4

88011134

+
intron-intronENST00000420751ENST00000511996KMT2Achr11

118353211

+AFF1chr4

88011134

+
In-frameENST00000534358ENST00000395146KMT2Achr11

118353210

+AFF1chr4

88005270

+
In-frameENST00000534358ENST00000307808KMT2Achr11

118353210

+AFF1chr4

88005270

+
5CDS-5UTRENST00000534358ENST00000544085KMT2Achr11

118353210

+AFF1chr4

88005270

+
5CDS-intronENST00000534358ENST00000511996KMT2Achr11

118353210

+AFF1chr4

88005270

+
In-frameENST00000389506ENST00000395146KMT2Achr11

118353210

+AFF1chr4

88005270

+
In-frameENST00000389506ENST00000307808KMT2Achr11

118353210

+AFF1chr4

88005270

+
5CDS-5UTRENST00000389506ENST00000544085KMT2Achr11

118353210

+AFF1chr4

88005270

+
5CDS-intronENST00000389506ENST00000511996KMT2Achr11

118353210

+AFF1chr4

88005270

+
In-frameENST00000354520ENST00000395146KMT2Achr11

118353210

+AFF1chr4

88005270

+
In-frameENST00000354520ENST00000307808KMT2Achr11

118353210

+AFF1chr4

88005270

+
5CDS-5UTRENST00000354520ENST00000544085KMT2Achr11

118353210

+AFF1chr4

88005270

+
5CDS-intronENST00000354520ENST00000511996KMT2Achr11

118353210

+AFF1chr4

88005270

+
intron-3CDSENST00000420751ENST00000395146KMT2Achr11

118353210

+AFF1chr4

88005270

+
intron-3CDSENST00000420751ENST00000307808KMT2Achr11

118353210

+AFF1chr4

88005270

+
intron-5UTRENST00000420751ENST00000544085KMT2Achr11

118353210

+AFF1chr4

88005270

+
intron-intronENST00000420751ENST00000511996KMT2Achr11

118353210

+AFF1chr4

88005270

+
intron-intronENST00000534358ENST00000395146KMT2Achr11

118355449

+AFF1chr4

88010585

+
intron-intronENST00000534358ENST00000307808KMT2Achr11

118355449

+AFF1chr4

88010585

+
intron-intronENST00000534358ENST00000544085KMT2Achr11

118355449

+AFF1chr4

88010585

+
intron-intronENST00000534358ENST00000511996KMT2Achr11

118355449

+AFF1chr4

88010585

+
intron-intronENST00000389506ENST00000395146KMT2Achr11

118355449

+AFF1chr4

88010585

+
intron-intronENST00000389506ENST00000307808KMT2Achr11

118355449

+AFF1chr4

88010585

+
intron-intronENST00000389506ENST00000544085KMT2Achr11

118355449

+AFF1chr4

88010585

+
intron-intronENST00000389506ENST00000511996KMT2Achr11

118355449

+AFF1chr4

88010585

+
intron-intronENST00000354520ENST00000395146KMT2Achr11

118355449

+AFF1chr4

88010585

+
intron-intronENST00000354520ENST00000307808KMT2Achr11

118355449

+AFF1chr4

88010585

+
intron-intronENST00000354520ENST00000544085KMT2Achr11

118355449

+AFF1chr4

88010585

+
intron-intronENST00000354520ENST00000511996KMT2Achr11

118355449

+AFF1chr4

88010585

+
intron-intronENST00000420751ENST00000395146KMT2Achr11

118355449

+AFF1chr4

88010585

+
intron-intronENST00000420751ENST00000307808KMT2Achr11

118355449

+AFF1chr4

88010585

+
intron-intronENST00000420751ENST00000544085KMT2Achr11

118355449

+AFF1chr4

88010585

+
intron-intronENST00000420751ENST00000511996KMT2Achr11

118355449

+AFF1chr4

88010585

+
5CDS-intronENST00000534358ENST00000395146KMT2Achr11

118354935

+AFF1chr4

88015814

+
5CDS-intronENST00000534358ENST00000307808KMT2Achr11

118354935

+AFF1chr4

88015814

+
5CDS-intronENST00000534358ENST00000544085KMT2Achr11

118354935

+AFF1chr4

88015814

+
5CDS-intronENST00000534358ENST00000511996KMT2Achr11

118354935

+AFF1chr4

88015814

+
5CDS-intronENST00000389506ENST00000395146KMT2Achr11

118354935

+AFF1chr4

88015814

+
5CDS-intronENST00000389506ENST00000307808KMT2Achr11

118354935

+AFF1chr4

88015814

+
5CDS-intronENST00000389506ENST00000544085KMT2Achr11

118354935

+AFF1chr4

88015814

+
5CDS-intronENST00000389506ENST00000511996KMT2Achr11

118354935

+AFF1chr4

88015814

+
5CDS-intronENST00000354520ENST00000395146KMT2Achr11

118354935

+AFF1chr4

88015814

+
5CDS-intronENST00000354520ENST00000307808KMT2Achr11

118354935

+AFF1chr4

88015814

+
5CDS-intronENST00000354520ENST00000544085KMT2Achr11

118354935

+AFF1chr4

88015814

+
5CDS-intronENST00000354520ENST00000511996KMT2Achr11

118354935

+AFF1chr4

88015814

+
3UTR-intronENST00000420751ENST00000395146KMT2Achr11

118354935

+AFF1chr4

88015814

+
3UTR-intronENST00000420751ENST00000307808KMT2Achr11

118354935

+AFF1chr4

88015814

+
3UTR-intronENST00000420751ENST00000544085KMT2Achr11

118354935

+AFF1chr4

88015814

+
3UTR-intronENST00000420751ENST00000511996KMT2Achr11

118354935

+AFF1chr4

88015814

+
In-frameENST00000534358ENST00000395146KMT2Achr11

118355622

-AFF1chr4

87968221

+
In-frameENST00000534358ENST00000307808KMT2Achr11

118355622

-AFF1chr4

87968221

+
5CDS-intronENST00000534358ENST00000544085KMT2Achr11

118355622

-AFF1chr4

87968221

+
5CDS-intronENST00000534358ENST00000511996KMT2Achr11

118355622

-AFF1chr4

87968221

+
In-frameENST00000389506ENST00000395146KMT2Achr11

118355622

-AFF1chr4

87968221

+
In-frameENST00000389506ENST00000307808KMT2Achr11

118355622

-AFF1chr4

87968221

+
5CDS-intronENST00000389506ENST00000544085KMT2Achr11

118355622

-AFF1chr4

87968221

+
5CDS-intronENST00000389506ENST00000511996KMT2Achr11

118355622

-AFF1chr4

87968221

+
intron-3CDSENST00000354520ENST00000395146KMT2Achr11

118355622

-AFF1chr4

87968221

+
intron-3CDSENST00000354520ENST00000307808KMT2Achr11

118355622

-AFF1chr4

87968221

+
intron-intronENST00000354520ENST00000544085KMT2Achr11

118355622

-AFF1chr4

87968221

+
intron-intronENST00000354520ENST00000511996KMT2Achr11

118355622

-AFF1chr4

87968221

+
intron-3CDSENST00000420751ENST00000395146KMT2Achr11

118355622

-AFF1chr4

87968221

+
intron-3CDSENST00000420751ENST00000307808KMT2Achr11

118355622

-AFF1chr4

87968221

+
intron-intronENST00000420751ENST00000544085KMT2Achr11

118355622

-AFF1chr4

87968221

+
intron-intronENST00000420751ENST00000511996KMT2Achr11

118355622

-AFF1chr4

87968221

+
intron-intronENST00000534358ENST00000395146KMT2Achr11

118355307

+AFF1chr4

87976189

+
intron-intronENST00000534358ENST00000307808KMT2Achr11

118355307

+AFF1chr4

87976189

+
intron-intronENST00000534358ENST00000544085KMT2Achr11

118355307

+AFF1chr4

87976189

+
intron-intronENST00000534358ENST00000511996KMT2Achr11

118355307

+AFF1chr4

87976189

+
intron-intronENST00000389506ENST00000395146KMT2Achr11

118355307

+AFF1chr4

87976189

+
intron-intronENST00000389506ENST00000307808KMT2Achr11

118355307

+AFF1chr4

87976189

+
intron-intronENST00000389506ENST00000544085KMT2Achr11

118355307

+AFF1chr4

87976189

+
intron-intronENST00000389506ENST00000511996KMT2Achr11

118355307

+AFF1chr4

87976189

+
intron-intronENST00000354520ENST00000395146KMT2Achr11

118355307

+AFF1chr4

87976189

+
intron-intronENST00000354520ENST00000307808KMT2Achr11

118355307

+AFF1chr4

87976189

+
intron-intronENST00000354520ENST00000544085KMT2Achr11

118355307

+AFF1chr4

87976189

+
intron-intronENST00000354520ENST00000511996KMT2Achr11

118355307

+AFF1chr4

87976189

+
intron-intronENST00000420751ENST00000395146KMT2Achr11

118355307

+AFF1chr4

87976189

+
intron-intronENST00000420751ENST00000307808KMT2Achr11

118355307

+AFF1chr4

87976189

+
intron-intronENST00000420751ENST00000544085KMT2Achr11

118355307

+AFF1chr4

87976189

+
intron-intronENST00000420751ENST00000511996KMT2Achr11

118355307

+AFF1chr4

87976189

+
5CDS-intronENST00000534358ENST00000395146KMT2Achr11

118355626

+AFF1chr4

88004293

+
5CDS-intronENST00000534358ENST00000307808KMT2Achr11

118355626

+AFF1chr4

88004293

+
5CDS-intronENST00000534358ENST00000544085KMT2Achr11

118355626

+AFF1chr4

88004293

+
5CDS-intronENST00000534358ENST00000511996KMT2Achr11

118355626

+AFF1chr4

88004293

+
5CDS-intronENST00000389506ENST00000395146KMT2Achr11

118355626

+AFF1chr4

88004293

+
5CDS-intronENST00000389506ENST00000307808KMT2Achr11

118355626

+AFF1chr4

88004293

+
5CDS-intronENST00000389506ENST00000544085KMT2Achr11

118355626

+AFF1chr4

88004293

+
5CDS-intronENST00000389506ENST00000511996KMT2Achr11

118355626

+AFF1chr4

88004293

+
intron-intronENST00000354520ENST00000395146KMT2Achr11

118355626

+AFF1chr4

88004293

+
intron-intronENST00000354520ENST00000307808KMT2Achr11

118355626

+AFF1chr4

88004293

+
intron-intronENST00000354520ENST00000544085KMT2Achr11

118355626

+AFF1chr4

88004293

+
intron-intronENST00000354520ENST00000511996KMT2Achr11

118355626

+AFF1chr4

88004293

+
intron-intronENST00000420751ENST00000395146KMT2Achr11

118355626

+AFF1chr4

88004293

+
intron-intronENST00000420751ENST00000307808KMT2Achr11

118355626

+AFF1chr4

88004293

+
intron-intronENST00000420751ENST00000544085KMT2Achr11

118355626

+AFF1chr4

88004293

+
intron-intronENST00000420751ENST00000511996KMT2Achr11

118355626

+AFF1chr4

88004293

+
intron-intronENST00000534358ENST00000395146KMT2Achr11

118359135

+AFF1chr4

87987255

+
intron-intronENST00000534358ENST00000307808KMT2Achr11

118359135

+AFF1chr4

87987255

+
intron-intronENST00000534358ENST00000544085KMT2Achr11

118359135

+AFF1chr4

87987255

+
intron-intronENST00000534358ENST00000511996KMT2Achr11

118359135

+AFF1chr4

87987255

+
intron-intronENST00000389506ENST00000395146KMT2Achr11

118359135

+AFF1chr4

87987255

+
intron-intronENST00000389506ENST00000307808KMT2Achr11

118359135

+AFF1chr4

87987255

+
intron-intronENST00000389506ENST00000544085KMT2Achr11

118359135

+AFF1chr4

87987255

+
intron-intronENST00000389506ENST00000511996KMT2Achr11

118359135

+AFF1chr4

87987255

+
intron-intronENST00000354520ENST00000395146KMT2Achr11

118359135

+AFF1chr4

87987255

+
intron-intronENST00000354520ENST00000307808KMT2Achr11

118359135

+AFF1chr4

87987255

+
intron-intronENST00000354520ENST00000544085KMT2Achr11

118359135

+AFF1chr4

87987255

+
intron-intronENST00000354520ENST00000511996KMT2Achr11

118359135

+AFF1chr4

87987255

+
intron-intronENST00000420751ENST00000395146KMT2Achr11

118359135

+AFF1chr4

87987255

+
intron-intronENST00000420751ENST00000307808KMT2Achr11

118359135

+AFF1chr4

87987255

+
intron-intronENST00000420751ENST00000544085KMT2Achr11

118359135

+AFF1chr4

87987255

+
intron-intronENST00000420751ENST00000511996KMT2Achr11

118359135

+AFF1chr4

87987255

+
intron-intronENST00000534358ENST00000395146KMT2Achr11

118355309

+AFF1chr4

87999277

+
intron-intronENST00000534358ENST00000307808KMT2Achr11

118355309

+AFF1chr4

87999277

+
intron-intronENST00000534358ENST00000544085KMT2Achr11

118355309

+AFF1chr4

87999277

+
intron-intronENST00000534358ENST00000511996KMT2Achr11

118355309

+AFF1chr4

87999277

+
intron-intronENST00000389506ENST00000395146KMT2Achr11

118355309

+AFF1chr4

87999277

+
intron-intronENST00000389506ENST00000307808KMT2Achr11

118355309

+AFF1chr4

87999277

+
intron-intronENST00000389506ENST00000544085KMT2Achr11

118355309

+AFF1chr4

87999277

+
intron-intronENST00000389506ENST00000511996KMT2Achr11

118355309

+AFF1chr4

87999277

+
intron-intronENST00000354520ENST00000395146KMT2Achr11

118355309

+AFF1chr4

87999277

+
intron-intronENST00000354520ENST00000307808KMT2Achr11

118355309

+AFF1chr4

87999277

+
intron-intronENST00000354520ENST00000544085KMT2Achr11

118355309

+AFF1chr4

87999277

+
intron-intronENST00000354520ENST00000511996KMT2Achr11

118355309

+AFF1chr4

87999277

+
intron-intronENST00000420751ENST00000395146KMT2Achr11

118355309

+AFF1chr4

87999277

+
intron-intronENST00000420751ENST00000307808KMT2Achr11

118355309

+AFF1chr4

87999277

+
intron-intronENST00000420751ENST00000544085KMT2Achr11

118355309

+AFF1chr4

87999277

+
intron-intronENST00000420751ENST00000511996KMT2Achr11

118355309

+AFF1chr4

87999277

+
intron-intronENST00000534358ENST00000395146KMT2Achr11

118355501

+AFF1chr4

87977475

+
intron-intronENST00000534358ENST00000307808KMT2Achr11

118355501

+AFF1chr4

87977475

+
intron-intronENST00000534358ENST00000544085KMT2Achr11

118355501

+AFF1chr4

87977475

+
intron-intronENST00000534358ENST00000511996KMT2Achr11

118355501

+AFF1chr4

87977475

+
intron-intronENST00000389506ENST00000395146KMT2Achr11

118355501

+AFF1chr4

87977475

+
intron-intronENST00000389506ENST00000307808KMT2Achr11

118355501

+AFF1chr4

87977475

+
intron-intronENST00000389506ENST00000544085KMT2Achr11

118355501

+AFF1chr4

87977475

+
intron-intronENST00000389506ENST00000511996KMT2Achr11

118355501

+AFF1chr4

87977475

+
intron-intronENST00000354520ENST00000395146KMT2Achr11

118355501

+AFF1chr4

87977475

+
intron-intronENST00000354520ENST00000307808KMT2Achr11

118355501

+AFF1chr4

87977475

+
intron-intronENST00000354520ENST00000544085KMT2Achr11

118355501

+AFF1chr4

87977475

+
intron-intronENST00000354520ENST00000511996KMT2Achr11

118355501

+AFF1chr4

87977475

+
intron-intronENST00000420751ENST00000395146KMT2Achr11

118355501

+AFF1chr4

87977475

+
intron-intronENST00000420751ENST00000307808KMT2Achr11

118355501

+AFF1chr4

87977475

+
intron-intronENST00000420751ENST00000544085KMT2Achr11

118355501

+AFF1chr4

87977475

+
intron-intronENST00000420751ENST00000511996KMT2Achr11

118355501

+AFF1chr4

87977475

+
intron-intronENST00000534358ENST00000395146KMT2Achr11

118355579

+AFF1chr4

87995374

+
intron-intronENST00000534358ENST00000307808KMT2Achr11

118355579

+AFF1chr4

87995374

+
intron-intronENST00000534358ENST00000544085KMT2Achr11

118355579

+AFF1chr4

87995374

+
intron-intronENST00000534358ENST00000511996KMT2Achr11

118355579

+AFF1chr4

87995374

+
intron-intronENST00000389506ENST00000395146KMT2Achr11

118355579

+AFF1chr4

87995374

+
intron-intronENST00000389506ENST00000307808KMT2Achr11

118355579

+AFF1chr4

87995374

+
intron-intronENST00000389506ENST00000544085KMT2Achr11

118355579

+AFF1chr4

87995374

+
intron-intronENST00000389506ENST00000511996KMT2Achr11

118355579

+AFF1chr4

87995374

+
intron-intronENST00000354520ENST00000395146KMT2Achr11

118355579

+AFF1chr4

87995374

+
intron-intronENST00000354520ENST00000307808KMT2Achr11

118355579

+AFF1chr4

87995374

+
intron-intronENST00000354520ENST00000544085KMT2Achr11

118355579

+AFF1chr4

87995374

+
intron-intronENST00000354520ENST00000511996KMT2Achr11

118355579

+AFF1chr4

87995374

+
intron-intronENST00000420751ENST00000395146KMT2Achr11

118355579

+AFF1chr4

87995374

+
intron-intronENST00000420751ENST00000307808KMT2Achr11

118355579

+AFF1chr4

87995374

+
intron-intronENST00000420751ENST00000544085KMT2Achr11

118355579

+AFF1chr4

87995374

+
intron-intronENST00000420751ENST00000511996KMT2Achr11

118355579

+AFF1chr4

87995374

+
5CDS-intronENST00000534358ENST00000395146KMT2Achr11

118355010

+AFF1chr4

87995281

+
5CDS-intronENST00000534358ENST00000307808KMT2Achr11

118355010

+AFF1chr4

87995281

+
5CDS-intronENST00000534358ENST00000544085KMT2Achr11

118355010

+AFF1chr4

87995281

+
5CDS-intronENST00000534358ENST00000511996KMT2Achr11

118355010

+AFF1chr4

87995281

+
5CDS-intronENST00000389506ENST00000395146KMT2Achr11

118355010

+AFF1chr4

87995281

+
5CDS-intronENST00000389506ENST00000307808KMT2Achr11

118355010

+AFF1chr4

87995281

+
5CDS-intronENST00000389506ENST00000544085KMT2Achr11

118355010

+AFF1chr4

87995281

+
5CDS-intronENST00000389506ENST00000511996KMT2Achr11

118355010

+AFF1chr4

87995281

+
5CDS-intronENST00000354520ENST00000395146KMT2Achr11

118355010

+AFF1chr4

87995281

+
5CDS-intronENST00000354520ENST00000307808KMT2Achr11

118355010

+AFF1chr4

87995281

+
5CDS-intronENST00000354520ENST00000544085KMT2Achr11

118355010

+AFF1chr4

87995281

+
5CDS-intronENST00000354520ENST00000511996KMT2Achr11

118355010

+AFF1chr4

87995281

+
3UTR-intronENST00000420751ENST00000395146KMT2Achr11

118355010

+AFF1chr4

87995281

+
3UTR-intronENST00000420751ENST00000307808KMT2Achr11

118355010

+AFF1chr4

87995281

+
3UTR-intronENST00000420751ENST00000544085KMT2Achr11

118355010

+AFF1chr4

87995281

+
3UTR-intronENST00000420751ENST00000511996KMT2Achr11

118355010

+AFF1chr4

87995281

+
In-frameENST00000534358ENST00000395146KMT2Achr11

118359475

+AFF1chr4

88005270

+
In-frameENST00000534358ENST00000307808KMT2Achr11

118359475

+AFF1chr4

88005270

+
5CDS-5UTRENST00000534358ENST00000544085KMT2Achr11

118359475

+AFF1chr4

88005270

+
5CDS-intronENST00000534358ENST00000511996KMT2Achr11

118359475

+AFF1chr4

88005270

+
In-frameENST00000389506ENST00000395146KMT2Achr11

118359475

+AFF1chr4

88005270

+
In-frameENST00000389506ENST00000307808KMT2Achr11

118359475

+AFF1chr4

88005270

+
5CDS-5UTRENST00000389506ENST00000544085KMT2Achr11

118359475

+AFF1chr4

88005270

+
5CDS-intronENST00000389506ENST00000511996KMT2Achr11

118359475

+AFF1chr4

88005270

+
In-frameENST00000354520ENST00000395146KMT2Achr11

118359475

+AFF1chr4

88005270

+
In-frameENST00000354520ENST00000307808KMT2Achr11

118359475

+AFF1chr4

88005270

+
5CDS-5UTRENST00000354520ENST00000544085KMT2Achr11

118359475

+AFF1chr4

88005270

+
5CDS-intronENST00000354520ENST00000511996KMT2Achr11

118359475

+AFF1chr4

88005270

+
intron-3CDSENST00000420751ENST00000395146KMT2Achr11

118359475

+AFF1chr4

88005270

+
intron-3CDSENST00000420751ENST00000307808KMT2Achr11

118359475

+AFF1chr4

88005270

+
intron-5UTRENST00000420751ENST00000544085KMT2Achr11

118359475

+AFF1chr4

88005270

+
intron-intronENST00000420751ENST00000511996KMT2Achr11

118359475

+AFF1chr4

88005270

+

Top

FusionProtFeatures for KMT2A_AFF1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
KMT2A

Q03164

AFF1

P51825


check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneKMT2Achr11:118353210chr4:88005270ENST00000354520+835137_14313623932Compositional biasNote=Poly-Gly
HgeneKMT2Achr11:118353210chr4:88005270ENST00000354520+83517_10213623932Compositional biasNote=Ala/Gly/Ser-rich
HgeneKMT2Achr11:118353210chr4:88005270ENST00000354520+835561_56413623932Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118353210chr4:88005270ENST00000354520+835568_57113623932Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118353210chr4:88005270ENST00000389506+836137_14313623970Compositional biasNote=Poly-Gly
HgeneKMT2Achr11:118353210chr4:88005270ENST00000389506+83617_10213623970Compositional biasNote=Ala/Gly/Ser-rich
HgeneKMT2Achr11:118353210chr4:88005270ENST00000389506+836561_56413623970Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118353210chr4:88005270ENST00000389506+836568_57113623970Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118353210chr4:88005270ENST00000534358+836137_14313623973Compositional biasNote=Poly-Gly
HgeneKMT2Achr11:118353210chr4:88005270ENST00000534358+83617_10213623973Compositional biasNote=Ala/Gly/Ser-rich
HgeneKMT2Achr11:118353210chr4:88005270ENST00000534358+836561_56413623973Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118353210chr4:88005270ENST00000534358+836568_57113623973Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118353211chr4:88011134ENST00000354520+835137_14313623932Compositional biasNote=Poly-Gly
HgeneKMT2Achr11:118353211chr4:88011134ENST00000354520+83517_10213623932Compositional biasNote=Ala/Gly/Ser-rich
HgeneKMT2Achr11:118353211chr4:88011134ENST00000354520+835561_56413623932Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118353211chr4:88011134ENST00000354520+835568_57113623932Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118353211chr4:88011134ENST00000389506+836137_14313623970Compositional biasNote=Poly-Gly
HgeneKMT2Achr11:118353211chr4:88011134ENST00000389506+83617_10213623970Compositional biasNote=Ala/Gly/Ser-rich
HgeneKMT2Achr11:118353211chr4:88011134ENST00000389506+836561_56413623970Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118353211chr4:88011134ENST00000389506+836568_57113623970Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118353211chr4:88011134ENST00000534358+836137_14313623973Compositional biasNote=Poly-Gly
HgeneKMT2Achr11:118353211chr4:88011134ENST00000534358+83617_10213623973Compositional biasNote=Ala/Gly/Ser-rich
HgeneKMT2Achr11:118353211chr4:88011134ENST00000534358+836561_56413623973Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118353211chr4:88011134ENST00000534358+836568_57113623973Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118353211chr4:88012943ENST00000354520+835137_14313623932Compositional biasNote=Poly-Gly
HgeneKMT2Achr11:118353211chr4:88012943ENST00000354520+83517_10213623932Compositional biasNote=Ala/Gly/Ser-rich
HgeneKMT2Achr11:118353211chr4:88012943ENST00000354520+835561_56413623932Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118353211chr4:88012943ENST00000354520+835568_57113623932Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118353211chr4:88012943ENST00000389506+836137_14313623970Compositional biasNote=Poly-Gly
HgeneKMT2Achr11:118353211chr4:88012943ENST00000389506+83617_10213623970Compositional biasNote=Ala/Gly/Ser-rich
HgeneKMT2Achr11:118353211chr4:88012943ENST00000389506+836561_56413623970Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118353211chr4:88012943ENST00000389506+836568_57113623970Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118353211chr4:88012943ENST00000534358+836137_14313623973Compositional biasNote=Poly-Gly
HgeneKMT2Achr11:118353211chr4:88012943ENST00000534358+83617_10213623973Compositional biasNote=Ala/Gly/Ser-rich
HgeneKMT2Achr11:118353211chr4:88012943ENST00000534358+836561_56413623973Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118353211chr4:88012943ENST00000534358+836568_57113623973Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118355690chr4:88005270ENST00000389506+1036137_14314443970Compositional biasNote=Poly-Gly
HgeneKMT2Achr11:118355690chr4:88005270ENST00000389506+103617_10214443970Compositional biasNote=Ala/Gly/Ser-rich
HgeneKMT2Achr11:118355690chr4:88005270ENST00000389506+1036561_56414443970Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118355690chr4:88005270ENST00000389506+1036568_57114443970Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118355690chr4:88005270ENST00000534358+1036137_14314443973Compositional biasNote=Poly-Gly
HgeneKMT2Achr11:118355690chr4:88005270ENST00000534358+103617_10214443973Compositional biasNote=Ala/Gly/Ser-rich
HgeneKMT2Achr11:118355690chr4:88005270ENST00000534358+1036561_56414443973Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118355690chr4:88005270ENST00000534358+1036568_57114443973Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118359475chr4:88005270ENST00000354520+1035137_14314553932Compositional biasNote=Poly-Gly
HgeneKMT2Achr11:118359475chr4:88005270ENST00000354520+103517_10214553932Compositional biasNote=Ala/Gly/Ser-rich
HgeneKMT2Achr11:118359475chr4:88005270ENST00000354520+1035561_56414553932Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118359475chr4:88005270ENST00000354520+1035568_57114553932Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118359475chr4:88005270ENST00000389506+1136137_14314933970Compositional biasNote=Poly-Gly
HgeneKMT2Achr11:118359475chr4:88005270ENST00000389506+113617_10214933970Compositional biasNote=Ala/Gly/Ser-rich
HgeneKMT2Achr11:118359475chr4:88005270ENST00000389506+1136561_56414933970Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118359475chr4:88005270ENST00000389506+1136568_57114933970Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118359475chr4:88005270ENST00000534358+1136137_14314933973Compositional biasNote=Poly-Gly
HgeneKMT2Achr11:118359475chr4:88005270ENST00000534358+113617_10214933973Compositional biasNote=Ala/Gly/Ser-rich
HgeneKMT2Achr11:118359475chr4:88005270ENST00000534358+1136561_56414933973Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118359475chr4:88005270ENST00000534358+1136568_57114933973Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118353210chr4:88005270ENST00000354520+835169_18013623932DNA bindingNote=A.T hook 1
HgeneKMT2Achr11:118353210chr4:88005270ENST00000354520+835217_22713623932DNA bindingNote=A.T hook 2
HgeneKMT2Achr11:118353210chr4:88005270ENST00000354520+835301_30913623932DNA bindingNote=A.T hook 3
HgeneKMT2Achr11:118353210chr4:88005270ENST00000389506+836169_18013623970DNA bindingNote=A.T hook 1
HgeneKMT2Achr11:118353210chr4:88005270ENST00000389506+836217_22713623970DNA bindingNote=A.T hook 2
HgeneKMT2Achr11:118353210chr4:88005270ENST00000389506+836301_30913623970DNA bindingNote=A.T hook 3
HgeneKMT2Achr11:118353210chr4:88005270ENST00000534358+836169_18013623973DNA bindingNote=A.T hook 1
HgeneKMT2Achr11:118353210chr4:88005270ENST00000534358+836217_22713623973DNA bindingNote=A.T hook 2
HgeneKMT2Achr11:118353210chr4:88005270ENST00000534358+836301_30913623973DNA bindingNote=A.T hook 3
HgeneKMT2Achr11:118353211chr4:88011134ENST00000354520+835169_18013623932DNA bindingNote=A.T hook 1
HgeneKMT2Achr11:118353211chr4:88011134ENST00000354520+835217_22713623932DNA bindingNote=A.T hook 2
HgeneKMT2Achr11:118353211chr4:88011134ENST00000354520+835301_30913623932DNA bindingNote=A.T hook 3
HgeneKMT2Achr11:118353211chr4:88011134ENST00000389506+836169_18013623970DNA bindingNote=A.T hook 1
HgeneKMT2Achr11:118353211chr4:88011134ENST00000389506+836217_22713623970DNA bindingNote=A.T hook 2
HgeneKMT2Achr11:118353211chr4:88011134ENST00000389506+836301_30913623970DNA bindingNote=A.T hook 3
HgeneKMT2Achr11:118353211chr4:88011134ENST00000534358+836169_18013623973DNA bindingNote=A.T hook 1
HgeneKMT2Achr11:118353211chr4:88011134ENST00000534358+836217_22713623973DNA bindingNote=A.T hook 2
HgeneKMT2Achr11:118353211chr4:88011134ENST00000534358+836301_30913623973DNA bindingNote=A.T hook 3
HgeneKMT2Achr11:118353211chr4:88012943ENST00000354520+835169_18013623932DNA bindingNote=A.T hook 1
HgeneKMT2Achr11:118353211chr4:88012943ENST00000354520+835217_22713623932DNA bindingNote=A.T hook 2
HgeneKMT2Achr11:118353211chr4:88012943ENST00000354520+835301_30913623932DNA bindingNote=A.T hook 3
HgeneKMT2Achr11:118353211chr4:88012943ENST00000389506+836169_18013623970DNA bindingNote=A.T hook 1
HgeneKMT2Achr11:118353211chr4:88012943ENST00000389506+836217_22713623970DNA bindingNote=A.T hook 2
HgeneKMT2Achr11:118353211chr4:88012943ENST00000389506+836301_30913623970DNA bindingNote=A.T hook 3
HgeneKMT2Achr11:118353211chr4:88012943ENST00000534358+836169_18013623973DNA bindingNote=A.T hook 1
HgeneKMT2Achr11:118353211chr4:88012943ENST00000534358+836217_22713623973DNA bindingNote=A.T hook 2
HgeneKMT2Achr11:118353211chr4:88012943ENST00000534358+836301_30913623973DNA bindingNote=A.T hook 3
HgeneKMT2Achr11:118355690chr4:88005270ENST00000389506+1036169_18014443970DNA bindingNote=A.T hook 1
HgeneKMT2Achr11:118355690chr4:88005270ENST00000389506+1036217_22714443970DNA bindingNote=A.T hook 2
HgeneKMT2Achr11:118355690chr4:88005270ENST00000389506+1036301_30914443970DNA bindingNote=A.T hook 3
HgeneKMT2Achr11:118355690chr4:88005270ENST00000534358+1036169_18014443973DNA bindingNote=A.T hook 1
HgeneKMT2Achr11:118355690chr4:88005270ENST00000534358+1036217_22714443973DNA bindingNote=A.T hook 2
HgeneKMT2Achr11:118355690chr4:88005270ENST00000534358+1036301_30914443973DNA bindingNote=A.T hook 3
HgeneKMT2Achr11:118359475chr4:88005270ENST00000354520+1035169_18014553932DNA bindingNote=A.T hook 1
HgeneKMT2Achr11:118359475chr4:88005270ENST00000354520+1035217_22714553932DNA bindingNote=A.T hook 2
HgeneKMT2Achr11:118359475chr4:88005270ENST00000354520+1035301_30914553932DNA bindingNote=A.T hook 3
HgeneKMT2Achr11:118359475chr4:88005270ENST00000389506+1136169_18014933970DNA bindingNote=A.T hook 1
HgeneKMT2Achr11:118359475chr4:88005270ENST00000389506+1136217_22714933970DNA bindingNote=A.T hook 2
HgeneKMT2Achr11:118359475chr4:88005270ENST00000389506+1136301_30914933970DNA bindingNote=A.T hook 3
HgeneKMT2Achr11:118359475chr4:88005270ENST00000534358+1136169_18014933973DNA bindingNote=A.T hook 1
HgeneKMT2Achr11:118359475chr4:88005270ENST00000534358+1136217_22714933973DNA bindingNote=A.T hook 2
HgeneKMT2Achr11:118359475chr4:88005270ENST00000534358+1136301_30914933973DNA bindingNote=A.T hook 3
HgeneKMT2Achr11:118353210chr4:88005270ENST00000354520+8351147_119513623932Zinc fingerCXXC-type
HgeneKMT2Achr11:118353210chr4:88005270ENST00000389506+8361147_119513623970Zinc fingerCXXC-type
HgeneKMT2Achr11:118353210chr4:88005270ENST00000534358+8361147_119513623973Zinc fingerCXXC-type
HgeneKMT2Achr11:118353211chr4:88011134ENST00000354520+8351147_119513623932Zinc fingerCXXC-type
HgeneKMT2Achr11:118353211chr4:88011134ENST00000389506+8361147_119513623970Zinc fingerCXXC-type
HgeneKMT2Achr11:118353211chr4:88011134ENST00000534358+8361147_119513623973Zinc fingerCXXC-type
HgeneKMT2Achr11:118353211chr4:88012943ENST00000354520+8351147_119513623932Zinc fingerCXXC-type
HgeneKMT2Achr11:118353211chr4:88012943ENST00000389506+8361147_119513623970Zinc fingerCXXC-type
HgeneKMT2Achr11:118353211chr4:88012943ENST00000534358+8361147_119513623973Zinc fingerCXXC-type
HgeneKMT2Achr11:118355690chr4:88005270ENST00000389506+10361147_119514443970Zinc fingerCXXC-type
HgeneKMT2Achr11:118355690chr4:88005270ENST00000534358+10361147_119514443973Zinc fingerCXXC-type
HgeneKMT2Achr11:118359475chr4:88005270ENST00000354520+10351147_119514553932Zinc fingerCXXC-type
HgeneKMT2Achr11:118359475chr4:88005270ENST00000389506+11361147_119514933970Zinc fingerCXXC-type
HgeneKMT2Achr11:118359475chr4:88005270ENST00000389506+11361431_148214933970Zinc fingerPHD-type 1
HgeneKMT2Achr11:118359475chr4:88005270ENST00000534358+11361147_119514933973Zinc fingerCXXC-type
HgeneKMT2Achr11:118359475chr4:88005270ENST00000534358+11361431_148214933973Zinc fingerPHD-type 1
TgeneAFF1chr11:118353210chr4:88005270ENST00000307808+220483_4923461211Compositional biasNote=Poly-Ser
TgeneAFF1chr11:118353210chr4:88005270ENST00000307808+220835_8433461211Compositional biasNote=Poly-Ser
TgeneAFF1chr11:118353210chr4:88005270ENST00000307808+220866_8693461211Compositional biasNote=Poly-Pro
TgeneAFF1chr11:118353210chr4:88005270ENST00000307808+220871_8743461211Compositional biasNote=Poly-Ser
TgeneAFF1chr11:118353210chr4:88005270ENST00000395146+321483_4923531219Compositional biasNote=Poly-Ser
TgeneAFF1chr11:118353210chr4:88005270ENST00000395146+321835_8433531219Compositional biasNote=Poly-Ser
TgeneAFF1chr11:118353210chr4:88005270ENST00000395146+321866_8693531219Compositional biasNote=Poly-Pro
TgeneAFF1chr11:118353210chr4:88005270ENST00000395146+321871_8743531219Compositional biasNote=Poly-Ser
TgeneAFF1chr11:118353211chr4:88011134ENST00000307808+320483_4923611211Compositional biasNote=Poly-Ser
TgeneAFF1chr11:118353211chr4:88011134ENST00000307808+320835_8433611211Compositional biasNote=Poly-Ser
TgeneAFF1chr11:118353211chr4:88011134ENST00000307808+320866_8693611211Compositional biasNote=Poly-Pro
TgeneAFF1chr11:118353211chr4:88011134ENST00000307808+320871_8743611211Compositional biasNote=Poly-Ser
TgeneAFF1chr11:118353211chr4:88011134ENST00000395146+421483_4923681219Compositional biasNote=Poly-Ser
TgeneAFF1chr11:118353211chr4:88011134ENST00000395146+421835_8433681219Compositional biasNote=Poly-Ser
TgeneAFF1chr11:118353211chr4:88011134ENST00000395146+421866_8693681219Compositional biasNote=Poly-Pro
TgeneAFF1chr11:118353211chr4:88011134ENST00000395146+421871_8743681219Compositional biasNote=Poly-Ser
TgeneAFF1chr11:118353211chr4:88012943ENST00000307808+420483_4923901211Compositional biasNote=Poly-Ser
TgeneAFF1chr11:118353211chr4:88012943ENST00000307808+420835_8433901211Compositional biasNote=Poly-Ser
TgeneAFF1chr11:118353211chr4:88012943ENST00000307808+420866_8693901211Compositional biasNote=Poly-Pro
TgeneAFF1chr11:118353211chr4:88012943ENST00000307808+420871_8743901211Compositional biasNote=Poly-Ser
TgeneAFF1chr11:118353211chr4:88012943ENST00000395146+521483_4923971219Compositional biasNote=Poly-Ser
TgeneAFF1chr11:118353211chr4:88012943ENST00000395146+521835_8433971219Compositional biasNote=Poly-Ser
TgeneAFF1chr11:118353211chr4:88012943ENST00000395146+521866_8693971219Compositional biasNote=Poly-Pro
TgeneAFF1chr11:118353211chr4:88012943ENST00000395146+521871_8743971219Compositional biasNote=Poly-Ser
TgeneAFF1chr11:118355622chr4:87968221ENST00000307808+020483_492-1401211Compositional biasNote=Poly-Ser
TgeneAFF1chr11:118355622chr4:87968221ENST00000307808+020835_843-1401211Compositional biasNote=Poly-Ser
TgeneAFF1chr11:118355622chr4:87968221ENST00000307808+020866_869-1401211Compositional biasNote=Poly-Pro
TgeneAFF1chr11:118355622chr4:87968221ENST00000307808+020871_874-1401211Compositional biasNote=Poly-Ser
TgeneAFF1chr11:118355622chr4:87968221ENST00000395146+021483_492-921219Compositional biasNote=Poly-Ser
TgeneAFF1chr11:118355622chr4:87968221ENST00000395146+021835_843-921219Compositional biasNote=Poly-Ser
TgeneAFF1chr11:118355622chr4:87968221ENST00000395146+021866_869-921219Compositional biasNote=Poly-Pro
TgeneAFF1chr11:118355622chr4:87968221ENST00000395146+021871_874-921219Compositional biasNote=Poly-Ser
TgeneAFF1chr11:118355690chr4:88005270ENST00000307808+220483_4923461211Compositional biasNote=Poly-Ser
TgeneAFF1chr11:118355690chr4:88005270ENST00000307808+220835_8433461211Compositional biasNote=Poly-Ser
TgeneAFF1chr11:118355690chr4:88005270ENST00000307808+220866_8693461211Compositional biasNote=Poly-Pro
TgeneAFF1chr11:118355690chr4:88005270ENST00000307808+220871_8743461211Compositional biasNote=Poly-Ser
TgeneAFF1chr11:118355690chr4:88005270ENST00000395146+321483_4923531219Compositional biasNote=Poly-Ser
TgeneAFF1chr11:118355690chr4:88005270ENST00000395146+321835_8433531219Compositional biasNote=Poly-Ser
TgeneAFF1chr11:118355690chr4:88005270ENST00000395146+321866_8693531219Compositional biasNote=Poly-Pro
TgeneAFF1chr11:118355690chr4:88005270ENST00000395146+321871_8743531219Compositional biasNote=Poly-Ser
TgeneAFF1chr11:118359475chr4:88005270ENST00000307808+220483_4923461211Compositional biasNote=Poly-Ser
TgeneAFF1chr11:118359475chr4:88005270ENST00000307808+220835_8433461211Compositional biasNote=Poly-Ser
TgeneAFF1chr11:118359475chr4:88005270ENST00000307808+220866_8693461211Compositional biasNote=Poly-Pro
TgeneAFF1chr11:118359475chr4:88005270ENST00000307808+220871_8743461211Compositional biasNote=Poly-Ser
TgeneAFF1chr11:118359475chr4:88005270ENST00000395146+321483_4923531219Compositional biasNote=Poly-Ser
TgeneAFF1chr11:118359475chr4:88005270ENST00000395146+321835_8433531219Compositional biasNote=Poly-Ser
TgeneAFF1chr11:118359475chr4:88005270ENST00000395146+321866_8693531219Compositional biasNote=Poly-Pro
TgeneAFF1chr11:118359475chr4:88005270ENST00000395146+321871_8743531219Compositional biasNote=Poly-Ser

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneKMT2Achr11:118355622chr4:87968221ENST00000354520+135137_14303932Compositional biasNote=Poly-Gly
HgeneKMT2Achr11:118355622chr4:87968221ENST00000354520+13517_10203932Compositional biasNote=Ala/Gly/Ser-rich
HgeneKMT2Achr11:118355622chr4:87968221ENST00000354520+135561_56403932Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118355622chr4:87968221ENST00000354520+135568_57103932Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118355622chr4:87968221ENST00000389506+136137_14303970Compositional biasNote=Poly-Gly
HgeneKMT2Achr11:118355622chr4:87968221ENST00000389506+13617_10203970Compositional biasNote=Ala/Gly/Ser-rich
HgeneKMT2Achr11:118355622chr4:87968221ENST00000389506+136561_56403970Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118355622chr4:87968221ENST00000389506+136568_57103970Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118355622chr4:87968221ENST00000534358+136137_143-83973Compositional biasNote=Poly-Gly
HgeneKMT2Achr11:118355622chr4:87968221ENST00000534358+13617_102-83973Compositional biasNote=Ala/Gly/Ser-rich
HgeneKMT2Achr11:118355622chr4:87968221ENST00000534358+136561_564-83973Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118355622chr4:87968221ENST00000534358+136568_571-83973Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118355690chr4:88005270ENST00000354520+135137_14303932Compositional biasNote=Poly-Gly
HgeneKMT2Achr11:118355690chr4:88005270ENST00000354520+13517_10203932Compositional biasNote=Ala/Gly/Ser-rich
HgeneKMT2Achr11:118355690chr4:88005270ENST00000354520+135561_56403932Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118355690chr4:88005270ENST00000354520+135568_57103932Compositional biasNote=Poly-Pro
HgeneKMT2Achr11:118355622chr4:87968221ENST00000354520+135169_18003932DNA bindingNote=A.T hook 1
HgeneKMT2Achr11:118355622chr4:87968221ENST00000354520+135217_22703932DNA bindingNote=A.T hook 2
HgeneKMT2Achr11:118355622chr4:87968221ENST00000354520+135301_30903932DNA bindingNote=A.T hook 3
HgeneKMT2Achr11:118355622chr4:87968221ENST00000389506+136169_18003970DNA bindingNote=A.T hook 1
HgeneKMT2Achr11:118355622chr4:87968221ENST00000389506+136217_22703970DNA bindingNote=A.T hook 2
HgeneKMT2Achr11:118355622chr4:87968221ENST00000389506+136301_30903970DNA bindingNote=A.T hook 3
HgeneKMT2Achr11:118355622chr4:87968221ENST00000534358+136169_180-83973DNA bindingNote=A.T hook 1
HgeneKMT2Achr11:118355622chr4:87968221ENST00000534358+136217_227-83973DNA bindingNote=A.T hook 2
HgeneKMT2Achr11:118355622chr4:87968221ENST00000534358+136301_309-83973DNA bindingNote=A.T hook 3
HgeneKMT2Achr11:118355690chr4:88005270ENST00000354520+135169_18003932DNA bindingNote=A.T hook 1
HgeneKMT2Achr11:118355690chr4:88005270ENST00000354520+135217_22703932DNA bindingNote=A.T hook 2
HgeneKMT2Achr11:118355690chr4:88005270ENST00000354520+135301_30903932DNA bindingNote=A.T hook 3
HgeneKMT2Achr11:118353210chr4:88005270ENST00000354520+8351703_174813623932DomainBromo%3B divergent
HgeneKMT2Achr11:118353210chr4:88005270ENST00000354520+8352018_207413623932DomainFYR N-terminal
HgeneKMT2Achr11:118353210chr4:88005270ENST00000354520+8353666_374713623932DomainFYR C-terminal
HgeneKMT2Achr11:118353210chr4:88005270ENST00000354520+8353829_394513623932DomainSET
HgeneKMT2Achr11:118353210chr4:88005270ENST00000354520+8353953_396913623932DomainPost-SET
HgeneKMT2Achr11:118353210chr4:88005270ENST00000389506+8361703_174813623970DomainBromo%3B divergent
HgeneKMT2Achr11:118353210chr4:88005270ENST00000389506+8362018_207413623970DomainFYR N-terminal
HgeneKMT2Achr11:118353210chr4:88005270ENST00000389506+8363666_374713623970DomainFYR C-terminal
HgeneKMT2Achr11:118353210chr4:88005270ENST00000389506+8363829_394513623970DomainSET
HgeneKMT2Achr11:118353210chr4:88005270ENST00000389506+8363953_396913623970DomainPost-SET
HgeneKMT2Achr11:118353210chr4:88005270ENST00000534358+8361703_174813623973DomainBromo%3B divergent
HgeneKMT2Achr11:118353210chr4:88005270ENST00000534358+8362018_207413623973DomainFYR N-terminal
HgeneKMT2Achr11:118353210chr4:88005270ENST00000534358+8363666_374713623973DomainFYR C-terminal
HgeneKMT2Achr11:118353210chr4:88005270ENST00000534358+8363829_394513623973DomainSET
HgeneKMT2Achr11:118353210chr4:88005270ENST00000534358+8363953_396913623973DomainPost-SET
HgeneKMT2Achr11:118353211chr4:88011134ENST00000354520+8351703_174813623932DomainBromo%3B divergent
HgeneKMT2Achr11:118353211chr4:88011134ENST00000354520+8352018_207413623932DomainFYR N-terminal
HgeneKMT2Achr11:118353211chr4:88011134ENST00000354520+8353666_374713623932DomainFYR C-terminal
HgeneKMT2Achr11:118353211chr4:88011134ENST00000354520+8353829_394513623932DomainSET
HgeneKMT2Achr11:118353211chr4:88011134ENST00000354520+8353953_396913623932DomainPost-SET
HgeneKMT2Achr11:118353211chr4:88011134ENST00000389506+8361703_174813623970DomainBromo%3B divergent
HgeneKMT2Achr11:118353211chr4:88011134ENST00000389506+8362018_207413623970DomainFYR N-terminal
HgeneKMT2Achr11:118353211chr4:88011134ENST00000389506+8363666_374713623970DomainFYR C-terminal
HgeneKMT2Achr11:118353211chr4:88011134ENST00000389506+8363829_394513623970DomainSET
HgeneKMT2Achr11:118353211chr4:88011134ENST00000389506+8363953_396913623970DomainPost-SET
HgeneKMT2Achr11:118353211chr4:88011134ENST00000534358+8361703_174813623973DomainBromo%3B divergent
HgeneKMT2Achr11:118353211chr4:88011134ENST00000534358+8362018_207413623973DomainFYR N-terminal
HgeneKMT2Achr11:118353211chr4:88011134ENST00000534358+8363666_374713623973DomainFYR C-terminal
HgeneKMT2Achr11:118353211chr4:88011134ENST00000534358+8363829_394513623973DomainSET
HgeneKMT2Achr11:118353211chr4:88011134ENST00000534358+8363953_396913623973DomainPost-SET
HgeneKMT2Achr11:118353211chr4:88012943ENST00000354520+8351703_174813623932DomainBromo%3B divergent
HgeneKMT2Achr11:118353211chr4:88012943ENST00000354520+8352018_207413623932DomainFYR N-terminal
HgeneKMT2Achr11:118353211chr4:88012943ENST00000354520+8353666_374713623932DomainFYR C-terminal
HgeneKMT2Achr11:118353211chr4:88012943ENST00000354520+8353829_394513623932DomainSET
HgeneKMT2Achr11:118353211chr4:88012943ENST00000354520+8353953_396913623932DomainPost-SET
HgeneKMT2Achr11:118353211chr4:88012943ENST00000389506+8361703_174813623970DomainBromo%3B divergent
HgeneKMT2Achr11:118353211chr4:88012943ENST00000389506+8362018_207413623970DomainFYR N-terminal
HgeneKMT2Achr11:118353211chr4:88012943ENST00000389506+8363666_374713623970DomainFYR C-terminal
HgeneKMT2Achr11:118353211chr4:88012943ENST00000389506+8363829_394513623970DomainSET
HgeneKMT2Achr11:118353211chr4:88012943ENST00000389506+8363953_396913623970DomainPost-SET
HgeneKMT2Achr11:118353211chr4:88012943ENST00000534358+8361703_174813623973DomainBromo%3B divergent
HgeneKMT2Achr11:118353211chr4:88012943ENST00000534358+8362018_207413623973DomainFYR N-terminal
HgeneKMT2Achr11:118353211chr4:88012943ENST00000534358+8363666_374713623973DomainFYR C-terminal
HgeneKMT2Achr11:118353211chr4:88012943ENST00000534358+8363829_394513623973DomainSET
HgeneKMT2Achr11:118353211chr4:88012943ENST00000534358+8363953_396913623973DomainPost-SET
HgeneKMT2Achr11:118355622chr4:87968221ENST00000354520+1351703_174803932DomainBromo%3B divergent
HgeneKMT2Achr11:118355622chr4:87968221ENST00000354520+1352018_207403932DomainFYR N-terminal
HgeneKMT2Achr11:118355622chr4:87968221ENST00000354520+1353666_374703932DomainFYR C-terminal
HgeneKMT2Achr11:118355622chr4:87968221ENST00000354520+1353829_394503932DomainSET
HgeneKMT2Achr11:118355622chr4:87968221ENST00000354520+1353953_396903932DomainPost-SET
HgeneKMT2Achr11:118355622chr4:87968221ENST00000389506+1361703_174803970DomainBromo%3B divergent
HgeneKMT2Achr11:118355622chr4:87968221ENST00000389506+1362018_207403970DomainFYR N-terminal
HgeneKMT2Achr11:118355622chr4:87968221ENST00000389506+1363666_374703970DomainFYR C-terminal
HgeneKMT2Achr11:118355622chr4:87968221ENST00000389506+1363829_394503970DomainSET
HgeneKMT2Achr11:118355622chr4:87968221ENST00000389506+1363953_396903970DomainPost-SET
HgeneKMT2Achr11:118355622chr4:87968221ENST00000534358+1361703_1748-83973DomainBromo%3B divergent
HgeneKMT2Achr11:118355622chr4:87968221ENST00000534358+1362018_2074-83973DomainFYR N-terminal
HgeneKMT2Achr11:118355622chr4:87968221ENST00000534358+1363666_3747-83973DomainFYR C-terminal
HgeneKMT2Achr11:118355622chr4:87968221ENST00000534358+1363829_3945-83973DomainSET
HgeneKMT2Achr11:118355622chr4:87968221ENST00000534358+1363953_3969-83973DomainPost-SET
HgeneKMT2Achr11:118355690chr4:88005270ENST00000354520+1351703_174803932DomainBromo%3B divergent
HgeneKMT2Achr11:118355690chr4:88005270ENST00000354520+1352018_207403932DomainFYR N-terminal
HgeneKMT2Achr11:118355690chr4:88005270ENST00000354520+1353666_374703932DomainFYR C-terminal
HgeneKMT2Achr11:118355690chr4:88005270ENST00000354520+1353829_394503932DomainSET
HgeneKMT2Achr11:118355690chr4:88005270ENST00000354520+1353953_396903932DomainPost-SET
HgeneKMT2Achr11:118355690chr4:88005270ENST00000389506+10361703_174814443970DomainBromo%3B divergent
HgeneKMT2Achr11:118355690chr4:88005270ENST00000389506+10362018_207414443970DomainFYR N-terminal
HgeneKMT2Achr11:118355690chr4:88005270ENST00000389506+10363666_374714443970DomainFYR C-terminal
HgeneKMT2Achr11:118355690chr4:88005270ENST00000389506+10363829_394514443970DomainSET
HgeneKMT2Achr11:118355690chr4:88005270ENST00000389506+10363953_396914443970DomainPost-SET
HgeneKMT2Achr11:118355690chr4:88005270ENST00000534358+10361703_174814443973DomainBromo%3B divergent
HgeneKMT2Achr11:118355690chr4:88005270ENST00000534358+10362018_207414443973DomainFYR N-terminal
HgeneKMT2Achr11:118355690chr4:88005270ENST00000534358+10363666_374714443973DomainFYR C-terminal
HgeneKMT2Achr11:118355690chr4:88005270ENST00000534358+10363829_394514443973DomainSET
HgeneKMT2Achr11:118355690chr4:88005270ENST00000534358+10363953_396914443973DomainPost-SET
HgeneKMT2Achr11:118359475chr4:88005270ENST00000354520+10351703_174814553932DomainBromo%3B divergent
HgeneKMT2Achr11:118359475chr4:88005270ENST00000354520+10352018_207414553932DomainFYR N-terminal
HgeneKMT2Achr11:118359475chr4:88005270ENST00000354520+10353666_374714553932DomainFYR C-terminal
HgeneKMT2Achr11:118359475chr4:88005270ENST00000354520+10353829_394514553932DomainSET
HgeneKMT2Achr11:118359475chr4:88005270ENST00000354520+10353953_396914553932DomainPost-SET
HgeneKMT2Achr11:118359475chr4:88005270ENST00000389506+11361703_174814933970DomainBromo%3B divergent
HgeneKMT2Achr11:118359475chr4:88005270ENST00000389506+11362018_207414933970DomainFYR N-terminal
HgeneKMT2Achr11:118359475chr4:88005270ENST00000389506+11363666_374714933970DomainFYR C-terminal
HgeneKMT2Achr11:118359475chr4:88005270ENST00000389506+11363829_394514933970DomainSET
HgeneKMT2Achr11:118359475chr4:88005270ENST00000389506+11363953_396914933970DomainPost-SET
HgeneKMT2Achr11:118359475chr4:88005270ENST00000534358+11361703_174814933973DomainBromo%3B divergent
HgeneKMT2Achr11:118359475chr4:88005270ENST00000534358+11362018_207414933973DomainFYR N-terminal
HgeneKMT2Achr11:118359475chr4:88005270ENST00000534358+11363666_374714933973DomainFYR C-terminal
HgeneKMT2Achr11:118359475chr4:88005270ENST00000534358+11363829_394514933973DomainSET
HgeneKMT2Achr11:118359475chr4:88005270ENST00000534358+11363953_396914933973DomainPost-SET
HgeneKMT2Achr11:118353210chr4:88005270ENST00000354520+8353906_390713623932RegionS-adenosyl-L-methionine binding
HgeneKMT2Achr11:118353210chr4:88005270ENST00000389506+8363906_390713623970RegionS-adenosyl-L-methionine binding
HgeneKMT2Achr11:118353210chr4:88005270ENST00000534358+8363906_390713623973RegionS-adenosyl-L-methionine binding
HgeneKMT2Achr11:118353211chr4:88011134ENST00000354520+8353906_390713623932RegionS-adenosyl-L-methionine binding
HgeneKMT2Achr11:118353211chr4:88011134ENST00000389506+8363906_390713623970RegionS-adenosyl-L-methionine binding
HgeneKMT2Achr11:118353211chr4:88011134ENST00000534358+8363906_390713623973RegionS-adenosyl-L-methionine binding
HgeneKMT2Achr11:118353211chr4:88012943ENST00000354520+8353906_390713623932RegionS-adenosyl-L-methionine binding
HgeneKMT2Achr11:118353211chr4:88012943ENST00000389506+8363906_390713623970RegionS-adenosyl-L-methionine binding
HgeneKMT2Achr11:118353211chr4:88012943ENST00000534358+8363906_390713623973RegionS-adenosyl-L-methionine binding
HgeneKMT2Achr11:118355622chr4:87968221ENST00000354520+1353906_390703932RegionS-adenosyl-L-methionine binding
HgeneKMT2Achr11:118355622chr4:87968221ENST00000389506+1363906_390703970RegionS-adenosyl-L-methionine binding
HgeneKMT2Achr11:118355622chr4:87968221ENST00000534358+1363906_3907-83973RegionS-adenosyl-L-methionine binding
HgeneKMT2Achr11:118355690chr4:88005270ENST00000354520+1353906_390703932RegionS-adenosyl-L-methionine binding
HgeneKMT2Achr11:118355690chr4:88005270ENST00000389506+10363906_390714443970RegionS-adenosyl-L-methionine binding
HgeneKMT2Achr11:118355690chr4:88005270ENST00000534358+10363906_390714443973RegionS-adenosyl-L-methionine binding
HgeneKMT2Achr11:118359475chr4:88005270ENST00000354520+10353906_390714553932RegionS-adenosyl-L-methionine binding
HgeneKMT2Achr11:118359475chr4:88005270ENST00000389506+11363906_390714933970RegionS-adenosyl-L-methionine binding
HgeneKMT2Achr11:118359475chr4:88005270ENST00000534358+11363906_390714933973RegionS-adenosyl-L-methionine binding
HgeneKMT2Achr11:118353210chr4:88005270ENST00000354520+8351431_148213623932Zinc fingerPHD-type 1
HgeneKMT2Achr11:118353210chr4:88005270ENST00000354520+8351479_153313623932Zinc fingerPHD-type 2
HgeneKMT2Achr11:118353210chr4:88005270ENST00000354520+8351566_162713623932Zinc fingerPHD-type 3
HgeneKMT2Achr11:118353210chr4:88005270ENST00000354520+8351870_191013623932Zinc fingerC2HC pre-PHD-type
HgeneKMT2Achr11:118353210chr4:88005270ENST00000354520+8351931_197813623932Zinc fingerPHD-type 4
HgeneKMT2Achr11:118353210chr4:88005270ENST00000389506+8361431_148213623970Zinc fingerPHD-type 1
HgeneKMT2Achr11:118353210chr4:88005270ENST00000389506+8361479_153313623970Zinc fingerPHD-type 2
HgeneKMT2Achr11:118353210chr4:88005270ENST00000389506+8361566_162713623970Zinc fingerPHD-type 3
HgeneKMT2Achr11:118353210chr4:88005270ENST00000389506+8361870_191013623970Zinc fingerC2HC pre-PHD-type
HgeneKMT2Achr11:118353210chr4:88005270ENST00000389506+8361931_197813623970Zinc fingerPHD-type 4
HgeneKMT2Achr11:118353210chr4:88005270ENST00000534358+8361431_148213623973Zinc fingerPHD-type 1
HgeneKMT2Achr11:118353210chr4:88005270ENST00000534358+8361479_153313623973Zinc fingerPHD-type 2
HgeneKMT2Achr11:118353210chr4:88005270ENST00000534358+8361566_162713623973Zinc fingerPHD-type 3
HgeneKMT2Achr11:118353210chr4:88005270ENST00000534358+8361870_191013623973Zinc fingerC2HC pre-PHD-type
HgeneKMT2Achr11:118353210chr4:88005270ENST00000534358+8361931_197813623973Zinc fingerPHD-type 4
HgeneKMT2Achr11:118353211chr4:88011134ENST00000354520+8351431_148213623932Zinc fingerPHD-type 1
HgeneKMT2Achr11:118353211chr4:88011134ENST00000354520+8351479_153313623932Zinc fingerPHD-type 2
HgeneKMT2Achr11:118353211chr4:88011134ENST00000354520+8351566_162713623932Zinc fingerPHD-type 3
HgeneKMT2Achr11:118353211chr4:88011134ENST00000354520+8351870_191013623932Zinc fingerC2HC pre-PHD-type
HgeneKMT2Achr11:118353211chr4:88011134ENST00000354520+8351931_197813623932Zinc fingerPHD-type 4
HgeneKMT2Achr11:118353211chr4:88011134ENST00000389506+8361431_148213623970Zinc fingerPHD-type 1
HgeneKMT2Achr11:118353211chr4:88011134ENST00000389506+8361479_153313623970Zinc fingerPHD-type 2
HgeneKMT2Achr11:118353211chr4:88011134ENST00000389506+8361566_162713623970Zinc fingerPHD-type 3
HgeneKMT2Achr11:118353211chr4:88011134ENST00000389506+8361870_191013623970Zinc fingerC2HC pre-PHD-type
HgeneKMT2Achr11:118353211chr4:88011134ENST00000389506+8361931_197813623970Zinc fingerPHD-type 4
HgeneKMT2Achr11:118353211chr4:88011134ENST00000534358+8361431_148213623973Zinc fingerPHD-type 1
HgeneKMT2Achr11:118353211chr4:88011134ENST00000534358+8361479_153313623973Zinc fingerPHD-type 2
HgeneKMT2Achr11:118353211chr4:88011134ENST00000534358+8361566_162713623973Zinc fingerPHD-type 3
HgeneKMT2Achr11:118353211chr4:88011134ENST00000534358+8361870_191013623973Zinc fingerC2HC pre-PHD-type
HgeneKMT2Achr11:118353211chr4:88011134ENST00000534358+8361931_197813623973Zinc fingerPHD-type 4
HgeneKMT2Achr11:118353211chr4:88012943ENST00000354520+8351431_148213623932Zinc fingerPHD-type 1
HgeneKMT2Achr11:118353211chr4:88012943ENST00000354520+8351479_153313623932Zinc fingerPHD-type 2
HgeneKMT2Achr11:118353211chr4:88012943ENST00000354520+8351566_162713623932Zinc fingerPHD-type 3
HgeneKMT2Achr11:118353211chr4:88012943ENST00000354520+8351870_191013623932Zinc fingerC2HC pre-PHD-type
HgeneKMT2Achr11:118353211chr4:88012943ENST00000354520+8351931_197813623932Zinc fingerPHD-type 4
HgeneKMT2Achr11:118353211chr4:88012943ENST00000389506+8361431_148213623970Zinc fingerPHD-type 1
HgeneKMT2Achr11:118353211chr4:88012943ENST00000389506+8361479_153313623970Zinc fingerPHD-type 2
HgeneKMT2Achr11:118353211chr4:88012943ENST00000389506+8361566_162713623970Zinc fingerPHD-type 3
HgeneKMT2Achr11:118353211chr4:88012943ENST00000389506+8361870_191013623970Zinc fingerC2HC pre-PHD-type
HgeneKMT2Achr11:118353211chr4:88012943ENST00000389506+8361931_197813623970Zinc fingerPHD-type 4
HgeneKMT2Achr11:118353211chr4:88012943ENST00000534358+8361431_148213623973Zinc fingerPHD-type 1
HgeneKMT2Achr11:118353211chr4:88012943ENST00000534358+8361479_153313623973Zinc fingerPHD-type 2
HgeneKMT2Achr11:118353211chr4:88012943ENST00000534358+8361566_162713623973Zinc fingerPHD-type 3
HgeneKMT2Achr11:118353211chr4:88012943ENST00000534358+8361870_191013623973Zinc fingerC2HC pre-PHD-type
HgeneKMT2Achr11:118353211chr4:88012943ENST00000534358+8361931_197813623973Zinc fingerPHD-type 4
HgeneKMT2Achr11:118355622chr4:87968221ENST00000354520+1351147_119503932Zinc fingerCXXC-type
HgeneKMT2Achr11:118355622chr4:87968221ENST00000354520+1351431_148203932Zinc fingerPHD-type 1
HgeneKMT2Achr11:118355622chr4:87968221ENST00000354520+1351479_153303932Zinc fingerPHD-type 2
HgeneKMT2Achr11:118355622chr4:87968221ENST00000354520+1351566_162703932Zinc fingerPHD-type 3
HgeneKMT2Achr11:118355622chr4:87968221ENST00000354520+1351870_191003932Zinc fingerC2HC pre-PHD-type
HgeneKMT2Achr11:118355622chr4:87968221ENST00000354520+1351931_197803932Zinc fingerPHD-type 4
HgeneKMT2Achr11:118355622chr4:87968221ENST00000389506+1361147_119503970Zinc fingerCXXC-type
HgeneKMT2Achr11:118355622chr4:87968221ENST00000389506+1361431_148203970Zinc fingerPHD-type 1
HgeneKMT2Achr11:118355622chr4:87968221ENST00000389506+1361479_153303970Zinc fingerPHD-type 2
HgeneKMT2Achr11:118355622chr4:87968221ENST00000389506+1361566_162703970Zinc fingerPHD-type 3
HgeneKMT2Achr11:118355622chr4:87968221ENST00000389506+1361870_191003970Zinc fingerC2HC pre-PHD-type
HgeneKMT2Achr11:118355622chr4:87968221ENST00000389506+1361931_197803970Zinc fingerPHD-type 4
HgeneKMT2Achr11:118355622chr4:87968221ENST00000534358+1361147_1195-83973Zinc fingerCXXC-type
HgeneKMT2Achr11:118355622chr4:87968221ENST00000534358+1361431_1482-83973Zinc fingerPHD-type 1
HgeneKMT2Achr11:118355622chr4:87968221ENST00000534358+1361479_1533-83973Zinc fingerPHD-type 2
HgeneKMT2Achr11:118355622chr4:87968221ENST00000534358+1361566_1627-83973Zinc fingerPHD-type 3
HgeneKMT2Achr11:118355622chr4:87968221ENST00000534358+1361870_1910-83973Zinc fingerC2HC pre-PHD-type
HgeneKMT2Achr11:118355622chr4:87968221ENST00000534358+1361931_1978-83973Zinc fingerPHD-type 4
HgeneKMT2Achr11:118355690chr4:88005270ENST00000354520+1351147_119503932Zinc fingerCXXC-type
HgeneKMT2Achr11:118355690chr4:88005270ENST00000354520+1351431_148203932Zinc fingerPHD-type 1
HgeneKMT2Achr11:118355690chr4:88005270ENST00000354520+1351479_153303932Zinc fingerPHD-type 2
HgeneKMT2Achr11:118355690chr4:88005270ENST00000354520+1351566_162703932Zinc fingerPHD-type 3
HgeneKMT2Achr11:118355690chr4:88005270ENST00000354520+1351870_191003932Zinc fingerC2HC pre-PHD-type
HgeneKMT2Achr11:118355690chr4:88005270ENST00000354520+1351931_197803932Zinc fingerPHD-type 4
HgeneKMT2Achr11:118355690chr4:88005270ENST00000389506+10361431_148214443970Zinc fingerPHD-type 1
HgeneKMT2Achr11:118355690chr4:88005270ENST00000389506+10361479_153314443970Zinc fingerPHD-type 2
HgeneKMT2Achr11:118355690chr4:88005270ENST00000389506+10361566_162714443970Zinc fingerPHD-type 3
HgeneKMT2Achr11:118355690chr4:88005270ENST00000389506+10361870_191014443970Zinc fingerC2HC pre-PHD-type
HgeneKMT2Achr11:118355690chr4:88005270ENST00000389506+10361931_197814443970Zinc fingerPHD-type 4
HgeneKMT2Achr11:118355690chr4:88005270ENST00000534358+10361431_148214443973Zinc fingerPHD-type 1
HgeneKMT2Achr11:118355690chr4:88005270ENST00000534358+10361479_153314443973Zinc fingerPHD-type 2
HgeneKMT2Achr11:118355690chr4:88005270ENST00000534358+10361566_162714443973Zinc fingerPHD-type 3
HgeneKMT2Achr11:118355690chr4:88005270ENST00000534358+10361870_191014443973Zinc fingerC2HC pre-PHD-type
HgeneKMT2Achr11:118355690chr4:88005270ENST00000534358+10361931_197814443973Zinc fingerPHD-type 4
HgeneKMT2Achr11:118359475chr4:88005270ENST00000354520+10351431_148214553932Zinc fingerPHD-type 1
HgeneKMT2Achr11:118359475chr4:88005270ENST00000354520+10351479_153314553932Zinc fingerPHD-type 2
HgeneKMT2Achr11:118359475chr4:88005270ENST00000354520+10351566_162714553932Zinc fingerPHD-type 3
HgeneKMT2Achr11:118359475chr4:88005270ENST00000354520+10351870_191014553932Zinc fingerC2HC pre-PHD-type
HgeneKMT2Achr11:118359475chr4:88005270ENST00000354520+10351931_197814553932Zinc fingerPHD-type 4
HgeneKMT2Achr11:118359475chr4:88005270ENST00000389506+11361479_153314933970Zinc fingerPHD-type 2
HgeneKMT2Achr11:118359475chr4:88005270ENST00000389506+11361566_162714933970Zinc fingerPHD-type 3
HgeneKMT2Achr11:118359475chr4:88005270ENST00000389506+11361870_191014933970Zinc fingerC2HC pre-PHD-type
HgeneKMT2Achr11:118359475chr4:88005270ENST00000389506+11361931_197814933970Zinc fingerPHD-type 4
HgeneKMT2Achr11:118359475chr4:88005270ENST00000534358+11361479_153314933973Zinc fingerPHD-type 2
HgeneKMT2Achr11:118359475chr4:88005270ENST00000534358+11361566_162714933973Zinc fingerPHD-type 3
HgeneKMT2Achr11:118359475chr4:88005270ENST00000534358+11361870_191014933973Zinc fingerC2HC pre-PHD-type
HgeneKMT2Achr11:118359475chr4:88005270ENST00000534358+11361931_197814933973Zinc fingerPHD-type 4


Top

FusionGeneSequence for KMT2A_AFF1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_KMT2A_ENST00000534358_chr11_118353211_+_AFF1_ENST00000395146_chr4_88012943_+_2184aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDYDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRYSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKYAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALYPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKDSQHVSSVTQNQKQYDTSSKTHSNSQQGTSSMLEDDLQLSDSEDSDSEQTPEKPPSSSAPPSAPQSLPEPVASAHSSS
AESESTSDSDSSSDSESESSSSDSEENEPLETPAPEPEPPTTNKWQLDNWLTKVSQPAAPPEGPRSTEPPRRHPESKGSSDSATSQEHSE
SKDPPPKSSSKAPRAPPEAPHPGKRSCQKSPAQQEPPQRQTVGTKQPKKPVKASARAGSRTSLQGEREPGLLPYGSRDQTSKDKPKVKTK
GRPRAAASNEPKPAVPPSSEKKKHKSSLPAPSKALSGPEPAKDNVEDRTPEHFALVPLTESQGPPHSGSGSRTSGCRQAVVVQEDSRKDR
LPLPLRDTKLLSPLRDTPPPQSLMVKITLDLLSRIPQPPGKGSRQRKAEDKQPPAGKKHSSEKRSSDSSSKLAKKRKGEAERDCDNKKIR
LEKEIKSQSSSSSSSHKESSKTKPSRPSSQSSKKEMLPPPPVSSSSQKPAKPALKRSRREADTCGQDPPKSASSTKSNHKDSSIPKQRRV
EGKGSRSSSEHKGSSGDTANPFPVPSLPNGNSKPGKPQVKFDKQQADLHMREAKKMKQKAELMTDRVGKAFKYLEAVLSFIECGIATESE
SQSSKSAYSVYSETVDLIKFIMSLKSFSDATAPTQEKIFAVLCMRCQSILNMAMFRCKKDIAIKYSRTLNKHFESSSKVAQAPSPCIARS
TGTPSPLSPMPSPASSVGSQSSAGSVGSSGVAATISTPVTIQNMTSSYVTITSHVLTAFDLWEQAEALTRKNKEFFARLSTNVCTLALNS

>In-frame_KMT2A_ENST00000534358_chr11_118353211_+_AFF1_ENST00000307808_chr4_88012943_+_2183aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDYDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRYSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKYAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALYPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKDSQHVSSVTQNQKQYDTSSKTHSNSQQGTSSMLEDDLQLSDSEDSDSEQTPEKPPSSSAPPSAPQSLPEPVASAHSSS
AESESTSDSDSSSDSESESSSSDSEENEPLETPAPEPEPPTTNKWQLDNWLTKVSQPAAPPEGPRSTEPPRRHPESKGSSDSATSQEHSE
SKDPPPKSSSKAPRAPPEAPHPGKRSCQKSPAQQEPPQRQTVGTKQPKKPVKASARAGSRTSLQGEREPGLLPYGSRDQTSKDKPKVKTK
GRPRAAASNEPKPAVPPSSEKKKHKSSLPAPSKALSGPEPAKDNVEDRTPEHFALVPLTESQGPPHSGSGSRTSGCRQAVVVQEDSRKDR
LPLPLRDTKLLSPLRDTPPPQSLMVKITLDLLSRIPQPPGKGSRQRKAEDKQPPAGKKHSSEKRSSDSSSKLAKKRKGEAERDCDNKKIR
LEKEIKSQSSSSSSSHKESSKTKPSRPSSQSSKKEMLPPPPVSSSSQKPAKPALKRSRREADTCGQDPPKSASSTKSNHKDSSIPKQRRV
EGKGSRSSSEHKGSSGDTANPFPVPSLPNGNSKPGKPQVKFDKQQADLHMREAKKMKQKAELMTDRVGKAFKYLEAVLSFIECGIATESE
SQSSKSAYSVYSETVDLIKFIMSLKSFSDATAPTQEKIFAVLCMRCQSILNMAMFRCKKDIAIKYSRTLNKHFESSSKVAQAPSPCIAST
GTPSPLSPMPSPASSVGSQSSAGSVGSSGVAATISTPVTIQNMTSSYVTITSHVLTAFDLWEQAEALTRKNKEFFARLSTNVCTLALNSS

>In-frame_KMT2A_ENST00000534358_chr11_118353211_+_AFF1_ENST00000544085_chr4_88012943_+_2184aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDYDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRYSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKYAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALYPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKDSQHVSSVTQNQKQYDTSSKTHSNSQQGTSSMLEDDLQLSDSEDSDSEQTPEKPPSSSAPPSAPQSLPEPVASAHSSS
AESESTSDSDSSSDSESESSSSDSEENEPLETPAPEPEPPTTNKWQLDNWLTKVSQPAAPPEGPRSTEPPRRHPESKGSSDSATSQEHSE
SKDPPPKSSSKAPRAPPEAPHPGKRSCQKSPAQQEPPQRQTVGTKQPKKPVKASARAGSRTSLQGEREPGLLPYGSRDQTSKDKPKVKTK
GRPRAAASNEPKPAVPPSSEKKKHKSSLPAPSKALSGPEPAKDNVEDRTPEHFALVPLTESQGPPHSGSGSRTSGCRQAVVVQEDSRKDR
LPLPLRDTKLLSPLRDTPPPQSLMVKITLDLLSRIPQPPGKGSRQRKAEDKQPPAGKKHSSEKRSSDSSSKLAKKRKGEAERDCDNKKIR
LEKEIKSQSSSSSSSHKESSKTKPSRPSSQSSKKEMLPPPPVSSSSQKPAKPALKRSRREADTCGQDPPKSASSTKSNHKDSSIPKQRRV
EGKGSRSSSEHKGSSGDTANPFPVPSLPNGNSKPGKPQVKFDKQQADLHMREAKKMKQKAELMTDRVGKAFKYLEAVLSFIECGIATESE
SQSSKSAYSVYSETVDLIKFIMSLKSFSDATAPTQEKIFAVLCMRCQSILNMAMFRCKKDIAIKYSRTLNKHFESSSKVAQAPSPCIARS
TGTPSPLSPMPSPASSVGSQSSAGSVGSSGVAATISTPVTIQNMTSSYVTITSHVLTAFDLWEQAEALTRKNKEFFARLSTNVCTLALNS

>In-frame_KMT2A_ENST00000389506_chr11_118353211_+_AFF1_ENST00000395146_chr4_88012943_+_2184aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDYDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRYSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKYAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALYPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKDSQHVSSVTQNQKQYDTSSKTHSNSQQGTSSMLEDDLQLSDSEDSDSEQTPEKPPSSSAPPSAPQSLPEPVASAHSSS
AESESTSDSDSSSDSESESSSSDSEENEPLETPAPEPEPPTTNKWQLDNWLTKVSQPAAPPEGPRSTEPPRRHPESKGSSDSATSQEHSE
SKDPPPKSSSKAPRAPPEAPHPGKRSCQKSPAQQEPPQRQTVGTKQPKKPVKASARAGSRTSLQGEREPGLLPYGSRDQTSKDKPKVKTK
GRPRAAASNEPKPAVPPSSEKKKHKSSLPAPSKALSGPEPAKDNVEDRTPEHFALVPLTESQGPPHSGSGSRTSGCRQAVVVQEDSRKDR
LPLPLRDTKLLSPLRDTPPPQSLMVKITLDLLSRIPQPPGKGSRQRKAEDKQPPAGKKHSSEKRSSDSSSKLAKKRKGEAERDCDNKKIR
LEKEIKSQSSSSSSSHKESSKTKPSRPSSQSSKKEMLPPPPVSSSSQKPAKPALKRSRREADTCGQDPPKSASSTKSNHKDSSIPKQRRV
EGKGSRSSSEHKGSSGDTANPFPVPSLPNGNSKPGKPQVKFDKQQADLHMREAKKMKQKAELMTDRVGKAFKYLEAVLSFIECGIATESE
SQSSKSAYSVYSETVDLIKFIMSLKSFSDATAPTQEKIFAVLCMRCQSILNMAMFRCKKDIAIKYSRTLNKHFESSSKVAQAPSPCIARS
TGTPSPLSPMPSPASSVGSQSSAGSVGSSGVAATISTPVTIQNMTSSYVTITSHVLTAFDLWEQAEALTRKNKEFFARLSTNVCTLALNS

>In-frame_KMT2A_ENST00000389506_chr11_118353211_+_AFF1_ENST00000307808_chr4_88012943_+_2183aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDYDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRYSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKYAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALYPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKDSQHVSSVTQNQKQYDTSSKTHSNSQQGTSSMLEDDLQLSDSEDSDSEQTPEKPPSSSAPPSAPQSLPEPVASAHSSS
AESESTSDSDSSSDSESESSSSDSEENEPLETPAPEPEPPTTNKWQLDNWLTKVSQPAAPPEGPRSTEPPRRHPESKGSSDSATSQEHSE
SKDPPPKSSSKAPRAPPEAPHPGKRSCQKSPAQQEPPQRQTVGTKQPKKPVKASARAGSRTSLQGEREPGLLPYGSRDQTSKDKPKVKTK
GRPRAAASNEPKPAVPPSSEKKKHKSSLPAPSKALSGPEPAKDNVEDRTPEHFALVPLTESQGPPHSGSGSRTSGCRQAVVVQEDSRKDR
LPLPLRDTKLLSPLRDTPPPQSLMVKITLDLLSRIPQPPGKGSRQRKAEDKQPPAGKKHSSEKRSSDSSSKLAKKRKGEAERDCDNKKIR
LEKEIKSQSSSSSSSHKESSKTKPSRPSSQSSKKEMLPPPPVSSSSQKPAKPALKRSRREADTCGQDPPKSASSTKSNHKDSSIPKQRRV
EGKGSRSSSEHKGSSGDTANPFPVPSLPNGNSKPGKPQVKFDKQQADLHMREAKKMKQKAELMTDRVGKAFKYLEAVLSFIECGIATESE
SQSSKSAYSVYSETVDLIKFIMSLKSFSDATAPTQEKIFAVLCMRCQSILNMAMFRCKKDIAIKYSRTLNKHFESSSKVAQAPSPCIAST
GTPSPLSPMPSPASSVGSQSSAGSVGSSGVAATISTPVTIQNMTSSYVTITSHVLTAFDLWEQAEALTRKNKEFFARLSTNVCTLALNSS

>In-frame_KMT2A_ENST00000389506_chr11_118353211_+_AFF1_ENST00000544085_chr4_88012943_+_2184aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDYDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRYSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKYAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALYPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKDSQHVSSVTQNQKQYDTSSKTHSNSQQGTSSMLEDDLQLSDSEDSDSEQTPEKPPSSSAPPSAPQSLPEPVASAHSSS
AESESTSDSDSSSDSESESSSSDSEENEPLETPAPEPEPPTTNKWQLDNWLTKVSQPAAPPEGPRSTEPPRRHPESKGSSDSATSQEHSE
SKDPPPKSSSKAPRAPPEAPHPGKRSCQKSPAQQEPPQRQTVGTKQPKKPVKASARAGSRTSLQGEREPGLLPYGSRDQTSKDKPKVKTK
GRPRAAASNEPKPAVPPSSEKKKHKSSLPAPSKALSGPEPAKDNVEDRTPEHFALVPLTESQGPPHSGSGSRTSGCRQAVVVQEDSRKDR
LPLPLRDTKLLSPLRDTPPPQSLMVKITLDLLSRIPQPPGKGSRQRKAEDKQPPAGKKHSSEKRSSDSSSKLAKKRKGEAERDCDNKKIR
LEKEIKSQSSSSSSSHKESSKTKPSRPSSQSSKKEMLPPPPVSSSSQKPAKPALKRSRREADTCGQDPPKSASSTKSNHKDSSIPKQRRV
EGKGSRSSSEHKGSSGDTANPFPVPSLPNGNSKPGKPQVKFDKQQADLHMREAKKMKQKAELMTDRVGKAFKYLEAVLSFIECGIATESE
SQSSKSAYSVYSETVDLIKFIMSLKSFSDATAPTQEKIFAVLCMRCQSILNMAMFRCKKDIAIKYSRTLNKHFESSSKVAQAPSPCIARS
TGTPSPLSPMPSPASSVGSQSSAGSVGSSGVAATISTPVTIQNMTSSYVTITSHVLTAFDLWEQAEALTRKNKEFFARLSTNVCTLALNS

>In-frame_KMT2A_ENST00000354520_chr11_118353211_+_AFF1_ENST00000395146_chr4_88012943_+_2184aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDYDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRYSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKYAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALYPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKDSQHVSSVTQNQKQYDTSSKTHSNSQQGTSSMLEDDLQLSDSEDSDSEQTPEKPPSSSAPPSAPQSLPEPVASAHSSS
AESESTSDSDSSSDSESESSSSDSEENEPLETPAPEPEPPTTNKWQLDNWLTKVSQPAAPPEGPRSTEPPRRHPESKGSSDSATSQEHSE
SKDPPPKSSSKAPRAPPEAPHPGKRSCQKSPAQQEPPQRQTVGTKQPKKPVKASARAGSRTSLQGEREPGLLPYGSRDQTSKDKPKVKTK
GRPRAAASNEPKPAVPPSSEKKKHKSSLPAPSKALSGPEPAKDNVEDRTPEHFALVPLTESQGPPHSGSGSRTSGCRQAVVVQEDSRKDR
LPLPLRDTKLLSPLRDTPPPQSLMVKITLDLLSRIPQPPGKGSRQRKAEDKQPPAGKKHSSEKRSSDSSSKLAKKRKGEAERDCDNKKIR
LEKEIKSQSSSSSSSHKESSKTKPSRPSSQSSKKEMLPPPPVSSSSQKPAKPALKRSRREADTCGQDPPKSASSTKSNHKDSSIPKQRRV
EGKGSRSSSEHKGSSGDTANPFPVPSLPNGNSKPGKPQVKFDKQQADLHMREAKKMKQKAELMTDRVGKAFKYLEAVLSFIECGIATESE
SQSSKSAYSVYSETVDLIKFIMSLKSFSDATAPTQEKIFAVLCMRCQSILNMAMFRCKKDIAIKYSRTLNKHFESSSKVAQAPSPCIARS
TGTPSPLSPMPSPASSVGSQSSAGSVGSSGVAATISTPVTIQNMTSSYVTITSHVLTAFDLWEQAEALTRKNKEFFARLSTNVCTLALNS

>In-frame_KMT2A_ENST00000354520_chr11_118353211_+_AFF1_ENST00000307808_chr4_88012943_+_2183aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDYDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRYSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKYAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALYPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKDSQHVSSVTQNQKQYDTSSKTHSNSQQGTSSMLEDDLQLSDSEDSDSEQTPEKPPSSSAPPSAPQSLPEPVASAHSSS
AESESTSDSDSSSDSESESSSSDSEENEPLETPAPEPEPPTTNKWQLDNWLTKVSQPAAPPEGPRSTEPPRRHPESKGSSDSATSQEHSE
SKDPPPKSSSKAPRAPPEAPHPGKRSCQKSPAQQEPPQRQTVGTKQPKKPVKASARAGSRTSLQGEREPGLLPYGSRDQTSKDKPKVKTK
GRPRAAASNEPKPAVPPSSEKKKHKSSLPAPSKALSGPEPAKDNVEDRTPEHFALVPLTESQGPPHSGSGSRTSGCRQAVVVQEDSRKDR
LPLPLRDTKLLSPLRDTPPPQSLMVKITLDLLSRIPQPPGKGSRQRKAEDKQPPAGKKHSSEKRSSDSSSKLAKKRKGEAERDCDNKKIR
LEKEIKSQSSSSSSSHKESSKTKPSRPSSQSSKKEMLPPPPVSSSSQKPAKPALKRSRREADTCGQDPPKSASSTKSNHKDSSIPKQRRV
EGKGSRSSSEHKGSSGDTANPFPVPSLPNGNSKPGKPQVKFDKQQADLHMREAKKMKQKAELMTDRVGKAFKYLEAVLSFIECGIATESE
SQSSKSAYSVYSETVDLIKFIMSLKSFSDATAPTQEKIFAVLCMRCQSILNMAMFRCKKDIAIKYSRTLNKHFESSSKVAQAPSPCIAST
GTPSPLSPMPSPASSVGSQSSAGSVGSSGVAATISTPVTIQNMTSSYVTITSHVLTAFDLWEQAEALTRKNKEFFARLSTNVCTLALNSS

>In-frame_KMT2A_ENST00000354520_chr11_118353211_+_AFF1_ENST00000544085_chr4_88012943_+_2184aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDYDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRYSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKYAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALYPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKDSQHVSSVTQNQKQYDTSSKTHSNSQQGTSSMLEDDLQLSDSEDSDSEQTPEKPPSSSAPPSAPQSLPEPVASAHSSS
AESESTSDSDSSSDSESESSSSDSEENEPLETPAPEPEPPTTNKWQLDNWLTKVSQPAAPPEGPRSTEPPRRHPESKGSSDSATSQEHSE
SKDPPPKSSSKAPRAPPEAPHPGKRSCQKSPAQQEPPQRQTVGTKQPKKPVKASARAGSRTSLQGEREPGLLPYGSRDQTSKDKPKVKTK
GRPRAAASNEPKPAVPPSSEKKKHKSSLPAPSKALSGPEPAKDNVEDRTPEHFALVPLTESQGPPHSGSGSRTSGCRQAVVVQEDSRKDR
LPLPLRDTKLLSPLRDTPPPQSLMVKITLDLLSRIPQPPGKGSRQRKAEDKQPPAGKKHSSEKRSSDSSSKLAKKRKGEAERDCDNKKIR
LEKEIKSQSSSSSSSHKESSKTKPSRPSSQSSKKEMLPPPPVSSSSQKPAKPALKRSRREADTCGQDPPKSASSTKSNHKDSSIPKQRRV
EGKGSRSSSEHKGSSGDTANPFPVPSLPNGNSKPGKPQVKFDKQQADLHMREAKKMKQKAELMTDRVGKAFKYLEAVLSFIECGIATESE
SQSSKSAYSVYSETVDLIKFIMSLKSFSDATAPTQEKIFAVLCMRCQSILNMAMFRCKKDIAIKYSRTLNKHFESSSKVAQAPSPCIARS
TGTPSPLSPMPSPASSVGSQSSAGSVGSSGVAATISTPVTIQNMTSSYVTITSHVLTAFDLWEQAEALTRKNKEFFARLSTNVCTLALNS

>In-frame_KMT2A_ENST00000534358_chr11_118355690_+_AFF1_ENST00000395146_chr4_88005270_+_2310aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDYDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRYSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKYAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALYPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKEDCEAENVWEMGGLGILTSVPITPRVVCFLCASS
GHVEQTYSNEVHCVEEILKEMTHSWPPPLTAIHTPSTAEPSKFPFPTKDSQHVSSVTQNQKQYDTSSKTHSNSQQGTSSMLEDDLQLSDS
EDSDSEQTPEKPPSSSAPPSAPQSLPEPVASAHSSSAESESTSDSDSSSDSESESSSSDSEENEPLETPAPEPEPPTTNKWQLDNWLTKV
SQPAAPPEGPRSTEPPRRHPESKGSSDSATSQEHSESKDPPPKSSSKAPRAPPEAPHPGKRSCQKSPAQQEPPQRQTVGTKQPKKPVKAS
ARAGSRTSLQGEREPGLLPYGSRDQTSKDKPKVKTKGRPRAAASNEPKPAVPPSSEKKKHKSSLPAPSKALSGPEPAKDNVEDRTPEHFA
LVPLTESQGPPHSGSGSRTSGCRQAVVVQEDSRKDRLPLPLRDTKLLSPLRDTPPPQSLMVKITLDLLSRIPQPPGKGSRQRKAEDKQPP
AGKKHSSEKRSSDSSSKLAKKRKGEAERDCDNKKIRLEKEIKSQSSSSSSSHKESSKTKPSRPSSQSSKKEMLPPPPVSSSSQKPAKPAL
KRSRREADTCGQDPPKSASSTKSNHKDSSIPKQRRVEGKGSRSSSEHKGSSGDTANPFPVPSLPNGNSKPGKPQVKFDKQQADLHMREAK
KMKQKAELMTDRVGKAFKYLEAVLSFIECGIATESESQSSKSAYSVYSETVDLIKFIMSLKSFSDATAPTQEKIFAVLCMRCQSILNMAM
FRCKKDIAIKYSRTLNKHFESSSKVAQAPSPCIARSTGTPSPLSPMPSPASSVGSQSSAGSVGSSGVAATISTPVTIQNMTSSYVTITSH

>In-frame_KMT2A_ENST00000534358_chr11_118355690_+_AFF1_ENST00000307808_chr4_88005270_+_2309aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDYDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRYSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKYAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALYPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKEDCEAENVWEMGGLGILTSVPITPRVVCFLCASS
GHVEQTYSNEVHCVEEILKEMTHSWPPPLTAIHTPSTAEPSKFPFPTKDSQHVSSVTQNQKQYDTSSKTHSNSQQGTSSMLEDDLQLSDS
EDSDSEQTPEKPPSSSAPPSAPQSLPEPVASAHSSSAESESTSDSDSSSDSESESSSSDSEENEPLETPAPEPEPPTTNKWQLDNWLTKV
SQPAAPPEGPRSTEPPRRHPESKGSSDSATSQEHSESKDPPPKSSSKAPRAPPEAPHPGKRSCQKSPAQQEPPQRQTVGTKQPKKPVKAS
ARAGSRTSLQGEREPGLLPYGSRDQTSKDKPKVKTKGRPRAAASNEPKPAVPPSSEKKKHKSSLPAPSKALSGPEPAKDNVEDRTPEHFA
LVPLTESQGPPHSGSGSRTSGCRQAVVVQEDSRKDRLPLPLRDTKLLSPLRDTPPPQSLMVKITLDLLSRIPQPPGKGSRQRKAEDKQPP
AGKKHSSEKRSSDSSSKLAKKRKGEAERDCDNKKIRLEKEIKSQSSSSSSSHKESSKTKPSRPSSQSSKKEMLPPPPVSSSSQKPAKPAL
KRSRREADTCGQDPPKSASSTKSNHKDSSIPKQRRVEGKGSRSSSEHKGSSGDTANPFPVPSLPNGNSKPGKPQVKFDKQQADLHMREAK
KMKQKAELMTDRVGKAFKYLEAVLSFIECGIATESESQSSKSAYSVYSETVDLIKFIMSLKSFSDATAPTQEKIFAVLCMRCQSILNMAM
FRCKKDIAIKYSRTLNKHFESSSKVAQAPSPCIASTGTPSPLSPMPSPASSVGSQSSAGSVGSSGVAATISTPVTIQNMTSSYVTITSHV

>In-frame_KMT2A_ENST00000389506_chr11_118355690_+_AFF1_ENST00000395146_chr4_88005270_+_2310aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDYDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRYSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKYAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALYPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKEDCEAENVWEMGGLGILTSVPITPRVVCFLCASS
GHVEQTYSNEVHCVEEILKEMTHSWPPPLTAIHTPSTAEPSKFPFPTKDSQHVSSVTQNQKQYDTSSKTHSNSQQGTSSMLEDDLQLSDS
EDSDSEQTPEKPPSSSAPPSAPQSLPEPVASAHSSSAESESTSDSDSSSDSESESSSSDSEENEPLETPAPEPEPPTTNKWQLDNWLTKV
SQPAAPPEGPRSTEPPRRHPESKGSSDSATSQEHSESKDPPPKSSSKAPRAPPEAPHPGKRSCQKSPAQQEPPQRQTVGTKQPKKPVKAS
ARAGSRTSLQGEREPGLLPYGSRDQTSKDKPKVKTKGRPRAAASNEPKPAVPPSSEKKKHKSSLPAPSKALSGPEPAKDNVEDRTPEHFA
LVPLTESQGPPHSGSGSRTSGCRQAVVVQEDSRKDRLPLPLRDTKLLSPLRDTPPPQSLMVKITLDLLSRIPQPPGKGSRQRKAEDKQPP
AGKKHSSEKRSSDSSSKLAKKRKGEAERDCDNKKIRLEKEIKSQSSSSSSSHKESSKTKPSRPSSQSSKKEMLPPPPVSSSSQKPAKPAL
KRSRREADTCGQDPPKSASSTKSNHKDSSIPKQRRVEGKGSRSSSEHKGSSGDTANPFPVPSLPNGNSKPGKPQVKFDKQQADLHMREAK
KMKQKAELMTDRVGKAFKYLEAVLSFIECGIATESESQSSKSAYSVYSETVDLIKFIMSLKSFSDATAPTQEKIFAVLCMRCQSILNMAM
FRCKKDIAIKYSRTLNKHFESSSKVAQAPSPCIARSTGTPSPLSPMPSPASSVGSQSSAGSVGSSGVAATISTPVTIQNMTSSYVTITSH

>In-frame_KMT2A_ENST00000389506_chr11_118355690_+_AFF1_ENST00000307808_chr4_88005270_+_2309aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDYDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRYSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKYAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALYPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKEDCEAENVWEMGGLGILTSVPITPRVVCFLCASS
GHVEQTYSNEVHCVEEILKEMTHSWPPPLTAIHTPSTAEPSKFPFPTKDSQHVSSVTQNQKQYDTSSKTHSNSQQGTSSMLEDDLQLSDS
EDSDSEQTPEKPPSSSAPPSAPQSLPEPVASAHSSSAESESTSDSDSSSDSESESSSSDSEENEPLETPAPEPEPPTTNKWQLDNWLTKV
SQPAAPPEGPRSTEPPRRHPESKGSSDSATSQEHSESKDPPPKSSSKAPRAPPEAPHPGKRSCQKSPAQQEPPQRQTVGTKQPKKPVKAS
ARAGSRTSLQGEREPGLLPYGSRDQTSKDKPKVKTKGRPRAAASNEPKPAVPPSSEKKKHKSSLPAPSKALSGPEPAKDNVEDRTPEHFA
LVPLTESQGPPHSGSGSRTSGCRQAVVVQEDSRKDRLPLPLRDTKLLSPLRDTPPPQSLMVKITLDLLSRIPQPPGKGSRQRKAEDKQPP
AGKKHSSEKRSSDSSSKLAKKRKGEAERDCDNKKIRLEKEIKSQSSSSSSSHKESSKTKPSRPSSQSSKKEMLPPPPVSSSSQKPAKPAL
KRSRREADTCGQDPPKSASSTKSNHKDSSIPKQRRVEGKGSRSSSEHKGSSGDTANPFPVPSLPNGNSKPGKPQVKFDKQQADLHMREAK
KMKQKAELMTDRVGKAFKYLEAVLSFIECGIATESESQSSKSAYSVYSETVDLIKFIMSLKSFSDATAPTQEKIFAVLCMRCQSILNMAM
FRCKKDIAIKYSRTLNKHFESSSKVAQAPSPCIASTGTPSPLSPMPSPASSVGSQSSAGSVGSSGVAATISTPVTIQNMTSSYVTITSHV

>In-frame_KMT2A_ENST00000534358_chr11_118355690_+_AFF1_ENST00000395146_chr4_88005270_+_2310aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDYDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRYSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKYAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALYPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKEDCEAENVWEMGGLGILTSVPITPRVVCFLCASS
GHVEQTYSNEVHCVEEILKEMTHSWPPPLTAIHTPSTAEPSKFPFPTKDSQHVSSVTQNQKQYDTSSKTHSNSQQGTSSMLEDDLQLSDS
EDSDSEQTPEKPPSSSAPPSAPQSLPEPVASAHSSSAESESTSDSDSSSDSESESSSSDSEENEPLETPAPEPEPPTTNKWQLDNWLTKV
SQPAAPPEGPRSTEPPRRHPESKGSSDSATSQEHSESKDPPPKSSSKAPRAPPEAPHPGKRSCQKSPAQQEPPQRQTVGTKQPKKPVKAS
ARAGSRTSLQGEREPGLLPYGSRDQTSKDKPKVKTKGRPRAAASNEPKPAVPPSSEKKKHKSSLPAPSKALSGPEPAKDNVEDRTPEHFA
LVPLTESQGPPHSGSGSRTSGCRQAVVVQEDSRKDRLPLPLRDTKLLSPLRDTPPPQSLMVKITLDLLSRIPQPPGKGSRQRKAEDKQPP
AGKKHSSEKRSSDSSSKLAKKRKGEAERDCDNKKIRLEKEIKSQSSSSSSSHKESSKTKPSRPSSQSSKKEMLPPPPVSSSSQKPAKPAL
KRSRREADTCGQDPPKSASSTKSNHKDSSIPKQRRVEGKGSRSSSEHKGSSGDTANPFPVPSLPNGNSKPGKPQVKFDKQQADLHMREAK
KMKQKAELMTDRVGKAFKYLEAVLSFIECGIATESESQSSKSAYSVYSETVDLIKFIMSLKSFSDATAPTQEKIFAVLCMRCQSILNMAM
FRCKKDIAIKYSRTLNKHFESSSKVAQAPSPCIARSTGTPSPLSPMPSPASSVGSQSSAGSVGSSGVAATISTPVTIQNMTSSYVTITSH

>In-frame_KMT2A_ENST00000534358_chr11_118355690_+_AFF1_ENST00000307808_chr4_88005270_+_2309aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDYDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRYSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKYAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALYPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKEDCEAENVWEMGGLGILTSVPITPRVVCFLCASS
GHVEQTYSNEVHCVEEILKEMTHSWPPPLTAIHTPSTAEPSKFPFPTKDSQHVSSVTQNQKQYDTSSKTHSNSQQGTSSMLEDDLQLSDS
EDSDSEQTPEKPPSSSAPPSAPQSLPEPVASAHSSSAESESTSDSDSSSDSESESSSSDSEENEPLETPAPEPEPPTTNKWQLDNWLTKV
SQPAAPPEGPRSTEPPRRHPESKGSSDSATSQEHSESKDPPPKSSSKAPRAPPEAPHPGKRSCQKSPAQQEPPQRQTVGTKQPKKPVKAS
ARAGSRTSLQGEREPGLLPYGSRDQTSKDKPKVKTKGRPRAAASNEPKPAVPPSSEKKKHKSSLPAPSKALSGPEPAKDNVEDRTPEHFA
LVPLTESQGPPHSGSGSRTSGCRQAVVVQEDSRKDRLPLPLRDTKLLSPLRDTPPPQSLMVKITLDLLSRIPQPPGKGSRQRKAEDKQPP
AGKKHSSEKRSSDSSSKLAKKRKGEAERDCDNKKIRLEKEIKSQSSSSSSSHKESSKTKPSRPSSQSSKKEMLPPPPVSSSSQKPAKPAL
KRSRREADTCGQDPPKSASSTKSNHKDSSIPKQRRVEGKGSRSSSEHKGSSGDTANPFPVPSLPNGNSKPGKPQVKFDKQQADLHMREAK
KMKQKAELMTDRVGKAFKYLEAVLSFIECGIATESESQSSKSAYSVYSETVDLIKFIMSLKSFSDATAPTQEKIFAVLCMRCQSILNMAM
FRCKKDIAIKYSRTLNKHFESSSKVAQAPSPCIASTGTPSPLSPMPSPASSVGSQSSAGSVGSSGVAATISTPVTIQNMTSSYVTITSHV

>In-frame_KMT2A_ENST00000389506_chr11_118355690_+_AFF1_ENST00000395146_chr4_88005270_+_2310aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDYDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRYSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKYAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALYPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKEDCEAENVWEMGGLGILTSVPITPRVVCFLCASS
GHVEQTYSNEVHCVEEILKEMTHSWPPPLTAIHTPSTAEPSKFPFPTKDSQHVSSVTQNQKQYDTSSKTHSNSQQGTSSMLEDDLQLSDS
EDSDSEQTPEKPPSSSAPPSAPQSLPEPVASAHSSSAESESTSDSDSSSDSESESSSSDSEENEPLETPAPEPEPPTTNKWQLDNWLTKV
SQPAAPPEGPRSTEPPRRHPESKGSSDSATSQEHSESKDPPPKSSSKAPRAPPEAPHPGKRSCQKSPAQQEPPQRQTVGTKQPKKPVKAS
ARAGSRTSLQGEREPGLLPYGSRDQTSKDKPKVKTKGRPRAAASNEPKPAVPPSSEKKKHKSSLPAPSKALSGPEPAKDNVEDRTPEHFA
LVPLTESQGPPHSGSGSRTSGCRQAVVVQEDSRKDRLPLPLRDTKLLSPLRDTPPPQSLMVKITLDLLSRIPQPPGKGSRQRKAEDKQPP
AGKKHSSEKRSSDSSSKLAKKRKGEAERDCDNKKIRLEKEIKSQSSSSSSSHKESSKTKPSRPSSQSSKKEMLPPPPVSSSSQKPAKPAL
KRSRREADTCGQDPPKSASSTKSNHKDSSIPKQRRVEGKGSRSSSEHKGSSGDTANPFPVPSLPNGNSKPGKPQVKFDKQQADLHMREAK
KMKQKAELMTDRVGKAFKYLEAVLSFIECGIATESESQSSKSAYSVYSETVDLIKFIMSLKSFSDATAPTQEKIFAVLCMRCQSILNMAM
FRCKKDIAIKYSRTLNKHFESSSKVAQAPSPCIARSTGTPSPLSPMPSPASSVGSQSSAGSVGSSGVAATISTPVTIQNMTSSYVTITSH

>In-frame_KMT2A_ENST00000389506_chr11_118355690_+_AFF1_ENST00000307808_chr4_88005270_+_2309aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDYDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRYSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKYAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALYPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKEDCEAENVWEMGGLGILTSVPITPRVVCFLCASS
GHVEQTYSNEVHCVEEILKEMTHSWPPPLTAIHTPSTAEPSKFPFPTKDSQHVSSVTQNQKQYDTSSKTHSNSQQGTSSMLEDDLQLSDS
EDSDSEQTPEKPPSSSAPPSAPQSLPEPVASAHSSSAESESTSDSDSSSDSESESSSSDSEENEPLETPAPEPEPPTTNKWQLDNWLTKV
SQPAAPPEGPRSTEPPRRHPESKGSSDSATSQEHSESKDPPPKSSSKAPRAPPEAPHPGKRSCQKSPAQQEPPQRQTVGTKQPKKPVKAS
ARAGSRTSLQGEREPGLLPYGSRDQTSKDKPKVKTKGRPRAAASNEPKPAVPPSSEKKKHKSSLPAPSKALSGPEPAKDNVEDRTPEHFA
LVPLTESQGPPHSGSGSRTSGCRQAVVVQEDSRKDRLPLPLRDTKLLSPLRDTPPPQSLMVKITLDLLSRIPQPPGKGSRQRKAEDKQPP
AGKKHSSEKRSSDSSSKLAKKRKGEAERDCDNKKIRLEKEIKSQSSSSSSSHKESSKTKPSRPSSQSSKKEMLPPPPVSSSSQKPAKPAL
KRSRREADTCGQDPPKSASSTKSNHKDSSIPKQRRVEGKGSRSSSEHKGSSGDTANPFPVPSLPNGNSKPGKPQVKFDKQQADLHMREAK
KMKQKAELMTDRVGKAFKYLEAVLSFIECGIATESESQSSKSAYSVYSETVDLIKFIMSLKSFSDATAPTQEKIFAVLCMRCQSILNMAM
FRCKKDIAIKYSRTLNKHFESSSKVAQAPSPCIASTGTPSPLSPMPSPASSVGSQSSAGSVGSSGVAATISTPVTIQNMTSSYVTITSHV

>In-frame_KMT2A_ENST00000534358_chr11_118353211_+_AFF1_ENST00000395146_chr4_88011134_+_2213aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDYDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRYSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKYAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALYPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEMTHSWPPPLTAIHTPSTAEPSKFPFPTKDSQHVSSVTQNQKQYDTSSKTHSNSQQGTSSMLEDDLQLSDSEDSDSEQ
TPEKPPSSSAPPSAPQSLPEPVASAHSSSAESESTSDSDSSSDSESESSSSDSEENEPLETPAPEPEPPTTNKWQLDNWLTKVSQPAAPP
EGPRSTEPPRRHPESKGSSDSATSQEHSESKDPPPKSSSKAPRAPPEAPHPGKRSCQKSPAQQEPPQRQTVGTKQPKKPVKASARAGSRT
SLQGEREPGLLPYGSRDQTSKDKPKVKTKGRPRAAASNEPKPAVPPSSEKKKHKSSLPAPSKALSGPEPAKDNVEDRTPEHFALVPLTES
QGPPHSGSGSRTSGCRQAVVVQEDSRKDRLPLPLRDTKLLSPLRDTPPPQSLMVKITLDLLSRIPQPPGKGSRQRKAEDKQPPAGKKHSS
EKRSSDSSSKLAKKRKGEAERDCDNKKIRLEKEIKSQSSSSSSSHKESSKTKPSRPSSQSSKKEMLPPPPVSSSSQKPAKPALKRSRREA
DTCGQDPPKSASSTKSNHKDSSIPKQRRVEGKGSRSSSEHKGSSGDTANPFPVPSLPNGNSKPGKPQVKFDKQQADLHMREAKKMKQKAE
LMTDRVGKAFKYLEAVLSFIECGIATESESQSSKSAYSVYSETVDLIKFIMSLKSFSDATAPTQEKIFAVLCMRCQSILNMAMFRCKKDI
AIKYSRTLNKHFESSSKVAQAPSPCIARSTGTPSPLSPMPSPASSVGSQSSAGSVGSSGVAATISTPVTIQNMTSSYVTITSHVLTAFDL

>In-frame_KMT2A_ENST00000534358_chr11_118353211_+_AFF1_ENST00000307808_chr4_88011134_+_2212aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDYDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRYSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKYAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALYPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEMTHSWPPPLTAIHTPSTAEPSKFPFPTKDSQHVSSVTQNQKQYDTSSKTHSNSQQGTSSMLEDDLQLSDSEDSDSEQ
TPEKPPSSSAPPSAPQSLPEPVASAHSSSAESESTSDSDSSSDSESESSSSDSEENEPLETPAPEPEPPTTNKWQLDNWLTKVSQPAAPP
EGPRSTEPPRRHPESKGSSDSATSQEHSESKDPPPKSSSKAPRAPPEAPHPGKRSCQKSPAQQEPPQRQTVGTKQPKKPVKASARAGSRT
SLQGEREPGLLPYGSRDQTSKDKPKVKTKGRPRAAASNEPKPAVPPSSEKKKHKSSLPAPSKALSGPEPAKDNVEDRTPEHFALVPLTES
QGPPHSGSGSRTSGCRQAVVVQEDSRKDRLPLPLRDTKLLSPLRDTPPPQSLMVKITLDLLSRIPQPPGKGSRQRKAEDKQPPAGKKHSS
EKRSSDSSSKLAKKRKGEAERDCDNKKIRLEKEIKSQSSSSSSSHKESSKTKPSRPSSQSSKKEMLPPPPVSSSSQKPAKPALKRSRREA
DTCGQDPPKSASSTKSNHKDSSIPKQRRVEGKGSRSSSEHKGSSGDTANPFPVPSLPNGNSKPGKPQVKFDKQQADLHMREAKKMKQKAE
LMTDRVGKAFKYLEAVLSFIECGIATESESQSSKSAYSVYSETVDLIKFIMSLKSFSDATAPTQEKIFAVLCMRCQSILNMAMFRCKKDI
AIKYSRTLNKHFESSSKVAQAPSPCIASTGTPSPLSPMPSPASSVGSQSSAGSVGSSGVAATISTPVTIQNMTSSYVTITSHVLTAFDLW

>In-frame_KMT2A_ENST00000389506_chr11_118353211_+_AFF1_ENST00000395146_chr4_88011134_+_2213aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDYDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRYSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKYAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALYPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEMTHSWPPPLTAIHTPSTAEPSKFPFPTKDSQHVSSVTQNQKQYDTSSKTHSNSQQGTSSMLEDDLQLSDSEDSDSEQ
TPEKPPSSSAPPSAPQSLPEPVASAHSSSAESESTSDSDSSSDSESESSSSDSEENEPLETPAPEPEPPTTNKWQLDNWLTKVSQPAAPP
EGPRSTEPPRRHPESKGSSDSATSQEHSESKDPPPKSSSKAPRAPPEAPHPGKRSCQKSPAQQEPPQRQTVGTKQPKKPVKASARAGSRT
SLQGEREPGLLPYGSRDQTSKDKPKVKTKGRPRAAASNEPKPAVPPSSEKKKHKSSLPAPSKALSGPEPAKDNVEDRTPEHFALVPLTES
QGPPHSGSGSRTSGCRQAVVVQEDSRKDRLPLPLRDTKLLSPLRDTPPPQSLMVKITLDLLSRIPQPPGKGSRQRKAEDKQPPAGKKHSS
EKRSSDSSSKLAKKRKGEAERDCDNKKIRLEKEIKSQSSSSSSSHKESSKTKPSRPSSQSSKKEMLPPPPVSSSSQKPAKPALKRSRREA
DTCGQDPPKSASSTKSNHKDSSIPKQRRVEGKGSRSSSEHKGSSGDTANPFPVPSLPNGNSKPGKPQVKFDKQQADLHMREAKKMKQKAE
LMTDRVGKAFKYLEAVLSFIECGIATESESQSSKSAYSVYSETVDLIKFIMSLKSFSDATAPTQEKIFAVLCMRCQSILNMAMFRCKKDI
AIKYSRTLNKHFESSSKVAQAPSPCIARSTGTPSPLSPMPSPASSVGSQSSAGSVGSSGVAATISTPVTIQNMTSSYVTITSHVLTAFDL

>In-frame_KMT2A_ENST00000389506_chr11_118353211_+_AFF1_ENST00000307808_chr4_88011134_+_2212aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDYDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRYSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKYAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALYPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEMTHSWPPPLTAIHTPSTAEPSKFPFPTKDSQHVSSVTQNQKQYDTSSKTHSNSQQGTSSMLEDDLQLSDSEDSDSEQ
TPEKPPSSSAPPSAPQSLPEPVASAHSSSAESESTSDSDSSSDSESESSSSDSEENEPLETPAPEPEPPTTNKWQLDNWLTKVSQPAAPP
EGPRSTEPPRRHPESKGSSDSATSQEHSESKDPPPKSSSKAPRAPPEAPHPGKRSCQKSPAQQEPPQRQTVGTKQPKKPVKASARAGSRT
SLQGEREPGLLPYGSRDQTSKDKPKVKTKGRPRAAASNEPKPAVPPSSEKKKHKSSLPAPSKALSGPEPAKDNVEDRTPEHFALVPLTES
QGPPHSGSGSRTSGCRQAVVVQEDSRKDRLPLPLRDTKLLSPLRDTPPPQSLMVKITLDLLSRIPQPPGKGSRQRKAEDKQPPAGKKHSS
EKRSSDSSSKLAKKRKGEAERDCDNKKIRLEKEIKSQSSSSSSSHKESSKTKPSRPSSQSSKKEMLPPPPVSSSSQKPAKPALKRSRREA
DTCGQDPPKSASSTKSNHKDSSIPKQRRVEGKGSRSSSEHKGSSGDTANPFPVPSLPNGNSKPGKPQVKFDKQQADLHMREAKKMKQKAE
LMTDRVGKAFKYLEAVLSFIECGIATESESQSSKSAYSVYSETVDLIKFIMSLKSFSDATAPTQEKIFAVLCMRCQSILNMAMFRCKKDI
AIKYSRTLNKHFESSSKVAQAPSPCIASTGTPSPLSPMPSPASSVGSQSSAGSVGSSGVAATISTPVTIQNMTSSYVTITSHVLTAFDLW

>In-frame_KMT2A_ENST00000354520_chr11_118353211_+_AFF1_ENST00000395146_chr4_88011134_+_2213aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDYDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRYSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKYAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALYPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEMTHSWPPPLTAIHTPSTAEPSKFPFPTKDSQHVSSVTQNQKQYDTSSKTHSNSQQGTSSMLEDDLQLSDSEDSDSEQ
TPEKPPSSSAPPSAPQSLPEPVASAHSSSAESESTSDSDSSSDSESESSSSDSEENEPLETPAPEPEPPTTNKWQLDNWLTKVSQPAAPP
EGPRSTEPPRRHPESKGSSDSATSQEHSESKDPPPKSSSKAPRAPPEAPHPGKRSCQKSPAQQEPPQRQTVGTKQPKKPVKASARAGSRT
SLQGEREPGLLPYGSRDQTSKDKPKVKTKGRPRAAASNEPKPAVPPSSEKKKHKSSLPAPSKALSGPEPAKDNVEDRTPEHFALVPLTES
QGPPHSGSGSRTSGCRQAVVVQEDSRKDRLPLPLRDTKLLSPLRDTPPPQSLMVKITLDLLSRIPQPPGKGSRQRKAEDKQPPAGKKHSS
EKRSSDSSSKLAKKRKGEAERDCDNKKIRLEKEIKSQSSSSSSSHKESSKTKPSRPSSQSSKKEMLPPPPVSSSSQKPAKPALKRSRREA
DTCGQDPPKSASSTKSNHKDSSIPKQRRVEGKGSRSSSEHKGSSGDTANPFPVPSLPNGNSKPGKPQVKFDKQQADLHMREAKKMKQKAE
LMTDRVGKAFKYLEAVLSFIECGIATESESQSSKSAYSVYSETVDLIKFIMSLKSFSDATAPTQEKIFAVLCMRCQSILNMAMFRCKKDI
AIKYSRTLNKHFESSSKVAQAPSPCIARSTGTPSPLSPMPSPASSVGSQSSAGSVGSSGVAATISTPVTIQNMTSSYVTITSHVLTAFDL

>In-frame_KMT2A_ENST00000354520_chr11_118353211_+_AFF1_ENST00000307808_chr4_88011134_+_2212aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDYDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRYSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKYAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALYPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEMTHSWPPPLTAIHTPSTAEPSKFPFPTKDSQHVSSVTQNQKQYDTSSKTHSNSQQGTSSMLEDDLQLSDSEDSDSEQ
TPEKPPSSSAPPSAPQSLPEPVASAHSSSAESESTSDSDSSSDSESESSSSDSEENEPLETPAPEPEPPTTNKWQLDNWLTKVSQPAAPP
EGPRSTEPPRRHPESKGSSDSATSQEHSESKDPPPKSSSKAPRAPPEAPHPGKRSCQKSPAQQEPPQRQTVGTKQPKKPVKASARAGSRT
SLQGEREPGLLPYGSRDQTSKDKPKVKTKGRPRAAASNEPKPAVPPSSEKKKHKSSLPAPSKALSGPEPAKDNVEDRTPEHFALVPLTES
QGPPHSGSGSRTSGCRQAVVVQEDSRKDRLPLPLRDTKLLSPLRDTPPPQSLMVKITLDLLSRIPQPPGKGSRQRKAEDKQPPAGKKHSS
EKRSSDSSSKLAKKRKGEAERDCDNKKIRLEKEIKSQSSSSSSSHKESSKTKPSRPSSQSSKKEMLPPPPVSSSSQKPAKPALKRSRREA
DTCGQDPPKSASSTKSNHKDSSIPKQRRVEGKGSRSSSEHKGSSGDTANPFPVPSLPNGNSKPGKPQVKFDKQQADLHMREAKKMKQKAE
LMTDRVGKAFKYLEAVLSFIECGIATESESQSSKSAYSVYSETVDLIKFIMSLKSFSDATAPTQEKIFAVLCMRCQSILNMAMFRCKKDI
AIKYSRTLNKHFESSSKVAQAPSPCIASTGTPSPLSPMPSPASSVGSQSSAGSVGSSGVAATISTPVTIQNMTSSYVTITSHVLTAFDLW

>In-frame_KMT2A_ENST00000534358_chr11_118353210_+_AFF1_ENST00000395146_chr4_88005270_+_2228aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDYDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRYSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKYAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALYPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKQTYSNEVHCVEEILKEMTHSWPPPLTAIHTPSTAEPSKFPFPTKDSQHVSSVTQNQKQYDTSSKTHSNSQQGTSSMLE
DDLQLSDSEDSDSEQTPEKPPSSSAPPSAPQSLPEPVASAHSSSAESESTSDSDSSSDSESESSSSDSEENEPLETPAPEPEPPTTNKWQ
LDNWLTKVSQPAAPPEGPRSTEPPRRHPESKGSSDSATSQEHSESKDPPPKSSSKAPRAPPEAPHPGKRSCQKSPAQQEPPQRQTVGTKQ
PKKPVKASARAGSRTSLQGEREPGLLPYGSRDQTSKDKPKVKTKGRPRAAASNEPKPAVPPSSEKKKHKSSLPAPSKALSGPEPAKDNVE
DRTPEHFALVPLTESQGPPHSGSGSRTSGCRQAVVVQEDSRKDRLPLPLRDTKLLSPLRDTPPPQSLMVKITLDLLSRIPQPPGKGSRQR
KAEDKQPPAGKKHSSEKRSSDSSSKLAKKRKGEAERDCDNKKIRLEKEIKSQSSSSSSSHKESSKTKPSRPSSQSSKKEMLPPPPVSSSS
QKPAKPALKRSRREADTCGQDPPKSASSTKSNHKDSSIPKQRRVEGKGSRSSSEHKGSSGDTANPFPVPSLPNGNSKPGKPQVKFDKQQA
DLHMREAKKMKQKAELMTDRVGKAFKYLEAVLSFIECGIATESESQSSKSAYSVYSETVDLIKFIMSLKSFSDATAPTQEKIFAVLCMRC
QSILNMAMFRCKKDIAIKYSRTLNKHFESSSKVAQAPSPCIARSTGTPSPLSPMPSPASSVGSQSSAGSVGSSGVAATISTPVTIQNMTS

>In-frame_KMT2A_ENST00000534358_chr11_118353210_+_AFF1_ENST00000307808_chr4_88005270_+_2227aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDYDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRYSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKYAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALYPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKQTYSNEVHCVEEILKEMTHSWPPPLTAIHTPSTAEPSKFPFPTKDSQHVSSVTQNQKQYDTSSKTHSNSQQGTSSMLE
DDLQLSDSEDSDSEQTPEKPPSSSAPPSAPQSLPEPVASAHSSSAESESTSDSDSSSDSESESSSSDSEENEPLETPAPEPEPPTTNKWQ
LDNWLTKVSQPAAPPEGPRSTEPPRRHPESKGSSDSATSQEHSESKDPPPKSSSKAPRAPPEAPHPGKRSCQKSPAQQEPPQRQTVGTKQ
PKKPVKASARAGSRTSLQGEREPGLLPYGSRDQTSKDKPKVKTKGRPRAAASNEPKPAVPPSSEKKKHKSSLPAPSKALSGPEPAKDNVE
DRTPEHFALVPLTESQGPPHSGSGSRTSGCRQAVVVQEDSRKDRLPLPLRDTKLLSPLRDTPPPQSLMVKITLDLLSRIPQPPGKGSRQR
KAEDKQPPAGKKHSSEKRSSDSSSKLAKKRKGEAERDCDNKKIRLEKEIKSQSSSSSSSHKESSKTKPSRPSSQSSKKEMLPPPPVSSSS
QKPAKPALKRSRREADTCGQDPPKSASSTKSNHKDSSIPKQRRVEGKGSRSSSEHKGSSGDTANPFPVPSLPNGNSKPGKPQVKFDKQQA
DLHMREAKKMKQKAELMTDRVGKAFKYLEAVLSFIECGIATESESQSSKSAYSVYSETVDLIKFIMSLKSFSDATAPTQEKIFAVLCMRC
QSILNMAMFRCKKDIAIKYSRTLNKHFESSSKVAQAPSPCIASTGTPSPLSPMPSPASSVGSQSSAGSVGSSGVAATISTPVTIQNMTSS

>In-frame_KMT2A_ENST00000389506_chr11_118353210_+_AFF1_ENST00000395146_chr4_88005270_+_2228aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDYDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRYSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKYAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALYPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKQTYSNEVHCVEEILKEMTHSWPPPLTAIHTPSTAEPSKFPFPTKDSQHVSSVTQNQKQYDTSSKTHSNSQQGTSSMLE
DDLQLSDSEDSDSEQTPEKPPSSSAPPSAPQSLPEPVASAHSSSAESESTSDSDSSSDSESESSSSDSEENEPLETPAPEPEPPTTNKWQ
LDNWLTKVSQPAAPPEGPRSTEPPRRHPESKGSSDSATSQEHSESKDPPPKSSSKAPRAPPEAPHPGKRSCQKSPAQQEPPQRQTVGTKQ
PKKPVKASARAGSRTSLQGEREPGLLPYGSRDQTSKDKPKVKTKGRPRAAASNEPKPAVPPSSEKKKHKSSLPAPSKALSGPEPAKDNVE
DRTPEHFALVPLTESQGPPHSGSGSRTSGCRQAVVVQEDSRKDRLPLPLRDTKLLSPLRDTPPPQSLMVKITLDLLSRIPQPPGKGSRQR
KAEDKQPPAGKKHSSEKRSSDSSSKLAKKRKGEAERDCDNKKIRLEKEIKSQSSSSSSSHKESSKTKPSRPSSQSSKKEMLPPPPVSSSS
QKPAKPALKRSRREADTCGQDPPKSASSTKSNHKDSSIPKQRRVEGKGSRSSSEHKGSSGDTANPFPVPSLPNGNSKPGKPQVKFDKQQA
DLHMREAKKMKQKAELMTDRVGKAFKYLEAVLSFIECGIATESESQSSKSAYSVYSETVDLIKFIMSLKSFSDATAPTQEKIFAVLCMRC
QSILNMAMFRCKKDIAIKYSRTLNKHFESSSKVAQAPSPCIARSTGTPSPLSPMPSPASSVGSQSSAGSVGSSGVAATISTPVTIQNMTS

>In-frame_KMT2A_ENST00000389506_chr11_118353210_+_AFF1_ENST00000307808_chr4_88005270_+_2227aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDYDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRYSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKYAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALYPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKQTYSNEVHCVEEILKEMTHSWPPPLTAIHTPSTAEPSKFPFPTKDSQHVSSVTQNQKQYDTSSKTHSNSQQGTSSMLE
DDLQLSDSEDSDSEQTPEKPPSSSAPPSAPQSLPEPVASAHSSSAESESTSDSDSSSDSESESSSSDSEENEPLETPAPEPEPPTTNKWQ
LDNWLTKVSQPAAPPEGPRSTEPPRRHPESKGSSDSATSQEHSESKDPPPKSSSKAPRAPPEAPHPGKRSCQKSPAQQEPPQRQTVGTKQ
PKKPVKASARAGSRTSLQGEREPGLLPYGSRDQTSKDKPKVKTKGRPRAAASNEPKPAVPPSSEKKKHKSSLPAPSKALSGPEPAKDNVE
DRTPEHFALVPLTESQGPPHSGSGSRTSGCRQAVVVQEDSRKDRLPLPLRDTKLLSPLRDTPPPQSLMVKITLDLLSRIPQPPGKGSRQR
KAEDKQPPAGKKHSSEKRSSDSSSKLAKKRKGEAERDCDNKKIRLEKEIKSQSSSSSSSHKESSKTKPSRPSSQSSKKEMLPPPPVSSSS
QKPAKPALKRSRREADTCGQDPPKSASSTKSNHKDSSIPKQRRVEGKGSRSSSEHKGSSGDTANPFPVPSLPNGNSKPGKPQVKFDKQQA
DLHMREAKKMKQKAELMTDRVGKAFKYLEAVLSFIECGIATESESQSSKSAYSVYSETVDLIKFIMSLKSFSDATAPTQEKIFAVLCMRC
QSILNMAMFRCKKDIAIKYSRTLNKHFESSSKVAQAPSPCIASTGTPSPLSPMPSPASSVGSQSSAGSVGSSGVAATISTPVTIQNMTSS

>In-frame_KMT2A_ENST00000354520_chr11_118353210_+_AFF1_ENST00000395146_chr4_88005270_+_2228aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDYDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRYSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKYAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALYPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKQTYSNEVHCVEEILKEMTHSWPPPLTAIHTPSTAEPSKFPFPTKDSQHVSSVTQNQKQYDTSSKTHSNSQQGTSSMLE
DDLQLSDSEDSDSEQTPEKPPSSSAPPSAPQSLPEPVASAHSSSAESESTSDSDSSSDSESESSSSDSEENEPLETPAPEPEPPTTNKWQ
LDNWLTKVSQPAAPPEGPRSTEPPRRHPESKGSSDSATSQEHSESKDPPPKSSSKAPRAPPEAPHPGKRSCQKSPAQQEPPQRQTVGTKQ
PKKPVKASARAGSRTSLQGEREPGLLPYGSRDQTSKDKPKVKTKGRPRAAASNEPKPAVPPSSEKKKHKSSLPAPSKALSGPEPAKDNVE
DRTPEHFALVPLTESQGPPHSGSGSRTSGCRQAVVVQEDSRKDRLPLPLRDTKLLSPLRDTPPPQSLMVKITLDLLSRIPQPPGKGSRQR
KAEDKQPPAGKKHSSEKRSSDSSSKLAKKRKGEAERDCDNKKIRLEKEIKSQSSSSSSSHKESSKTKPSRPSSQSSKKEMLPPPPVSSSS
QKPAKPALKRSRREADTCGQDPPKSASSTKSNHKDSSIPKQRRVEGKGSRSSSEHKGSSGDTANPFPVPSLPNGNSKPGKPQVKFDKQQA
DLHMREAKKMKQKAELMTDRVGKAFKYLEAVLSFIECGIATESESQSSKSAYSVYSETVDLIKFIMSLKSFSDATAPTQEKIFAVLCMRC
QSILNMAMFRCKKDIAIKYSRTLNKHFESSSKVAQAPSPCIARSTGTPSPLSPMPSPASSVGSQSSAGSVGSSGVAATISTPVTIQNMTS

>In-frame_KMT2A_ENST00000354520_chr11_118353210_+_AFF1_ENST00000307808_chr4_88005270_+_2227aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDYDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRYSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKYAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALYPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKQTYSNEVHCVEEILKEMTHSWPPPLTAIHTPSTAEPSKFPFPTKDSQHVSSVTQNQKQYDTSSKTHSNSQQGTSSMLE
DDLQLSDSEDSDSEQTPEKPPSSSAPPSAPQSLPEPVASAHSSSAESESTSDSDSSSDSESESSSSDSEENEPLETPAPEPEPPTTNKWQ
LDNWLTKVSQPAAPPEGPRSTEPPRRHPESKGSSDSATSQEHSESKDPPPKSSSKAPRAPPEAPHPGKRSCQKSPAQQEPPQRQTVGTKQ
PKKPVKASARAGSRTSLQGEREPGLLPYGSRDQTSKDKPKVKTKGRPRAAASNEPKPAVPPSSEKKKHKSSLPAPSKALSGPEPAKDNVE
DRTPEHFALVPLTESQGPPHSGSGSRTSGCRQAVVVQEDSRKDRLPLPLRDTKLLSPLRDTPPPQSLMVKITLDLLSRIPQPPGKGSRQR
KAEDKQPPAGKKHSSEKRSSDSSSKLAKKRKGEAERDCDNKKIRLEKEIKSQSSSSSSSHKESSKTKPSRPSSQSSKKEMLPPPPVSSSS
QKPAKPALKRSRREADTCGQDPPKSASSTKSNHKDSSIPKQRRVEGKGSRSSSEHKGSSGDTANPFPVPSLPNGNSKPGKPQVKFDKQQA
DLHMREAKKMKQKAELMTDRVGKAFKYLEAVLSFIECGIATESESQSSKSAYSVYSETVDLIKFIMSLKSFSDATAPTQEKIFAVLCMRC
QSILNMAMFRCKKDIAIKYSRTLNKHFESSSKVAQAPSPCIASTGTPSPLSPMPSPASSVGSQSSAGSVGSSGVAATISTPVTIQNMTSS

>In-frame_KMT2A_ENST00000534358_chr11_118355690_+_AFF1_ENST00000395146_chr4_88005270_+_2310aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDYDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRYSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKYAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALYPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKEDCEAENVWEMGGLGILTSVPITPRVVCFLCASS
GHVEQTYSNEVHCVEEILKEMTHSWPPPLTAIHTPSTAEPSKFPFPTKDSQHVSSVTQNQKQYDTSSKTHSNSQQGTSSMLEDDLQLSDS
EDSDSEQTPEKPPSSSAPPSAPQSLPEPVASAHSSSAESESTSDSDSSSDSESESSSSDSEENEPLETPAPEPEPPTTNKWQLDNWLTKV
SQPAAPPEGPRSTEPPRRHPESKGSSDSATSQEHSESKDPPPKSSSKAPRAPPEAPHPGKRSCQKSPAQQEPPQRQTVGTKQPKKPVKAS
ARAGSRTSLQGEREPGLLPYGSRDQTSKDKPKVKTKGRPRAAASNEPKPAVPPSSEKKKHKSSLPAPSKALSGPEPAKDNVEDRTPEHFA
LVPLTESQGPPHSGSGSRTSGCRQAVVVQEDSRKDRLPLPLRDTKLLSPLRDTPPPQSLMVKITLDLLSRIPQPPGKGSRQRKAEDKQPP
AGKKHSSEKRSSDSSSKLAKKRKGEAERDCDNKKIRLEKEIKSQSSSSSSSHKESSKTKPSRPSSQSSKKEMLPPPPVSSSSQKPAKPAL
KRSRREADTCGQDPPKSASSTKSNHKDSSIPKQRRVEGKGSRSSSEHKGSSGDTANPFPVPSLPNGNSKPGKPQVKFDKQQADLHMREAK
KMKQKAELMTDRVGKAFKYLEAVLSFIECGIATESESQSSKSAYSVYSETVDLIKFIMSLKSFSDATAPTQEKIFAVLCMRCQSILNMAM
FRCKKDIAIKYSRTLNKHFESSSKVAQAPSPCIARSTGTPSPLSPMPSPASSVGSQSSAGSVGSSGVAATISTPVTIQNMTSSYVTITSH

>In-frame_KMT2A_ENST00000534358_chr11_118355690_+_AFF1_ENST00000307808_chr4_88005270_+_2309aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDYDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRYSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKYAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALYPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKEDCEAENVWEMGGLGILTSVPITPRVVCFLCASS
GHVEQTYSNEVHCVEEILKEMTHSWPPPLTAIHTPSTAEPSKFPFPTKDSQHVSSVTQNQKQYDTSSKTHSNSQQGTSSMLEDDLQLSDS
EDSDSEQTPEKPPSSSAPPSAPQSLPEPVASAHSSSAESESTSDSDSSSDSESESSSSDSEENEPLETPAPEPEPPTTNKWQLDNWLTKV
SQPAAPPEGPRSTEPPRRHPESKGSSDSATSQEHSESKDPPPKSSSKAPRAPPEAPHPGKRSCQKSPAQQEPPQRQTVGTKQPKKPVKAS
ARAGSRTSLQGEREPGLLPYGSRDQTSKDKPKVKTKGRPRAAASNEPKPAVPPSSEKKKHKSSLPAPSKALSGPEPAKDNVEDRTPEHFA
LVPLTESQGPPHSGSGSRTSGCRQAVVVQEDSRKDRLPLPLRDTKLLSPLRDTPPPQSLMVKITLDLLSRIPQPPGKGSRQRKAEDKQPP
AGKKHSSEKRSSDSSSKLAKKRKGEAERDCDNKKIRLEKEIKSQSSSSSSSHKESSKTKPSRPSSQSSKKEMLPPPPVSSSSQKPAKPAL
KRSRREADTCGQDPPKSASSTKSNHKDSSIPKQRRVEGKGSRSSSEHKGSSGDTANPFPVPSLPNGNSKPGKPQVKFDKQQADLHMREAK
KMKQKAELMTDRVGKAFKYLEAVLSFIECGIATESESQSSKSAYSVYSETVDLIKFIMSLKSFSDATAPTQEKIFAVLCMRCQSILNMAM
FRCKKDIAIKYSRTLNKHFESSSKVAQAPSPCIASTGTPSPLSPMPSPASSVGSQSSAGSVGSSGVAATISTPVTIQNMTSSYVTITSHV

>In-frame_KMT2A_ENST00000389506_chr11_118355690_+_AFF1_ENST00000395146_chr4_88005270_+_2310aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDYDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRYSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKYAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALYPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKEDCEAENVWEMGGLGILTSVPITPRVVCFLCASS
GHVEQTYSNEVHCVEEILKEMTHSWPPPLTAIHTPSTAEPSKFPFPTKDSQHVSSVTQNQKQYDTSSKTHSNSQQGTSSMLEDDLQLSDS
EDSDSEQTPEKPPSSSAPPSAPQSLPEPVASAHSSSAESESTSDSDSSSDSESESSSSDSEENEPLETPAPEPEPPTTNKWQLDNWLTKV
SQPAAPPEGPRSTEPPRRHPESKGSSDSATSQEHSESKDPPPKSSSKAPRAPPEAPHPGKRSCQKSPAQQEPPQRQTVGTKQPKKPVKAS
ARAGSRTSLQGEREPGLLPYGSRDQTSKDKPKVKTKGRPRAAASNEPKPAVPPSSEKKKHKSSLPAPSKALSGPEPAKDNVEDRTPEHFA
LVPLTESQGPPHSGSGSRTSGCRQAVVVQEDSRKDRLPLPLRDTKLLSPLRDTPPPQSLMVKITLDLLSRIPQPPGKGSRQRKAEDKQPP
AGKKHSSEKRSSDSSSKLAKKRKGEAERDCDNKKIRLEKEIKSQSSSSSSSHKESSKTKPSRPSSQSSKKEMLPPPPVSSSSQKPAKPAL
KRSRREADTCGQDPPKSASSTKSNHKDSSIPKQRRVEGKGSRSSSEHKGSSGDTANPFPVPSLPNGNSKPGKPQVKFDKQQADLHMREAK
KMKQKAELMTDRVGKAFKYLEAVLSFIECGIATESESQSSKSAYSVYSETVDLIKFIMSLKSFSDATAPTQEKIFAVLCMRCQSILNMAM
FRCKKDIAIKYSRTLNKHFESSSKVAQAPSPCIARSTGTPSPLSPMPSPASSVGSQSSAGSVGSSGVAATISTPVTIQNMTSSYVTITSH

>In-frame_KMT2A_ENST00000389506_chr11_118355690_+_AFF1_ENST00000307808_chr4_88005270_+_2309aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDYDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRYSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKYAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALYPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKEDCEAENVWEMGGLGILTSVPITPRVVCFLCASS
GHVEQTYSNEVHCVEEILKEMTHSWPPPLTAIHTPSTAEPSKFPFPTKDSQHVSSVTQNQKQYDTSSKTHSNSQQGTSSMLEDDLQLSDS
EDSDSEQTPEKPPSSSAPPSAPQSLPEPVASAHSSSAESESTSDSDSSSDSESESSSSDSEENEPLETPAPEPEPPTTNKWQLDNWLTKV
SQPAAPPEGPRSTEPPRRHPESKGSSDSATSQEHSESKDPPPKSSSKAPRAPPEAPHPGKRSCQKSPAQQEPPQRQTVGTKQPKKPVKAS
ARAGSRTSLQGEREPGLLPYGSRDQTSKDKPKVKTKGRPRAAASNEPKPAVPPSSEKKKHKSSLPAPSKALSGPEPAKDNVEDRTPEHFA
LVPLTESQGPPHSGSGSRTSGCRQAVVVQEDSRKDRLPLPLRDTKLLSPLRDTPPPQSLMVKITLDLLSRIPQPPGKGSRQRKAEDKQPP
AGKKHSSEKRSSDSSSKLAKKRKGEAERDCDNKKIRLEKEIKSQSSSSSSSHKESSKTKPSRPSSQSSKKEMLPPPPVSSSSQKPAKPAL
KRSRREADTCGQDPPKSASSTKSNHKDSSIPKQRRVEGKGSRSSSEHKGSSGDTANPFPVPSLPNGNSKPGKPQVKFDKQQADLHMREAK
KMKQKAELMTDRVGKAFKYLEAVLSFIECGIATESESQSSKSAYSVYSETVDLIKFIMSLKSFSDATAPTQEKIFAVLCMRCQSILNMAM
FRCKKDIAIKYSRTLNKHFESSSKVAQAPSPCIASTGTPSPLSPMPSPASSVGSQSSAGSVGSSGVAATISTPVTIQNMTSSYVTITSHV

>In-frame_KMT2A_ENST00000534358_chr11_118355622_-_AFF1_ENST00000395146_chr4_87968221_+_0aa

>In-frame_KMT2A_ENST00000534358_chr11_118355622_-_AFF1_ENST00000307808_chr4_87968221_+_0aa

>In-frame_KMT2A_ENST00000389506_chr11_118355622_-_AFF1_ENST00000395146_chr4_87968221_+_0aa

>In-frame_KMT2A_ENST00000389506_chr11_118355622_-_AFF1_ENST00000307808_chr4_87968221_+_0aa

>In-frame_KMT2A_ENST00000534358_chr11_118353211_+_AFF1_ENST00000395146_chr4_88011134_+_2213aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDYDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRYSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKYAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALYPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEMTHSWPPPLTAIHTPSTAEPSKFPFPTKDSQHVSSVTQNQKQYDTSSKTHSNSQQGTSSMLEDDLQLSDSEDSDSEQ
TPEKPPSSSAPPSAPQSLPEPVASAHSSSAESESTSDSDSSSDSESESSSSDSEENEPLETPAPEPEPPTTNKWQLDNWLTKVSQPAAPP
EGPRSTEPPRRHPESKGSSDSATSQEHSESKDPPPKSSSKAPRAPPEAPHPGKRSCQKSPAQQEPPQRQTVGTKQPKKPVKASARAGSRT
SLQGEREPGLLPYGSRDQTSKDKPKVKTKGRPRAAASNEPKPAVPPSSEKKKHKSSLPAPSKALSGPEPAKDNVEDRTPEHFALVPLTES
QGPPHSGSGSRTSGCRQAVVVQEDSRKDRLPLPLRDTKLLSPLRDTPPPQSLMVKITLDLLSRIPQPPGKGSRQRKAEDKQPPAGKKHSS
EKRSSDSSSKLAKKRKGEAERDCDNKKIRLEKEIKSQSSSSSSSHKESSKTKPSRPSSQSSKKEMLPPPPVSSSSQKPAKPALKRSRREA
DTCGQDPPKSASSTKSNHKDSSIPKQRRVEGKGSRSSSEHKGSSGDTANPFPVPSLPNGNSKPGKPQVKFDKQQADLHMREAKKMKQKAE
LMTDRVGKAFKYLEAVLSFIECGIATESESQSSKSAYSVYSETVDLIKFIMSLKSFSDATAPTQEKIFAVLCMRCQSILNMAMFRCKKDI
AIKYSRTLNKHFESSSKVAQAPSPCIARSTGTPSPLSPMPSPASSVGSQSSAGSVGSSGVAATISTPVTIQNMTSSYVTITSHVLTAFDL

>In-frame_KMT2A_ENST00000534358_chr11_118353211_+_AFF1_ENST00000307808_chr4_88011134_+_2212aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDYDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRYSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKYAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALYPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEMTHSWPPPLTAIHTPSTAEPSKFPFPTKDSQHVSSVTQNQKQYDTSSKTHSNSQQGTSSMLEDDLQLSDSEDSDSEQ
TPEKPPSSSAPPSAPQSLPEPVASAHSSSAESESTSDSDSSSDSESESSSSDSEENEPLETPAPEPEPPTTNKWQLDNWLTKVSQPAAPP
EGPRSTEPPRRHPESKGSSDSATSQEHSESKDPPPKSSSKAPRAPPEAPHPGKRSCQKSPAQQEPPQRQTVGTKQPKKPVKASARAGSRT
SLQGEREPGLLPYGSRDQTSKDKPKVKTKGRPRAAASNEPKPAVPPSSEKKKHKSSLPAPSKALSGPEPAKDNVEDRTPEHFALVPLTES
QGPPHSGSGSRTSGCRQAVVVQEDSRKDRLPLPLRDTKLLSPLRDTPPPQSLMVKITLDLLSRIPQPPGKGSRQRKAEDKQPPAGKKHSS
EKRSSDSSSKLAKKRKGEAERDCDNKKIRLEKEIKSQSSSSSSSHKESSKTKPSRPSSQSSKKEMLPPPPVSSSSQKPAKPALKRSRREA
DTCGQDPPKSASSTKSNHKDSSIPKQRRVEGKGSRSSSEHKGSSGDTANPFPVPSLPNGNSKPGKPQVKFDKQQADLHMREAKKMKQKAE
LMTDRVGKAFKYLEAVLSFIECGIATESESQSSKSAYSVYSETVDLIKFIMSLKSFSDATAPTQEKIFAVLCMRCQSILNMAMFRCKKDI
AIKYSRTLNKHFESSSKVAQAPSPCIASTGTPSPLSPMPSPASSVGSQSSAGSVGSSGVAATISTPVTIQNMTSSYVTITSHVLTAFDLW

>In-frame_KMT2A_ENST00000389506_chr11_118353211_+_AFF1_ENST00000395146_chr4_88011134_+_2213aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDYDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRYSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKYAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALYPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEMTHSWPPPLTAIHTPSTAEPSKFPFPTKDSQHVSSVTQNQKQYDTSSKTHSNSQQGTSSMLEDDLQLSDSEDSDSEQ
TPEKPPSSSAPPSAPQSLPEPVASAHSSSAESESTSDSDSSSDSESESSSSDSEENEPLETPAPEPEPPTTNKWQLDNWLTKVSQPAAPP
EGPRSTEPPRRHPESKGSSDSATSQEHSESKDPPPKSSSKAPRAPPEAPHPGKRSCQKSPAQQEPPQRQTVGTKQPKKPVKASARAGSRT
SLQGEREPGLLPYGSRDQTSKDKPKVKTKGRPRAAASNEPKPAVPPSSEKKKHKSSLPAPSKALSGPEPAKDNVEDRTPEHFALVPLTES
QGPPHSGSGSRTSGCRQAVVVQEDSRKDRLPLPLRDTKLLSPLRDTPPPQSLMVKITLDLLSRIPQPPGKGSRQRKAEDKQPPAGKKHSS
EKRSSDSSSKLAKKRKGEAERDCDNKKIRLEKEIKSQSSSSSSSHKESSKTKPSRPSSQSSKKEMLPPPPVSSSSQKPAKPALKRSRREA
DTCGQDPPKSASSTKSNHKDSSIPKQRRVEGKGSRSSSEHKGSSGDTANPFPVPSLPNGNSKPGKPQVKFDKQQADLHMREAKKMKQKAE
LMTDRVGKAFKYLEAVLSFIECGIATESESQSSKSAYSVYSETVDLIKFIMSLKSFSDATAPTQEKIFAVLCMRCQSILNMAMFRCKKDI
AIKYSRTLNKHFESSSKVAQAPSPCIARSTGTPSPLSPMPSPASSVGSQSSAGSVGSSGVAATISTPVTIQNMTSSYVTITSHVLTAFDL

>In-frame_KMT2A_ENST00000389506_chr11_118353211_+_AFF1_ENST00000307808_chr4_88011134_+_2212aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDYDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRYSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKYAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALYPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEMTHSWPPPLTAIHTPSTAEPSKFPFPTKDSQHVSSVTQNQKQYDTSSKTHSNSQQGTSSMLEDDLQLSDSEDSDSEQ
TPEKPPSSSAPPSAPQSLPEPVASAHSSSAESESTSDSDSSSDSESESSSSDSEENEPLETPAPEPEPPTTNKWQLDNWLTKVSQPAAPP
EGPRSTEPPRRHPESKGSSDSATSQEHSESKDPPPKSSSKAPRAPPEAPHPGKRSCQKSPAQQEPPQRQTVGTKQPKKPVKASARAGSRT
SLQGEREPGLLPYGSRDQTSKDKPKVKTKGRPRAAASNEPKPAVPPSSEKKKHKSSLPAPSKALSGPEPAKDNVEDRTPEHFALVPLTES
QGPPHSGSGSRTSGCRQAVVVQEDSRKDRLPLPLRDTKLLSPLRDTPPPQSLMVKITLDLLSRIPQPPGKGSRQRKAEDKQPPAGKKHSS
EKRSSDSSSKLAKKRKGEAERDCDNKKIRLEKEIKSQSSSSSSSHKESSKTKPSRPSSQSSKKEMLPPPPVSSSSQKPAKPALKRSRREA
DTCGQDPPKSASSTKSNHKDSSIPKQRRVEGKGSRSSSEHKGSSGDTANPFPVPSLPNGNSKPGKPQVKFDKQQADLHMREAKKMKQKAE
LMTDRVGKAFKYLEAVLSFIECGIATESESQSSKSAYSVYSETVDLIKFIMSLKSFSDATAPTQEKIFAVLCMRCQSILNMAMFRCKKDI
AIKYSRTLNKHFESSSKVAQAPSPCIASTGTPSPLSPMPSPASSVGSQSSAGSVGSSGVAATISTPVTIQNMTSSYVTITSHVLTAFDLW

>In-frame_KMT2A_ENST00000354520_chr11_118353211_+_AFF1_ENST00000395146_chr4_88011134_+_2213aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDYDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRYSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKYAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALYPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEMTHSWPPPLTAIHTPSTAEPSKFPFPTKDSQHVSSVTQNQKQYDTSSKTHSNSQQGTSSMLEDDLQLSDSEDSDSEQ
TPEKPPSSSAPPSAPQSLPEPVASAHSSSAESESTSDSDSSSDSESESSSSDSEENEPLETPAPEPEPPTTNKWQLDNWLTKVSQPAAPP
EGPRSTEPPRRHPESKGSSDSATSQEHSESKDPPPKSSSKAPRAPPEAPHPGKRSCQKSPAQQEPPQRQTVGTKQPKKPVKASARAGSRT
SLQGEREPGLLPYGSRDQTSKDKPKVKTKGRPRAAASNEPKPAVPPSSEKKKHKSSLPAPSKALSGPEPAKDNVEDRTPEHFALVPLTES
QGPPHSGSGSRTSGCRQAVVVQEDSRKDRLPLPLRDTKLLSPLRDTPPPQSLMVKITLDLLSRIPQPPGKGSRQRKAEDKQPPAGKKHSS
EKRSSDSSSKLAKKRKGEAERDCDNKKIRLEKEIKSQSSSSSSSHKESSKTKPSRPSSQSSKKEMLPPPPVSSSSQKPAKPALKRSRREA
DTCGQDPPKSASSTKSNHKDSSIPKQRRVEGKGSRSSSEHKGSSGDTANPFPVPSLPNGNSKPGKPQVKFDKQQADLHMREAKKMKQKAE
LMTDRVGKAFKYLEAVLSFIECGIATESESQSSKSAYSVYSETVDLIKFIMSLKSFSDATAPTQEKIFAVLCMRCQSILNMAMFRCKKDI
AIKYSRTLNKHFESSSKVAQAPSPCIARSTGTPSPLSPMPSPASSVGSQSSAGSVGSSGVAATISTPVTIQNMTSSYVTITSHVLTAFDL

>In-frame_KMT2A_ENST00000354520_chr11_118353211_+_AFF1_ENST00000307808_chr4_88011134_+_2212aa
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSAS
SSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKI
KKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDYDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRYSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
YFSSAKYAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESA
EKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALYPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLC
LSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC
TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEMTHSWPPPLTAIHTPSTAEPSKFPFPTKDSQHVSSVTQNQKQYDTSSKTHSNSQQGTSSMLEDDLQLSDSEDSDSEQ
TPEKPPSSSAPPSAPQSLPEPVASAHSSSAESESTSDSDSSSDSESESSSSDSEENEPLETPAPEPEPPTTNKWQLDNWLTKVSQPAAPP
EGPRSTEPPRRHPESKGSSDSATSQEHSESKDPPPKSSSKAPRAPPEAPHPGKRSCQKSPAQQEPPQRQTVGTKQPKKPVKASARAGSRT
SLQGEREPGLLPYGSRDQTSKDKPKVKTKGRPRAAASNEPKPAVPPSSEKKKHKSSLPAPSKALSGPEPAKDNVEDRTPEHFALVPLTES
QGPPHSGSGSRTSGCRQAVVVQEDSRKDRLPLPLRDTKLLSPLRDTPPPQSLMVKITLDLLSRIPQPPGKGSRQRKAEDKQPPAGKKHSS
EKRSSDSSSKLAKKRKGEAERDCDNKKIRLEKEIKSQSSSSSSSHKESSKTKPSRPSSQSSKKEMLPPPPVSSSSQKPAKPALKRSRREA
DTCGQDPPKSASSTKSNHKDSSIPKQRRVEGKGSRSSSEHKGSSGDTANPFPVPSLPNGNSKPGKPQVKFDKQQADLHMREAKKMKQKAE
LMTDRVGKAFKYLEAVLSFIECGIATESESQSSKSAYSVYSETVDLIKFIMSLKSFSDATAPTQEKIFAVLCMRCQSILNMAMFRCKKDI
AIKYSRTLNKHFESSSKVAQAPSPCIASTGTPSPLSPMPSPASSVGSQSSAGSVGSSGVAATISTPVTIQNMTSSYVTITSHVLTAFDLW


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_KMT2A_ENST00000534358_chr11_118353211_+_AFF1_ENST00000395146_chr4_88012943_+_6552nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGACTCTCAGCATGTCAGTTCTGTAACCCAAAACCAAAAACAATATGATACATCT
TCAAAAACTCACTCAAATTCTCAGCAAGGAACGTCATCCATGCTCGAAGACGACCTTCAGCTCAGTGACAGTGAGGACAGTGACAGTGAA
CAAACCCCAGAGAAGCCTCCCTCCTCATCTGCACCTCCAAGTGCTCCACAGTCCCTTCCAGAACCAGTGGCATCAGCACATTCCAGCAGT
GCAGAGTCAGAAAGCACCAGTGACTCAGACAGTTCCTCAGACTCAGAGAGCGAGAGCAGTTCAAGTGACAGCGAAGAAAATGAGCCCCTA
GAAACCCCAGCTCCGGAGCCTGAGCCTCCAACAACAAACAAATGGCAGCTGGACAACTGGCTGACCAAAGTCAGCCAGCCAGCTGCGCCA
CCAGAGGGCCCCAGGAGCACAGAGCCCCCACGGCGGCACCCAGAGAGTAAGGGCAGCAGCGACAGTGCCACGAGTCAGGAGCATTCTGAA
TCCAAAGATCCTCCCCCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCACCCGAAGCCCCCCACCCCGGAAAGAGGAGCTGTCAGAAGTCT
CCGGCACAGCAGGAGCCCCCACAAAGGCAAACCGTTGGAACCAAACAACCCAAAAAACCTGTCAAGGCCTCTGCCCGGGCAGGTTCACGG
ACCAGCCTGCAGGGGGAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCCCGAGACCAGACTTCCAAAGACAAGCCCAAGGTGAAGACGAAA
GGACGGCCCCGGGCCGCAGCAAGCAACGAACCCAAGCCAGCAGTGCCCCCCTCCAGTGAGAAGAAGAAGCACAAGAGCTCCCTCCCTGCC
CCCTCTAAGGCTCTCTCAGGCCCAGAACCCGCGAAGGACAATGTGGAGGACAGGACCCCTGAGCACTTTGCTCTTGTTCCCCTGACTGAG
AGCCAGGGCCCACCCCACAGTGGCAGCGGCAGCAGGACTAGTGGCTGCCGCCAAGCCGTGGTGGTCCAGGAGGACAGCCGCAAAGACAGA
CTCCCATTGCCTTTGAGAGACACCAAGCTGCTCTCACCGCTCAGGGACACTCCTCCCCCACAAAGCTTGATGGTGAAGATCACCCTAGAC
CTGCTCTCTCGGATACCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGGAAAGCAGAAGATAAACAGCCGCCCGCAGGGAAGAAGCACAGC
TCTGAGAAGAGGAGCTCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGAAAGGGTGAAGCAGAAAGAGACTGTGATAACAAGAAAATCAGA
CTGGAGAAGGAAATCAAATCACAGTCATCTTCATCTTCATCCTCCCACAAAGAATCTTCTAAAACAAAGCCCTCCAGGCCCTCCTCACAG
TCCTCAAAGAAGGAAATGCTCCCCCCGCCACCCGTGTCCTCGTCCTCCCAGAAGCCAGCCAAGCCTGCACTTAAGAGGTCAAGGCGGGAA
GCAGACACCTGTGGCCAGGACCCTCCCAAAAGTGCCAGCAGTACCAAGAGCAACCACAAAGACTCTTCCATTCCCAAGCAGAGAAGAGTA
GAGGGGAAGGGCTCCAGAAGCTCCTCGGAGCACAAGGGTTCTTCCGGAGATACTGCAAATCCTTTTCCAGTGCCTTCTTTGCCAAATGGT
AACTCTAAACCAGGGAAGCCTCAAGTGAAGTTTGACAAACAACAAGCAGACCTTCACATGAGGGAGGCAAAAAAGATGAAGCAGAAAGCA
GAGTTAATGACGGACAGGGTTGGAAAGGCTTTTAAGTACCTGGAAGCCGTCTTGTCCTTCATTGAGTGCGGAATTGCCACAGAGTCTGAA
AGCCAGTCATCCAAGTCAGCTTACTCTGTCTACTCAGAAACTGTAGATCTCATTAAATTCATAATGTCATTAAAATCCTTCTCAGATGCC
ACAGCGCCAACACAAGAGAAAATATTTGCTGTTTTATGCATGCGTTGCCAGTCCATTTTGAACATGGCGATGTTTCGTTGTAAAAAAGAC
ATAGCAATAAAGTATTCTCGTACTCTTAATAAACACTTCGAGAGTTCTTCCAAAGTCGCCCAGGCACCTTCTCCATGCATTGCAAGAAGC
ACAGGCACACCATCCCCTCTTTCCCCAATGCCTTCTCCTGCCAGCTCCGTAGGGTCCCAGTCAAGTGCTGGCAGTGTGGGGAGCAGTGGG
GTGGCTGCCACTATCAGCACCCCAGTCACCATCCAGAATATGACATCTTCCTATGTCACCATCACATCCCATGTTCTTACCGCCTTTGAC
CTTTGGGAACAGGCCGAGGCCCTCACGAGGAAGAATAAAGAATTCTTTGCTCGGCTCAGCACAAATGTGTGCACCTTGGCCCTCAACAGC

>In-frame_KMT2A_ENST00000534358_chr11_118353211_+_AFF1_ENST00000307808_chr4_88012943_+_6549nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGACTCTCAGCATGTCAGTTCTGTAACCCAAAACCAAAAACAATATGATACATCT
TCAAAAACTCACTCAAATTCTCAGCAAGGAACGTCATCCATGCTCGAAGACGACCTTCAGCTCAGTGACAGTGAGGACAGTGACAGTGAA
CAAACCCCAGAGAAGCCTCCCTCCTCATCTGCACCTCCAAGTGCTCCACAGTCCCTTCCAGAACCAGTGGCATCAGCACATTCCAGCAGT
GCAGAGTCAGAAAGCACCAGTGACTCAGACAGTTCCTCAGACTCAGAGAGCGAGAGCAGTTCAAGTGACAGCGAAGAAAATGAGCCCCTA
GAAACCCCAGCTCCGGAGCCTGAGCCTCCAACAACAAACAAATGGCAGCTGGACAACTGGCTGACCAAAGTCAGCCAGCCAGCTGCGCCA
CCAGAGGGCCCCAGGAGCACAGAGCCCCCACGGCGGCACCCAGAGAGTAAGGGCAGCAGCGACAGTGCCACGAGTCAGGAGCATTCTGAA
TCCAAAGATCCTCCCCCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCACCCGAAGCCCCCCACCCCGGAAAGAGGAGCTGTCAGAAGTCT
CCGGCACAGCAGGAGCCCCCACAAAGGCAAACCGTTGGAACCAAACAACCCAAAAAACCTGTCAAGGCCTCTGCCCGGGCAGGTTCACGG
ACCAGCCTGCAGGGGGAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCCCGAGACCAGACTTCCAAAGACAAGCCCAAGGTGAAGACGAAA
GGACGGCCCCGGGCCGCAGCAAGCAACGAACCCAAGCCAGCAGTGCCCCCCTCCAGTGAGAAGAAGAAGCACAAGAGCTCCCTCCCTGCC
CCCTCTAAGGCTCTCTCAGGCCCAGAACCCGCGAAGGACAATGTGGAGGACAGGACCCCTGAGCACTTTGCTCTTGTTCCCCTGACTGAG
AGCCAGGGCCCACCCCACAGTGGCAGCGGCAGCAGGACTAGTGGCTGCCGCCAAGCCGTGGTGGTCCAGGAGGACAGCCGCAAAGACAGA
CTCCCATTGCCTTTGAGAGACACCAAGCTGCTCTCACCGCTCAGGGACACTCCTCCCCCACAAAGCTTGATGGTGAAGATCACCCTAGAC
CTGCTCTCTCGGATACCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGGAAAGCAGAAGATAAACAGCCGCCCGCAGGGAAGAAGCACAGC
TCTGAGAAGAGGAGCTCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGAAAGGGTGAAGCAGAAAGAGACTGTGATAACAAGAAAATCAGA
CTGGAGAAGGAAATCAAATCACAGTCATCTTCATCTTCATCCTCCCACAAAGAATCTTCTAAAACAAAGCCCTCCAGGCCCTCCTCACAG
TCCTCAAAGAAGGAAATGCTCCCCCCGCCACCCGTGTCCTCGTCCTCCCAGAAGCCAGCCAAGCCTGCACTTAAGAGGTCAAGGCGGGAA
GCAGACACCTGTGGCCAGGACCCTCCCAAAAGTGCCAGCAGTACCAAGAGCAACCACAAAGACTCTTCCATTCCCAAGCAGAGAAGAGTA
GAGGGGAAGGGCTCCAGAAGCTCCTCGGAGCACAAGGGTTCTTCCGGAGATACTGCAAATCCTTTTCCAGTGCCTTCTTTGCCAAATGGT
AACTCTAAACCAGGGAAGCCTCAAGTGAAGTTTGACAAACAACAAGCAGACCTTCACATGAGGGAGGCAAAAAAGATGAAGCAGAAAGCA
GAGTTAATGACGGACAGGGTTGGAAAGGCTTTTAAGTACCTGGAAGCCGTCTTGTCCTTCATTGAGTGCGGAATTGCCACAGAGTCTGAA
AGCCAGTCATCCAAGTCAGCTTACTCTGTCTACTCAGAAACTGTAGATCTCATTAAATTCATAATGTCATTAAAATCCTTCTCAGATGCC
ACAGCGCCAACACAAGAGAAAATATTTGCTGTTTTATGCATGCGTTGCCAGTCCATTTTGAACATGGCGATGTTTCGTTGTAAAAAAGAC
ATAGCAATAAAGTATTCTCGTACTCTTAATAAACACTTCGAGAGTTCTTCCAAAGTCGCCCAGGCACCTTCTCCATGCATTGCAAGCACA
GGCACACCATCCCCTCTTTCCCCAATGCCTTCTCCTGCCAGCTCCGTAGGGTCCCAGTCAAGTGCTGGCAGTGTGGGGAGCAGTGGGGTG
GCTGCCACTATCAGCACCCCAGTCACCATCCAGAATATGACATCTTCCTATGTCACCATCACATCCCATGTTCTTACCGCCTTTGACCTT
TGGGAACAGGCCGAGGCCCTCACGAGGAAGAATAAAGAATTCTTTGCTCGGCTCAGCACAAATGTGTGCACCTTGGCCCTCAACAGCAGT

>In-frame_KMT2A_ENST00000534358_chr11_118353211_+_AFF1_ENST00000544085_chr4_88012943_+_6552nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGACTCTCAGCATGTCAGTTCTGTAACCCAAAACCAAAAACAATATGATACATCT
TCAAAAACTCACTCAAATTCTCAGCAAGGAACGTCATCCATGCTCGAAGACGACCTTCAGCTCAGTGACAGTGAGGACAGTGACAGTGAA
CAAACCCCAGAGAAGCCTCCCTCCTCATCTGCACCTCCAAGTGCTCCACAGTCCCTTCCAGAACCAGTGGCATCAGCACATTCCAGCAGT
GCAGAGTCAGAAAGCACCAGTGACTCAGACAGTTCCTCAGACTCAGAGAGCGAGAGCAGTTCAAGTGACAGCGAAGAAAATGAGCCCCTA
GAAACCCCAGCTCCGGAGCCTGAGCCTCCAACAACAAACAAATGGCAGCTGGACAACTGGCTGACCAAAGTCAGCCAGCCAGCTGCGCCA
CCAGAGGGCCCCAGGAGCACAGAGCCCCCACGGCGGCACCCAGAGAGTAAGGGCAGCAGCGACAGTGCCACGAGTCAGGAGCATTCTGAA
TCCAAAGATCCTCCCCCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCACCCGAAGCCCCCCACCCCGGAAAGAGGAGCTGTCAGAAGTCT
CCGGCACAGCAGGAGCCCCCACAAAGGCAAACCGTTGGAACCAAACAACCCAAAAAACCTGTCAAGGCCTCTGCCCGGGCAGGTTCACGG
ACCAGCCTGCAGGGGGAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCCCGAGACCAGACTTCCAAAGACAAGCCCAAGGTGAAGACGAAA
GGACGGCCCCGGGCCGCAGCAAGCAACGAACCCAAGCCAGCAGTGCCCCCCTCCAGTGAGAAGAAGAAGCACAAGAGCTCCCTCCCTGCC
CCCTCTAAGGCTCTCTCAGGCCCAGAACCCGCGAAGGACAATGTGGAGGACAGGACCCCTGAGCACTTTGCTCTTGTTCCCCTGACTGAG
AGCCAGGGCCCACCCCACAGTGGCAGCGGCAGCAGGACTAGTGGCTGCCGCCAAGCCGTGGTGGTCCAGGAGGACAGCCGCAAAGACAGA
CTCCCATTGCCTTTGAGAGACACCAAGCTGCTCTCACCGCTCAGGGACACTCCTCCCCCACAAAGCTTGATGGTGAAGATCACCCTAGAC
CTGCTCTCTCGGATACCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGGAAAGCAGAAGATAAACAGCCGCCCGCAGGGAAGAAGCACAGC
TCTGAGAAGAGGAGCTCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGAAAGGGTGAAGCAGAAAGAGACTGTGATAACAAGAAAATCAGA
CTGGAGAAGGAAATCAAATCACAGTCATCTTCATCTTCATCCTCCCACAAAGAATCTTCTAAAACAAAGCCCTCCAGGCCCTCCTCACAG
TCCTCAAAGAAGGAAATGCTCCCCCCGCCACCCGTGTCCTCGTCCTCCCAGAAGCCAGCCAAGCCTGCACTTAAGAGGTCAAGGCGGGAA
GCAGACACCTGTGGCCAGGACCCTCCCAAAAGTGCCAGCAGTACCAAGAGCAACCACAAAGACTCTTCCATTCCCAAGCAGAGAAGAGTA
GAGGGGAAGGGCTCCAGAAGCTCCTCGGAGCACAAGGGTTCTTCCGGAGATACTGCAAATCCTTTTCCAGTGCCTTCTTTGCCAAATGGT
AACTCTAAACCAGGGAAGCCTCAAGTGAAGTTTGACAAACAACAAGCAGACCTTCACATGAGGGAGGCAAAAAAGATGAAGCAGAAAGCA
GAGTTAATGACGGACAGGGTTGGAAAGGCTTTTAAGTACCTGGAAGCCGTCTTGTCCTTCATTGAGTGCGGAATTGCCACAGAGTCTGAA
AGCCAGTCATCCAAGTCAGCTTACTCTGTCTACTCAGAAACTGTAGATCTCATTAAATTCATAATGTCATTAAAATCCTTCTCAGATGCC
ACAGCGCCAACACAAGAGAAAATATTTGCTGTTTTATGCATGCGTTGCCAGTCCATTTTGAACATGGCGATGTTTCGTTGTAAAAAAGAC
ATAGCAATAAAGTATTCTCGTACTCTTAATAAACACTTCGAGAGTTCTTCCAAAGTCGCCCAGGCACCTTCTCCATGCATTGCAAGAAGC
ACAGGCACACCATCCCCTCTTTCCCCAATGCCTTCTCCTGCCAGCTCCGTAGGGTCCCAGTCAAGTGCTGGCAGTGTGGGGAGCAGTGGG
GTGGCTGCCACTATCAGCACCCCAGTCACCATCCAGAATATGACATCTTCCTATGTCACCATCACATCCCATGTTCTTACCGCCTTTGAC
CTTTGGGAACAGGCCGAGGCCCTCACGAGGAAGAATAAAGAATTCTTTGCTCGGCTCAGCACAAATGTGTGCACCTTGGCCCTCAACAGC

>In-frame_KMT2A_ENST00000389506_chr11_118353211_+_AFF1_ENST00000395146_chr4_88012943_+_6552nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGACTCTCAGCATGTCAGTTCTGTAACCCAAAACCAAAAACAATATGATACATCT
TCAAAAACTCACTCAAATTCTCAGCAAGGAACGTCATCCATGCTCGAAGACGACCTTCAGCTCAGTGACAGTGAGGACAGTGACAGTGAA
CAAACCCCAGAGAAGCCTCCCTCCTCATCTGCACCTCCAAGTGCTCCACAGTCCCTTCCAGAACCAGTGGCATCAGCACATTCCAGCAGT
GCAGAGTCAGAAAGCACCAGTGACTCAGACAGTTCCTCAGACTCAGAGAGCGAGAGCAGTTCAAGTGACAGCGAAGAAAATGAGCCCCTA
GAAACCCCAGCTCCGGAGCCTGAGCCTCCAACAACAAACAAATGGCAGCTGGACAACTGGCTGACCAAAGTCAGCCAGCCAGCTGCGCCA
CCAGAGGGCCCCAGGAGCACAGAGCCCCCACGGCGGCACCCAGAGAGTAAGGGCAGCAGCGACAGTGCCACGAGTCAGGAGCATTCTGAA
TCCAAAGATCCTCCCCCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCACCCGAAGCCCCCCACCCCGGAAAGAGGAGCTGTCAGAAGTCT
CCGGCACAGCAGGAGCCCCCACAAAGGCAAACCGTTGGAACCAAACAACCCAAAAAACCTGTCAAGGCCTCTGCCCGGGCAGGTTCACGG
ACCAGCCTGCAGGGGGAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCCCGAGACCAGACTTCCAAAGACAAGCCCAAGGTGAAGACGAAA
GGACGGCCCCGGGCCGCAGCAAGCAACGAACCCAAGCCAGCAGTGCCCCCCTCCAGTGAGAAGAAGAAGCACAAGAGCTCCCTCCCTGCC
CCCTCTAAGGCTCTCTCAGGCCCAGAACCCGCGAAGGACAATGTGGAGGACAGGACCCCTGAGCACTTTGCTCTTGTTCCCCTGACTGAG
AGCCAGGGCCCACCCCACAGTGGCAGCGGCAGCAGGACTAGTGGCTGCCGCCAAGCCGTGGTGGTCCAGGAGGACAGCCGCAAAGACAGA
CTCCCATTGCCTTTGAGAGACACCAAGCTGCTCTCACCGCTCAGGGACACTCCTCCCCCACAAAGCTTGATGGTGAAGATCACCCTAGAC
CTGCTCTCTCGGATACCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGGAAAGCAGAAGATAAACAGCCGCCCGCAGGGAAGAAGCACAGC
TCTGAGAAGAGGAGCTCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGAAAGGGTGAAGCAGAAAGAGACTGTGATAACAAGAAAATCAGA
CTGGAGAAGGAAATCAAATCACAGTCATCTTCATCTTCATCCTCCCACAAAGAATCTTCTAAAACAAAGCCCTCCAGGCCCTCCTCACAG
TCCTCAAAGAAGGAAATGCTCCCCCCGCCACCCGTGTCCTCGTCCTCCCAGAAGCCAGCCAAGCCTGCACTTAAGAGGTCAAGGCGGGAA
GCAGACACCTGTGGCCAGGACCCTCCCAAAAGTGCCAGCAGTACCAAGAGCAACCACAAAGACTCTTCCATTCCCAAGCAGAGAAGAGTA
GAGGGGAAGGGCTCCAGAAGCTCCTCGGAGCACAAGGGTTCTTCCGGAGATACTGCAAATCCTTTTCCAGTGCCTTCTTTGCCAAATGGT
AACTCTAAACCAGGGAAGCCTCAAGTGAAGTTTGACAAACAACAAGCAGACCTTCACATGAGGGAGGCAAAAAAGATGAAGCAGAAAGCA
GAGTTAATGACGGACAGGGTTGGAAAGGCTTTTAAGTACCTGGAAGCCGTCTTGTCCTTCATTGAGTGCGGAATTGCCACAGAGTCTGAA
AGCCAGTCATCCAAGTCAGCTTACTCTGTCTACTCAGAAACTGTAGATCTCATTAAATTCATAATGTCATTAAAATCCTTCTCAGATGCC
ACAGCGCCAACACAAGAGAAAATATTTGCTGTTTTATGCATGCGTTGCCAGTCCATTTTGAACATGGCGATGTTTCGTTGTAAAAAAGAC
ATAGCAATAAAGTATTCTCGTACTCTTAATAAACACTTCGAGAGTTCTTCCAAAGTCGCCCAGGCACCTTCTCCATGCATTGCAAGAAGC
ACAGGCACACCATCCCCTCTTTCCCCAATGCCTTCTCCTGCCAGCTCCGTAGGGTCCCAGTCAAGTGCTGGCAGTGTGGGGAGCAGTGGG
GTGGCTGCCACTATCAGCACCCCAGTCACCATCCAGAATATGACATCTTCCTATGTCACCATCACATCCCATGTTCTTACCGCCTTTGAC
CTTTGGGAACAGGCCGAGGCCCTCACGAGGAAGAATAAAGAATTCTTTGCTCGGCTCAGCACAAATGTGTGCACCTTGGCCCTCAACAGC

>In-frame_KMT2A_ENST00000389506_chr11_118353211_+_AFF1_ENST00000307808_chr4_88012943_+_6549nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGACTCTCAGCATGTCAGTTCTGTAACCCAAAACCAAAAACAATATGATACATCT
TCAAAAACTCACTCAAATTCTCAGCAAGGAACGTCATCCATGCTCGAAGACGACCTTCAGCTCAGTGACAGTGAGGACAGTGACAGTGAA
CAAACCCCAGAGAAGCCTCCCTCCTCATCTGCACCTCCAAGTGCTCCACAGTCCCTTCCAGAACCAGTGGCATCAGCACATTCCAGCAGT
GCAGAGTCAGAAAGCACCAGTGACTCAGACAGTTCCTCAGACTCAGAGAGCGAGAGCAGTTCAAGTGACAGCGAAGAAAATGAGCCCCTA
GAAACCCCAGCTCCGGAGCCTGAGCCTCCAACAACAAACAAATGGCAGCTGGACAACTGGCTGACCAAAGTCAGCCAGCCAGCTGCGCCA
CCAGAGGGCCCCAGGAGCACAGAGCCCCCACGGCGGCACCCAGAGAGTAAGGGCAGCAGCGACAGTGCCACGAGTCAGGAGCATTCTGAA
TCCAAAGATCCTCCCCCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCACCCGAAGCCCCCCACCCCGGAAAGAGGAGCTGTCAGAAGTCT
CCGGCACAGCAGGAGCCCCCACAAAGGCAAACCGTTGGAACCAAACAACCCAAAAAACCTGTCAAGGCCTCTGCCCGGGCAGGTTCACGG
ACCAGCCTGCAGGGGGAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCCCGAGACCAGACTTCCAAAGACAAGCCCAAGGTGAAGACGAAA
GGACGGCCCCGGGCCGCAGCAAGCAACGAACCCAAGCCAGCAGTGCCCCCCTCCAGTGAGAAGAAGAAGCACAAGAGCTCCCTCCCTGCC
CCCTCTAAGGCTCTCTCAGGCCCAGAACCCGCGAAGGACAATGTGGAGGACAGGACCCCTGAGCACTTTGCTCTTGTTCCCCTGACTGAG
AGCCAGGGCCCACCCCACAGTGGCAGCGGCAGCAGGACTAGTGGCTGCCGCCAAGCCGTGGTGGTCCAGGAGGACAGCCGCAAAGACAGA
CTCCCATTGCCTTTGAGAGACACCAAGCTGCTCTCACCGCTCAGGGACACTCCTCCCCCACAAAGCTTGATGGTGAAGATCACCCTAGAC
CTGCTCTCTCGGATACCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGGAAAGCAGAAGATAAACAGCCGCCCGCAGGGAAGAAGCACAGC
TCTGAGAAGAGGAGCTCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGAAAGGGTGAAGCAGAAAGAGACTGTGATAACAAGAAAATCAGA
CTGGAGAAGGAAATCAAATCACAGTCATCTTCATCTTCATCCTCCCACAAAGAATCTTCTAAAACAAAGCCCTCCAGGCCCTCCTCACAG
TCCTCAAAGAAGGAAATGCTCCCCCCGCCACCCGTGTCCTCGTCCTCCCAGAAGCCAGCCAAGCCTGCACTTAAGAGGTCAAGGCGGGAA
GCAGACACCTGTGGCCAGGACCCTCCCAAAAGTGCCAGCAGTACCAAGAGCAACCACAAAGACTCTTCCATTCCCAAGCAGAGAAGAGTA
GAGGGGAAGGGCTCCAGAAGCTCCTCGGAGCACAAGGGTTCTTCCGGAGATACTGCAAATCCTTTTCCAGTGCCTTCTTTGCCAAATGGT
AACTCTAAACCAGGGAAGCCTCAAGTGAAGTTTGACAAACAACAAGCAGACCTTCACATGAGGGAGGCAAAAAAGATGAAGCAGAAAGCA
GAGTTAATGACGGACAGGGTTGGAAAGGCTTTTAAGTACCTGGAAGCCGTCTTGTCCTTCATTGAGTGCGGAATTGCCACAGAGTCTGAA
AGCCAGTCATCCAAGTCAGCTTACTCTGTCTACTCAGAAACTGTAGATCTCATTAAATTCATAATGTCATTAAAATCCTTCTCAGATGCC
ACAGCGCCAACACAAGAGAAAATATTTGCTGTTTTATGCATGCGTTGCCAGTCCATTTTGAACATGGCGATGTTTCGTTGTAAAAAAGAC
ATAGCAATAAAGTATTCTCGTACTCTTAATAAACACTTCGAGAGTTCTTCCAAAGTCGCCCAGGCACCTTCTCCATGCATTGCAAGCACA
GGCACACCATCCCCTCTTTCCCCAATGCCTTCTCCTGCCAGCTCCGTAGGGTCCCAGTCAAGTGCTGGCAGTGTGGGGAGCAGTGGGGTG
GCTGCCACTATCAGCACCCCAGTCACCATCCAGAATATGACATCTTCCTATGTCACCATCACATCCCATGTTCTTACCGCCTTTGACCTT
TGGGAACAGGCCGAGGCCCTCACGAGGAAGAATAAAGAATTCTTTGCTCGGCTCAGCACAAATGTGTGCACCTTGGCCCTCAACAGCAGT

>In-frame_KMT2A_ENST00000389506_chr11_118353211_+_AFF1_ENST00000544085_chr4_88012943_+_6552nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGACTCTCAGCATGTCAGTTCTGTAACCCAAAACCAAAAACAATATGATACATCT
TCAAAAACTCACTCAAATTCTCAGCAAGGAACGTCATCCATGCTCGAAGACGACCTTCAGCTCAGTGACAGTGAGGACAGTGACAGTGAA
CAAACCCCAGAGAAGCCTCCCTCCTCATCTGCACCTCCAAGTGCTCCACAGTCCCTTCCAGAACCAGTGGCATCAGCACATTCCAGCAGT
GCAGAGTCAGAAAGCACCAGTGACTCAGACAGTTCCTCAGACTCAGAGAGCGAGAGCAGTTCAAGTGACAGCGAAGAAAATGAGCCCCTA
GAAACCCCAGCTCCGGAGCCTGAGCCTCCAACAACAAACAAATGGCAGCTGGACAACTGGCTGACCAAAGTCAGCCAGCCAGCTGCGCCA
CCAGAGGGCCCCAGGAGCACAGAGCCCCCACGGCGGCACCCAGAGAGTAAGGGCAGCAGCGACAGTGCCACGAGTCAGGAGCATTCTGAA
TCCAAAGATCCTCCCCCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCACCCGAAGCCCCCCACCCCGGAAAGAGGAGCTGTCAGAAGTCT
CCGGCACAGCAGGAGCCCCCACAAAGGCAAACCGTTGGAACCAAACAACCCAAAAAACCTGTCAAGGCCTCTGCCCGGGCAGGTTCACGG
ACCAGCCTGCAGGGGGAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCCCGAGACCAGACTTCCAAAGACAAGCCCAAGGTGAAGACGAAA
GGACGGCCCCGGGCCGCAGCAAGCAACGAACCCAAGCCAGCAGTGCCCCCCTCCAGTGAGAAGAAGAAGCACAAGAGCTCCCTCCCTGCC
CCCTCTAAGGCTCTCTCAGGCCCAGAACCCGCGAAGGACAATGTGGAGGACAGGACCCCTGAGCACTTTGCTCTTGTTCCCCTGACTGAG
AGCCAGGGCCCACCCCACAGTGGCAGCGGCAGCAGGACTAGTGGCTGCCGCCAAGCCGTGGTGGTCCAGGAGGACAGCCGCAAAGACAGA
CTCCCATTGCCTTTGAGAGACACCAAGCTGCTCTCACCGCTCAGGGACACTCCTCCCCCACAAAGCTTGATGGTGAAGATCACCCTAGAC
CTGCTCTCTCGGATACCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGGAAAGCAGAAGATAAACAGCCGCCCGCAGGGAAGAAGCACAGC
TCTGAGAAGAGGAGCTCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGAAAGGGTGAAGCAGAAAGAGACTGTGATAACAAGAAAATCAGA
CTGGAGAAGGAAATCAAATCACAGTCATCTTCATCTTCATCCTCCCACAAAGAATCTTCTAAAACAAAGCCCTCCAGGCCCTCCTCACAG
TCCTCAAAGAAGGAAATGCTCCCCCCGCCACCCGTGTCCTCGTCCTCCCAGAAGCCAGCCAAGCCTGCACTTAAGAGGTCAAGGCGGGAA
GCAGACACCTGTGGCCAGGACCCTCCCAAAAGTGCCAGCAGTACCAAGAGCAACCACAAAGACTCTTCCATTCCCAAGCAGAGAAGAGTA
GAGGGGAAGGGCTCCAGAAGCTCCTCGGAGCACAAGGGTTCTTCCGGAGATACTGCAAATCCTTTTCCAGTGCCTTCTTTGCCAAATGGT
AACTCTAAACCAGGGAAGCCTCAAGTGAAGTTTGACAAACAACAAGCAGACCTTCACATGAGGGAGGCAAAAAAGATGAAGCAGAAAGCA
GAGTTAATGACGGACAGGGTTGGAAAGGCTTTTAAGTACCTGGAAGCCGTCTTGTCCTTCATTGAGTGCGGAATTGCCACAGAGTCTGAA
AGCCAGTCATCCAAGTCAGCTTACTCTGTCTACTCAGAAACTGTAGATCTCATTAAATTCATAATGTCATTAAAATCCTTCTCAGATGCC
ACAGCGCCAACACAAGAGAAAATATTTGCTGTTTTATGCATGCGTTGCCAGTCCATTTTGAACATGGCGATGTTTCGTTGTAAAAAAGAC
ATAGCAATAAAGTATTCTCGTACTCTTAATAAACACTTCGAGAGTTCTTCCAAAGTCGCCCAGGCACCTTCTCCATGCATTGCAAGAAGC
ACAGGCACACCATCCCCTCTTTCCCCAATGCCTTCTCCTGCCAGCTCCGTAGGGTCCCAGTCAAGTGCTGGCAGTGTGGGGAGCAGTGGG
GTGGCTGCCACTATCAGCACCCCAGTCACCATCCAGAATATGACATCTTCCTATGTCACCATCACATCCCATGTTCTTACCGCCTTTGAC
CTTTGGGAACAGGCCGAGGCCCTCACGAGGAAGAATAAAGAATTCTTTGCTCGGCTCAGCACAAATGTGTGCACCTTGGCCCTCAACAGC

>In-frame_KMT2A_ENST00000354520_chr11_118353211_+_AFF1_ENST00000395146_chr4_88012943_+_6552nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGACTCTCAGCATGTCAGTTCTGTAACCCAAAACCAAAAACAATATGATACATCT
TCAAAAACTCACTCAAATTCTCAGCAAGGAACGTCATCCATGCTCGAAGACGACCTTCAGCTCAGTGACAGTGAGGACAGTGACAGTGAA
CAAACCCCAGAGAAGCCTCCCTCCTCATCTGCACCTCCAAGTGCTCCACAGTCCCTTCCAGAACCAGTGGCATCAGCACATTCCAGCAGT
GCAGAGTCAGAAAGCACCAGTGACTCAGACAGTTCCTCAGACTCAGAGAGCGAGAGCAGTTCAAGTGACAGCGAAGAAAATGAGCCCCTA
GAAACCCCAGCTCCGGAGCCTGAGCCTCCAACAACAAACAAATGGCAGCTGGACAACTGGCTGACCAAAGTCAGCCAGCCAGCTGCGCCA
CCAGAGGGCCCCAGGAGCACAGAGCCCCCACGGCGGCACCCAGAGAGTAAGGGCAGCAGCGACAGTGCCACGAGTCAGGAGCATTCTGAA
TCCAAAGATCCTCCCCCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCACCCGAAGCCCCCCACCCCGGAAAGAGGAGCTGTCAGAAGTCT
CCGGCACAGCAGGAGCCCCCACAAAGGCAAACCGTTGGAACCAAACAACCCAAAAAACCTGTCAAGGCCTCTGCCCGGGCAGGTTCACGG
ACCAGCCTGCAGGGGGAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCCCGAGACCAGACTTCCAAAGACAAGCCCAAGGTGAAGACGAAA
GGACGGCCCCGGGCCGCAGCAAGCAACGAACCCAAGCCAGCAGTGCCCCCCTCCAGTGAGAAGAAGAAGCACAAGAGCTCCCTCCCTGCC
CCCTCTAAGGCTCTCTCAGGCCCAGAACCCGCGAAGGACAATGTGGAGGACAGGACCCCTGAGCACTTTGCTCTTGTTCCCCTGACTGAG
AGCCAGGGCCCACCCCACAGTGGCAGCGGCAGCAGGACTAGTGGCTGCCGCCAAGCCGTGGTGGTCCAGGAGGACAGCCGCAAAGACAGA
CTCCCATTGCCTTTGAGAGACACCAAGCTGCTCTCACCGCTCAGGGACACTCCTCCCCCACAAAGCTTGATGGTGAAGATCACCCTAGAC
CTGCTCTCTCGGATACCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGGAAAGCAGAAGATAAACAGCCGCCCGCAGGGAAGAAGCACAGC
TCTGAGAAGAGGAGCTCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGAAAGGGTGAAGCAGAAAGAGACTGTGATAACAAGAAAATCAGA
CTGGAGAAGGAAATCAAATCACAGTCATCTTCATCTTCATCCTCCCACAAAGAATCTTCTAAAACAAAGCCCTCCAGGCCCTCCTCACAG
TCCTCAAAGAAGGAAATGCTCCCCCCGCCACCCGTGTCCTCGTCCTCCCAGAAGCCAGCCAAGCCTGCACTTAAGAGGTCAAGGCGGGAA
GCAGACACCTGTGGCCAGGACCCTCCCAAAAGTGCCAGCAGTACCAAGAGCAACCACAAAGACTCTTCCATTCCCAAGCAGAGAAGAGTA
GAGGGGAAGGGCTCCAGAAGCTCCTCGGAGCACAAGGGTTCTTCCGGAGATACTGCAAATCCTTTTCCAGTGCCTTCTTTGCCAAATGGT
AACTCTAAACCAGGGAAGCCTCAAGTGAAGTTTGACAAACAACAAGCAGACCTTCACATGAGGGAGGCAAAAAAGATGAAGCAGAAAGCA
GAGTTAATGACGGACAGGGTTGGAAAGGCTTTTAAGTACCTGGAAGCCGTCTTGTCCTTCATTGAGTGCGGAATTGCCACAGAGTCTGAA
AGCCAGTCATCCAAGTCAGCTTACTCTGTCTACTCAGAAACTGTAGATCTCATTAAATTCATAATGTCATTAAAATCCTTCTCAGATGCC
ACAGCGCCAACACAAGAGAAAATATTTGCTGTTTTATGCATGCGTTGCCAGTCCATTTTGAACATGGCGATGTTTCGTTGTAAAAAAGAC
ATAGCAATAAAGTATTCTCGTACTCTTAATAAACACTTCGAGAGTTCTTCCAAAGTCGCCCAGGCACCTTCTCCATGCATTGCAAGAAGC
ACAGGCACACCATCCCCTCTTTCCCCAATGCCTTCTCCTGCCAGCTCCGTAGGGTCCCAGTCAAGTGCTGGCAGTGTGGGGAGCAGTGGG
GTGGCTGCCACTATCAGCACCCCAGTCACCATCCAGAATATGACATCTTCCTATGTCACCATCACATCCCATGTTCTTACCGCCTTTGAC
CTTTGGGAACAGGCCGAGGCCCTCACGAGGAAGAATAAAGAATTCTTTGCTCGGCTCAGCACAAATGTGTGCACCTTGGCCCTCAACAGC

>In-frame_KMT2A_ENST00000354520_chr11_118353211_+_AFF1_ENST00000307808_chr4_88012943_+_6549nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGACTCTCAGCATGTCAGTTCTGTAACCCAAAACCAAAAACAATATGATACATCT
TCAAAAACTCACTCAAATTCTCAGCAAGGAACGTCATCCATGCTCGAAGACGACCTTCAGCTCAGTGACAGTGAGGACAGTGACAGTGAA
CAAACCCCAGAGAAGCCTCCCTCCTCATCTGCACCTCCAAGTGCTCCACAGTCCCTTCCAGAACCAGTGGCATCAGCACATTCCAGCAGT
GCAGAGTCAGAAAGCACCAGTGACTCAGACAGTTCCTCAGACTCAGAGAGCGAGAGCAGTTCAAGTGACAGCGAAGAAAATGAGCCCCTA
GAAACCCCAGCTCCGGAGCCTGAGCCTCCAACAACAAACAAATGGCAGCTGGACAACTGGCTGACCAAAGTCAGCCAGCCAGCTGCGCCA
CCAGAGGGCCCCAGGAGCACAGAGCCCCCACGGCGGCACCCAGAGAGTAAGGGCAGCAGCGACAGTGCCACGAGTCAGGAGCATTCTGAA
TCCAAAGATCCTCCCCCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCACCCGAAGCCCCCCACCCCGGAAAGAGGAGCTGTCAGAAGTCT
CCGGCACAGCAGGAGCCCCCACAAAGGCAAACCGTTGGAACCAAACAACCCAAAAAACCTGTCAAGGCCTCTGCCCGGGCAGGTTCACGG
ACCAGCCTGCAGGGGGAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCCCGAGACCAGACTTCCAAAGACAAGCCCAAGGTGAAGACGAAA
GGACGGCCCCGGGCCGCAGCAAGCAACGAACCCAAGCCAGCAGTGCCCCCCTCCAGTGAGAAGAAGAAGCACAAGAGCTCCCTCCCTGCC
CCCTCTAAGGCTCTCTCAGGCCCAGAACCCGCGAAGGACAATGTGGAGGACAGGACCCCTGAGCACTTTGCTCTTGTTCCCCTGACTGAG
AGCCAGGGCCCACCCCACAGTGGCAGCGGCAGCAGGACTAGTGGCTGCCGCCAAGCCGTGGTGGTCCAGGAGGACAGCCGCAAAGACAGA
CTCCCATTGCCTTTGAGAGACACCAAGCTGCTCTCACCGCTCAGGGACACTCCTCCCCCACAAAGCTTGATGGTGAAGATCACCCTAGAC
CTGCTCTCTCGGATACCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGGAAAGCAGAAGATAAACAGCCGCCCGCAGGGAAGAAGCACAGC
TCTGAGAAGAGGAGCTCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGAAAGGGTGAAGCAGAAAGAGACTGTGATAACAAGAAAATCAGA
CTGGAGAAGGAAATCAAATCACAGTCATCTTCATCTTCATCCTCCCACAAAGAATCTTCTAAAACAAAGCCCTCCAGGCCCTCCTCACAG
TCCTCAAAGAAGGAAATGCTCCCCCCGCCACCCGTGTCCTCGTCCTCCCAGAAGCCAGCCAAGCCTGCACTTAAGAGGTCAAGGCGGGAA
GCAGACACCTGTGGCCAGGACCCTCCCAAAAGTGCCAGCAGTACCAAGAGCAACCACAAAGACTCTTCCATTCCCAAGCAGAGAAGAGTA
GAGGGGAAGGGCTCCAGAAGCTCCTCGGAGCACAAGGGTTCTTCCGGAGATACTGCAAATCCTTTTCCAGTGCCTTCTTTGCCAAATGGT
AACTCTAAACCAGGGAAGCCTCAAGTGAAGTTTGACAAACAACAAGCAGACCTTCACATGAGGGAGGCAAAAAAGATGAAGCAGAAAGCA
GAGTTAATGACGGACAGGGTTGGAAAGGCTTTTAAGTACCTGGAAGCCGTCTTGTCCTTCATTGAGTGCGGAATTGCCACAGAGTCTGAA
AGCCAGTCATCCAAGTCAGCTTACTCTGTCTACTCAGAAACTGTAGATCTCATTAAATTCATAATGTCATTAAAATCCTTCTCAGATGCC
ACAGCGCCAACACAAGAGAAAATATTTGCTGTTTTATGCATGCGTTGCCAGTCCATTTTGAACATGGCGATGTTTCGTTGTAAAAAAGAC
ATAGCAATAAAGTATTCTCGTACTCTTAATAAACACTTCGAGAGTTCTTCCAAAGTCGCCCAGGCACCTTCTCCATGCATTGCAAGCACA
GGCACACCATCCCCTCTTTCCCCAATGCCTTCTCCTGCCAGCTCCGTAGGGTCCCAGTCAAGTGCTGGCAGTGTGGGGAGCAGTGGGGTG
GCTGCCACTATCAGCACCCCAGTCACCATCCAGAATATGACATCTTCCTATGTCACCATCACATCCCATGTTCTTACCGCCTTTGACCTT
TGGGAACAGGCCGAGGCCCTCACGAGGAAGAATAAAGAATTCTTTGCTCGGCTCAGCACAAATGTGTGCACCTTGGCCCTCAACAGCAGT

>In-frame_KMT2A_ENST00000354520_chr11_118353211_+_AFF1_ENST00000544085_chr4_88012943_+_6552nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGACTCTCAGCATGTCAGTTCTGTAACCCAAAACCAAAAACAATATGATACATCT
TCAAAAACTCACTCAAATTCTCAGCAAGGAACGTCATCCATGCTCGAAGACGACCTTCAGCTCAGTGACAGTGAGGACAGTGACAGTGAA
CAAACCCCAGAGAAGCCTCCCTCCTCATCTGCACCTCCAAGTGCTCCACAGTCCCTTCCAGAACCAGTGGCATCAGCACATTCCAGCAGT
GCAGAGTCAGAAAGCACCAGTGACTCAGACAGTTCCTCAGACTCAGAGAGCGAGAGCAGTTCAAGTGACAGCGAAGAAAATGAGCCCCTA
GAAACCCCAGCTCCGGAGCCTGAGCCTCCAACAACAAACAAATGGCAGCTGGACAACTGGCTGACCAAAGTCAGCCAGCCAGCTGCGCCA
CCAGAGGGCCCCAGGAGCACAGAGCCCCCACGGCGGCACCCAGAGAGTAAGGGCAGCAGCGACAGTGCCACGAGTCAGGAGCATTCTGAA
TCCAAAGATCCTCCCCCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCACCCGAAGCCCCCCACCCCGGAAAGAGGAGCTGTCAGAAGTCT
CCGGCACAGCAGGAGCCCCCACAAAGGCAAACCGTTGGAACCAAACAACCCAAAAAACCTGTCAAGGCCTCTGCCCGGGCAGGTTCACGG
ACCAGCCTGCAGGGGGAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCCCGAGACCAGACTTCCAAAGACAAGCCCAAGGTGAAGACGAAA
GGACGGCCCCGGGCCGCAGCAAGCAACGAACCCAAGCCAGCAGTGCCCCCCTCCAGTGAGAAGAAGAAGCACAAGAGCTCCCTCCCTGCC
CCCTCTAAGGCTCTCTCAGGCCCAGAACCCGCGAAGGACAATGTGGAGGACAGGACCCCTGAGCACTTTGCTCTTGTTCCCCTGACTGAG
AGCCAGGGCCCACCCCACAGTGGCAGCGGCAGCAGGACTAGTGGCTGCCGCCAAGCCGTGGTGGTCCAGGAGGACAGCCGCAAAGACAGA
CTCCCATTGCCTTTGAGAGACACCAAGCTGCTCTCACCGCTCAGGGACACTCCTCCCCCACAAAGCTTGATGGTGAAGATCACCCTAGAC
CTGCTCTCTCGGATACCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGGAAAGCAGAAGATAAACAGCCGCCCGCAGGGAAGAAGCACAGC
TCTGAGAAGAGGAGCTCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGAAAGGGTGAAGCAGAAAGAGACTGTGATAACAAGAAAATCAGA
CTGGAGAAGGAAATCAAATCACAGTCATCTTCATCTTCATCCTCCCACAAAGAATCTTCTAAAACAAAGCCCTCCAGGCCCTCCTCACAG
TCCTCAAAGAAGGAAATGCTCCCCCCGCCACCCGTGTCCTCGTCCTCCCAGAAGCCAGCCAAGCCTGCACTTAAGAGGTCAAGGCGGGAA
GCAGACACCTGTGGCCAGGACCCTCCCAAAAGTGCCAGCAGTACCAAGAGCAACCACAAAGACTCTTCCATTCCCAAGCAGAGAAGAGTA
GAGGGGAAGGGCTCCAGAAGCTCCTCGGAGCACAAGGGTTCTTCCGGAGATACTGCAAATCCTTTTCCAGTGCCTTCTTTGCCAAATGGT
AACTCTAAACCAGGGAAGCCTCAAGTGAAGTTTGACAAACAACAAGCAGACCTTCACATGAGGGAGGCAAAAAAGATGAAGCAGAAAGCA
GAGTTAATGACGGACAGGGTTGGAAAGGCTTTTAAGTACCTGGAAGCCGTCTTGTCCTTCATTGAGTGCGGAATTGCCACAGAGTCTGAA
AGCCAGTCATCCAAGTCAGCTTACTCTGTCTACTCAGAAACTGTAGATCTCATTAAATTCATAATGTCATTAAAATCCTTCTCAGATGCC
ACAGCGCCAACACAAGAGAAAATATTTGCTGTTTTATGCATGCGTTGCCAGTCCATTTTGAACATGGCGATGTTTCGTTGTAAAAAAGAC
ATAGCAATAAAGTATTCTCGTACTCTTAATAAACACTTCGAGAGTTCTTCCAAAGTCGCCCAGGCACCTTCTCCATGCATTGCAAGAAGC
ACAGGCACACCATCCCCTCTTTCCCCAATGCCTTCTCCTGCCAGCTCCGTAGGGTCCCAGTCAAGTGCTGGCAGTGTGGGGAGCAGTGGG
GTGGCTGCCACTATCAGCACCCCAGTCACCATCCAGAATATGACATCTTCCTATGTCACCATCACATCCCATGTTCTTACCGCCTTTGAC
CTTTGGGAACAGGCCGAGGCCCTCACGAGGAAGAATAAAGAATTCTTTGCTCGGCTCAGCACAAATGTGTGCACCTTGGCCCTCAACAGC

>In-frame_KMT2A_ENST00000534358_chr11_118355690_+_AFF1_ENST00000395146_chr4_88005270_+_6930nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGGAGGATTGTGAA
GCAGAAAATGTGTGGGAGATGGGAGGCTTAGGAATCTTGACTTCTGTTCCTATAACACCCAGGGTGGTTTGCTTTCTCTGTGCCAGTAGT
GGGCATGTAGAGCAGACCTACTCCAATGAAGTCCATTGTGTTGAAGAGATTCTGAAGGAAATGACCCATTCATGGCCGCCTCCTTTGACA
GCAATACATACGCCTAGTACAGCTGAGCCATCCAAGTTTCCTTTCCCTACAAAGGACTCTCAGCATGTCAGTTCTGTAACCCAAAACCAA
AAACAATATGATACATCTTCAAAAACTCACTCAAATTCTCAGCAAGGAACGTCATCCATGCTCGAAGACGACCTTCAGCTCAGTGACAGT
GAGGACAGTGACAGTGAACAAACCCCAGAGAAGCCTCCCTCCTCATCTGCACCTCCAAGTGCTCCACAGTCCCTTCCAGAACCAGTGGCA
TCAGCACATTCCAGCAGTGCAGAGTCAGAAAGCACCAGTGACTCAGACAGTTCCTCAGACTCAGAGAGCGAGAGCAGTTCAAGTGACAGC
GAAGAAAATGAGCCCCTAGAAACCCCAGCTCCGGAGCCTGAGCCTCCAACAACAAACAAATGGCAGCTGGACAACTGGCTGACCAAAGTC
AGCCAGCCAGCTGCGCCACCAGAGGGCCCCAGGAGCACAGAGCCCCCACGGCGGCACCCAGAGAGTAAGGGCAGCAGCGACAGTGCCACG
AGTCAGGAGCATTCTGAATCCAAAGATCCTCCCCCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCACCCGAAGCCCCCCACCCCGGAAAG
AGGAGCTGTCAGAAGTCTCCGGCACAGCAGGAGCCCCCACAAAGGCAAACCGTTGGAACCAAACAACCCAAAAAACCTGTCAAGGCCTCT
GCCCGGGCAGGTTCACGGACCAGCCTGCAGGGGGAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCCCGAGACCAGACTTCCAAAGACAAG
CCCAAGGTGAAGACGAAAGGACGGCCCCGGGCCGCAGCAAGCAACGAACCCAAGCCAGCAGTGCCCCCCTCCAGTGAGAAGAAGAAGCAC
AAGAGCTCCCTCCCTGCCCCCTCTAAGGCTCTCTCAGGCCCAGAACCCGCGAAGGACAATGTGGAGGACAGGACCCCTGAGCACTTTGCT
CTTGTTCCCCTGACTGAGAGCCAGGGCCCACCCCACAGTGGCAGCGGCAGCAGGACTAGTGGCTGCCGCCAAGCCGTGGTGGTCCAGGAG
GACAGCCGCAAAGACAGACTCCCATTGCCTTTGAGAGACACCAAGCTGCTCTCACCGCTCAGGGACACTCCTCCCCCACAAAGCTTGATG
GTGAAGATCACCCTAGACCTGCTCTCTCGGATACCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGGAAAGCAGAAGATAAACAGCCGCCC
GCAGGGAAGAAGCACAGCTCTGAGAAGAGGAGCTCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGAAAGGGTGAAGCAGAAAGAGACTGT
GATAACAAGAAAATCAGACTGGAGAAGGAAATCAAATCACAGTCATCTTCATCTTCATCCTCCCACAAAGAATCTTCTAAAACAAAGCCC
TCCAGGCCCTCCTCACAGTCCTCAAAGAAGGAAATGCTCCCCCCGCCACCCGTGTCCTCGTCCTCCCAGAAGCCAGCCAAGCCTGCACTT
AAGAGGTCAAGGCGGGAAGCAGACACCTGTGGCCAGGACCCTCCCAAAAGTGCCAGCAGTACCAAGAGCAACCACAAAGACTCTTCCATT
CCCAAGCAGAGAAGAGTAGAGGGGAAGGGCTCCAGAAGCTCCTCGGAGCACAAGGGTTCTTCCGGAGATACTGCAAATCCTTTTCCAGTG
CCTTCTTTGCCAAATGGTAACTCTAAACCAGGGAAGCCTCAAGTGAAGTTTGACAAACAACAAGCAGACCTTCACATGAGGGAGGCAAAA
AAGATGAAGCAGAAAGCAGAGTTAATGACGGACAGGGTTGGAAAGGCTTTTAAGTACCTGGAAGCCGTCTTGTCCTTCATTGAGTGCGGA
ATTGCCACAGAGTCTGAAAGCCAGTCATCCAAGTCAGCTTACTCTGTCTACTCAGAAACTGTAGATCTCATTAAATTCATAATGTCATTA
AAATCCTTCTCAGATGCCACAGCGCCAACACAAGAGAAAATATTTGCTGTTTTATGCATGCGTTGCCAGTCCATTTTGAACATGGCGATG
TTTCGTTGTAAAAAAGACATAGCAATAAAGTATTCTCGTACTCTTAATAAACACTTCGAGAGTTCTTCCAAAGTCGCCCAGGCACCTTCT
CCATGCATTGCAAGAAGCACAGGCACACCATCCCCTCTTTCCCCAATGCCTTCTCCTGCCAGCTCCGTAGGGTCCCAGTCAAGTGCTGGC
AGTGTGGGGAGCAGTGGGGTGGCTGCCACTATCAGCACCCCAGTCACCATCCAGAATATGACATCTTCCTATGTCACCATCACATCCCAT
GTTCTTACCGCCTTTGACCTTTGGGAACAGGCCGAGGCCCTCACGAGGAAGAATAAAGAATTCTTTGCTCGGCTCAGCACAAATGTGTGC
ACCTTGGCCCTCAACAGCAGTTTGGTGGACCTGGTGCACTATACACGACAGGGTTTTCAGCAGCTACAAGAATTAACCAAAACACCTTAA

>In-frame_KMT2A_ENST00000534358_chr11_118355690_+_AFF1_ENST00000307808_chr4_88005270_+_6927nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGGAGGATTGTGAA
GCAGAAAATGTGTGGGAGATGGGAGGCTTAGGAATCTTGACTTCTGTTCCTATAACACCCAGGGTGGTTTGCTTTCTCTGTGCCAGTAGT
GGGCATGTAGAGCAGACCTACTCCAATGAAGTCCATTGTGTTGAAGAGATTCTGAAGGAAATGACCCATTCATGGCCGCCTCCTTTGACA
GCAATACATACGCCTAGTACAGCTGAGCCATCCAAGTTTCCTTTCCCTACAAAGGACTCTCAGCATGTCAGTTCTGTAACCCAAAACCAA
AAACAATATGATACATCTTCAAAAACTCACTCAAATTCTCAGCAAGGAACGTCATCCATGCTCGAAGACGACCTTCAGCTCAGTGACAGT
GAGGACAGTGACAGTGAACAAACCCCAGAGAAGCCTCCCTCCTCATCTGCACCTCCAAGTGCTCCACAGTCCCTTCCAGAACCAGTGGCA
TCAGCACATTCCAGCAGTGCAGAGTCAGAAAGCACCAGTGACTCAGACAGTTCCTCAGACTCAGAGAGCGAGAGCAGTTCAAGTGACAGC
GAAGAAAATGAGCCCCTAGAAACCCCAGCTCCGGAGCCTGAGCCTCCAACAACAAACAAATGGCAGCTGGACAACTGGCTGACCAAAGTC
AGCCAGCCAGCTGCGCCACCAGAGGGCCCCAGGAGCACAGAGCCCCCACGGCGGCACCCAGAGAGTAAGGGCAGCAGCGACAGTGCCACG
AGTCAGGAGCATTCTGAATCCAAAGATCCTCCCCCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCACCCGAAGCCCCCCACCCCGGAAAG
AGGAGCTGTCAGAAGTCTCCGGCACAGCAGGAGCCCCCACAAAGGCAAACCGTTGGAACCAAACAACCCAAAAAACCTGTCAAGGCCTCT
GCCCGGGCAGGTTCACGGACCAGCCTGCAGGGGGAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCCCGAGACCAGACTTCCAAAGACAAG
CCCAAGGTGAAGACGAAAGGACGGCCCCGGGCCGCAGCAAGCAACGAACCCAAGCCAGCAGTGCCCCCCTCCAGTGAGAAGAAGAAGCAC
AAGAGCTCCCTCCCTGCCCCCTCTAAGGCTCTCTCAGGCCCAGAACCCGCGAAGGACAATGTGGAGGACAGGACCCCTGAGCACTTTGCT
CTTGTTCCCCTGACTGAGAGCCAGGGCCCACCCCACAGTGGCAGCGGCAGCAGGACTAGTGGCTGCCGCCAAGCCGTGGTGGTCCAGGAG
GACAGCCGCAAAGACAGACTCCCATTGCCTTTGAGAGACACCAAGCTGCTCTCACCGCTCAGGGACACTCCTCCCCCACAAAGCTTGATG
GTGAAGATCACCCTAGACCTGCTCTCTCGGATACCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGGAAAGCAGAAGATAAACAGCCGCCC
GCAGGGAAGAAGCACAGCTCTGAGAAGAGGAGCTCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGAAAGGGTGAAGCAGAAAGAGACTGT
GATAACAAGAAAATCAGACTGGAGAAGGAAATCAAATCACAGTCATCTTCATCTTCATCCTCCCACAAAGAATCTTCTAAAACAAAGCCC
TCCAGGCCCTCCTCACAGTCCTCAAAGAAGGAAATGCTCCCCCCGCCACCCGTGTCCTCGTCCTCCCAGAAGCCAGCCAAGCCTGCACTT
AAGAGGTCAAGGCGGGAAGCAGACACCTGTGGCCAGGACCCTCCCAAAAGTGCCAGCAGTACCAAGAGCAACCACAAAGACTCTTCCATT
CCCAAGCAGAGAAGAGTAGAGGGGAAGGGCTCCAGAAGCTCCTCGGAGCACAAGGGTTCTTCCGGAGATACTGCAAATCCTTTTCCAGTG
CCTTCTTTGCCAAATGGTAACTCTAAACCAGGGAAGCCTCAAGTGAAGTTTGACAAACAACAAGCAGACCTTCACATGAGGGAGGCAAAA
AAGATGAAGCAGAAAGCAGAGTTAATGACGGACAGGGTTGGAAAGGCTTTTAAGTACCTGGAAGCCGTCTTGTCCTTCATTGAGTGCGGA
ATTGCCACAGAGTCTGAAAGCCAGTCATCCAAGTCAGCTTACTCTGTCTACTCAGAAACTGTAGATCTCATTAAATTCATAATGTCATTA
AAATCCTTCTCAGATGCCACAGCGCCAACACAAGAGAAAATATTTGCTGTTTTATGCATGCGTTGCCAGTCCATTTTGAACATGGCGATG
TTTCGTTGTAAAAAAGACATAGCAATAAAGTATTCTCGTACTCTTAATAAACACTTCGAGAGTTCTTCCAAAGTCGCCCAGGCACCTTCT
CCATGCATTGCAAGCACAGGCACACCATCCCCTCTTTCCCCAATGCCTTCTCCTGCCAGCTCCGTAGGGTCCCAGTCAAGTGCTGGCAGT
GTGGGGAGCAGTGGGGTGGCTGCCACTATCAGCACCCCAGTCACCATCCAGAATATGACATCTTCCTATGTCACCATCACATCCCATGTT
CTTACCGCCTTTGACCTTTGGGAACAGGCCGAGGCCCTCACGAGGAAGAATAAAGAATTCTTTGCTCGGCTCAGCACAAATGTGTGCACC

>In-frame_KMT2A_ENST00000389506_chr11_118355690_+_AFF1_ENST00000395146_chr4_88005270_+_6930nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGGAGGATTGTGAA
GCAGAAAATGTGTGGGAGATGGGAGGCTTAGGAATCTTGACTTCTGTTCCTATAACACCCAGGGTGGTTTGCTTTCTCTGTGCCAGTAGT
GGGCATGTAGAGCAGACCTACTCCAATGAAGTCCATTGTGTTGAAGAGATTCTGAAGGAAATGACCCATTCATGGCCGCCTCCTTTGACA
GCAATACATACGCCTAGTACAGCTGAGCCATCCAAGTTTCCTTTCCCTACAAAGGACTCTCAGCATGTCAGTTCTGTAACCCAAAACCAA
AAACAATATGATACATCTTCAAAAACTCACTCAAATTCTCAGCAAGGAACGTCATCCATGCTCGAAGACGACCTTCAGCTCAGTGACAGT
GAGGACAGTGACAGTGAACAAACCCCAGAGAAGCCTCCCTCCTCATCTGCACCTCCAAGTGCTCCACAGTCCCTTCCAGAACCAGTGGCA
TCAGCACATTCCAGCAGTGCAGAGTCAGAAAGCACCAGTGACTCAGACAGTTCCTCAGACTCAGAGAGCGAGAGCAGTTCAAGTGACAGC
GAAGAAAATGAGCCCCTAGAAACCCCAGCTCCGGAGCCTGAGCCTCCAACAACAAACAAATGGCAGCTGGACAACTGGCTGACCAAAGTC
AGCCAGCCAGCTGCGCCACCAGAGGGCCCCAGGAGCACAGAGCCCCCACGGCGGCACCCAGAGAGTAAGGGCAGCAGCGACAGTGCCACG
AGTCAGGAGCATTCTGAATCCAAAGATCCTCCCCCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCACCCGAAGCCCCCCACCCCGGAAAG
AGGAGCTGTCAGAAGTCTCCGGCACAGCAGGAGCCCCCACAAAGGCAAACCGTTGGAACCAAACAACCCAAAAAACCTGTCAAGGCCTCT
GCCCGGGCAGGTTCACGGACCAGCCTGCAGGGGGAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCCCGAGACCAGACTTCCAAAGACAAG
CCCAAGGTGAAGACGAAAGGACGGCCCCGGGCCGCAGCAAGCAACGAACCCAAGCCAGCAGTGCCCCCCTCCAGTGAGAAGAAGAAGCAC
AAGAGCTCCCTCCCTGCCCCCTCTAAGGCTCTCTCAGGCCCAGAACCCGCGAAGGACAATGTGGAGGACAGGACCCCTGAGCACTTTGCT
CTTGTTCCCCTGACTGAGAGCCAGGGCCCACCCCACAGTGGCAGCGGCAGCAGGACTAGTGGCTGCCGCCAAGCCGTGGTGGTCCAGGAG
GACAGCCGCAAAGACAGACTCCCATTGCCTTTGAGAGACACCAAGCTGCTCTCACCGCTCAGGGACACTCCTCCCCCACAAAGCTTGATG
GTGAAGATCACCCTAGACCTGCTCTCTCGGATACCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGGAAAGCAGAAGATAAACAGCCGCCC
GCAGGGAAGAAGCACAGCTCTGAGAAGAGGAGCTCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGAAAGGGTGAAGCAGAAAGAGACTGT
GATAACAAGAAAATCAGACTGGAGAAGGAAATCAAATCACAGTCATCTTCATCTTCATCCTCCCACAAAGAATCTTCTAAAACAAAGCCC
TCCAGGCCCTCCTCACAGTCCTCAAAGAAGGAAATGCTCCCCCCGCCACCCGTGTCCTCGTCCTCCCAGAAGCCAGCCAAGCCTGCACTT
AAGAGGTCAAGGCGGGAAGCAGACACCTGTGGCCAGGACCCTCCCAAAAGTGCCAGCAGTACCAAGAGCAACCACAAAGACTCTTCCATT
CCCAAGCAGAGAAGAGTAGAGGGGAAGGGCTCCAGAAGCTCCTCGGAGCACAAGGGTTCTTCCGGAGATACTGCAAATCCTTTTCCAGTG
CCTTCTTTGCCAAATGGTAACTCTAAACCAGGGAAGCCTCAAGTGAAGTTTGACAAACAACAAGCAGACCTTCACATGAGGGAGGCAAAA
AAGATGAAGCAGAAAGCAGAGTTAATGACGGACAGGGTTGGAAAGGCTTTTAAGTACCTGGAAGCCGTCTTGTCCTTCATTGAGTGCGGA
ATTGCCACAGAGTCTGAAAGCCAGTCATCCAAGTCAGCTTACTCTGTCTACTCAGAAACTGTAGATCTCATTAAATTCATAATGTCATTA
AAATCCTTCTCAGATGCCACAGCGCCAACACAAGAGAAAATATTTGCTGTTTTATGCATGCGTTGCCAGTCCATTTTGAACATGGCGATG
TTTCGTTGTAAAAAAGACATAGCAATAAAGTATTCTCGTACTCTTAATAAACACTTCGAGAGTTCTTCCAAAGTCGCCCAGGCACCTTCT
CCATGCATTGCAAGAAGCACAGGCACACCATCCCCTCTTTCCCCAATGCCTTCTCCTGCCAGCTCCGTAGGGTCCCAGTCAAGTGCTGGC
AGTGTGGGGAGCAGTGGGGTGGCTGCCACTATCAGCACCCCAGTCACCATCCAGAATATGACATCTTCCTATGTCACCATCACATCCCAT
GTTCTTACCGCCTTTGACCTTTGGGAACAGGCCGAGGCCCTCACGAGGAAGAATAAAGAATTCTTTGCTCGGCTCAGCACAAATGTGTGC
ACCTTGGCCCTCAACAGCAGTTTGGTGGACCTGGTGCACTATACACGACAGGGTTTTCAGCAGCTACAAGAATTAACCAAAACACCTTAA

>In-frame_KMT2A_ENST00000389506_chr11_118355690_+_AFF1_ENST00000307808_chr4_88005270_+_6927nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGGAGGATTGTGAA
GCAGAAAATGTGTGGGAGATGGGAGGCTTAGGAATCTTGACTTCTGTTCCTATAACACCCAGGGTGGTTTGCTTTCTCTGTGCCAGTAGT
GGGCATGTAGAGCAGACCTACTCCAATGAAGTCCATTGTGTTGAAGAGATTCTGAAGGAAATGACCCATTCATGGCCGCCTCCTTTGACA
GCAATACATACGCCTAGTACAGCTGAGCCATCCAAGTTTCCTTTCCCTACAAAGGACTCTCAGCATGTCAGTTCTGTAACCCAAAACCAA
AAACAATATGATACATCTTCAAAAACTCACTCAAATTCTCAGCAAGGAACGTCATCCATGCTCGAAGACGACCTTCAGCTCAGTGACAGT
GAGGACAGTGACAGTGAACAAACCCCAGAGAAGCCTCCCTCCTCATCTGCACCTCCAAGTGCTCCACAGTCCCTTCCAGAACCAGTGGCA
TCAGCACATTCCAGCAGTGCAGAGTCAGAAAGCACCAGTGACTCAGACAGTTCCTCAGACTCAGAGAGCGAGAGCAGTTCAAGTGACAGC
GAAGAAAATGAGCCCCTAGAAACCCCAGCTCCGGAGCCTGAGCCTCCAACAACAAACAAATGGCAGCTGGACAACTGGCTGACCAAAGTC
AGCCAGCCAGCTGCGCCACCAGAGGGCCCCAGGAGCACAGAGCCCCCACGGCGGCACCCAGAGAGTAAGGGCAGCAGCGACAGTGCCACG
AGTCAGGAGCATTCTGAATCCAAAGATCCTCCCCCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCACCCGAAGCCCCCCACCCCGGAAAG
AGGAGCTGTCAGAAGTCTCCGGCACAGCAGGAGCCCCCACAAAGGCAAACCGTTGGAACCAAACAACCCAAAAAACCTGTCAAGGCCTCT
GCCCGGGCAGGTTCACGGACCAGCCTGCAGGGGGAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCCCGAGACCAGACTTCCAAAGACAAG
CCCAAGGTGAAGACGAAAGGACGGCCCCGGGCCGCAGCAAGCAACGAACCCAAGCCAGCAGTGCCCCCCTCCAGTGAGAAGAAGAAGCAC
AAGAGCTCCCTCCCTGCCCCCTCTAAGGCTCTCTCAGGCCCAGAACCCGCGAAGGACAATGTGGAGGACAGGACCCCTGAGCACTTTGCT
CTTGTTCCCCTGACTGAGAGCCAGGGCCCACCCCACAGTGGCAGCGGCAGCAGGACTAGTGGCTGCCGCCAAGCCGTGGTGGTCCAGGAG
GACAGCCGCAAAGACAGACTCCCATTGCCTTTGAGAGACACCAAGCTGCTCTCACCGCTCAGGGACACTCCTCCCCCACAAAGCTTGATG
GTGAAGATCACCCTAGACCTGCTCTCTCGGATACCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGGAAAGCAGAAGATAAACAGCCGCCC
GCAGGGAAGAAGCACAGCTCTGAGAAGAGGAGCTCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGAAAGGGTGAAGCAGAAAGAGACTGT
GATAACAAGAAAATCAGACTGGAGAAGGAAATCAAATCACAGTCATCTTCATCTTCATCCTCCCACAAAGAATCTTCTAAAACAAAGCCC
TCCAGGCCCTCCTCACAGTCCTCAAAGAAGGAAATGCTCCCCCCGCCACCCGTGTCCTCGTCCTCCCAGAAGCCAGCCAAGCCTGCACTT
AAGAGGTCAAGGCGGGAAGCAGACACCTGTGGCCAGGACCCTCCCAAAAGTGCCAGCAGTACCAAGAGCAACCACAAAGACTCTTCCATT
CCCAAGCAGAGAAGAGTAGAGGGGAAGGGCTCCAGAAGCTCCTCGGAGCACAAGGGTTCTTCCGGAGATACTGCAAATCCTTTTCCAGTG
CCTTCTTTGCCAAATGGTAACTCTAAACCAGGGAAGCCTCAAGTGAAGTTTGACAAACAACAAGCAGACCTTCACATGAGGGAGGCAAAA
AAGATGAAGCAGAAAGCAGAGTTAATGACGGACAGGGTTGGAAAGGCTTTTAAGTACCTGGAAGCCGTCTTGTCCTTCATTGAGTGCGGA
ATTGCCACAGAGTCTGAAAGCCAGTCATCCAAGTCAGCTTACTCTGTCTACTCAGAAACTGTAGATCTCATTAAATTCATAATGTCATTA
AAATCCTTCTCAGATGCCACAGCGCCAACACAAGAGAAAATATTTGCTGTTTTATGCATGCGTTGCCAGTCCATTTTGAACATGGCGATG
TTTCGTTGTAAAAAAGACATAGCAATAAAGTATTCTCGTACTCTTAATAAACACTTCGAGAGTTCTTCCAAAGTCGCCCAGGCACCTTCT
CCATGCATTGCAAGCACAGGCACACCATCCCCTCTTTCCCCAATGCCTTCTCCTGCCAGCTCCGTAGGGTCCCAGTCAAGTGCTGGCAGT
GTGGGGAGCAGTGGGGTGGCTGCCACTATCAGCACCCCAGTCACCATCCAGAATATGACATCTTCCTATGTCACCATCACATCCCATGTT
CTTACCGCCTTTGACCTTTGGGAACAGGCCGAGGCCCTCACGAGGAAGAATAAAGAATTCTTTGCTCGGCTCAGCACAAATGTGTGCACC

>In-frame_KMT2A_ENST00000534358_chr11_118355690_+_AFF1_ENST00000395146_chr4_88005270_+_6930nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGGAGGATTGTGAA
GCAGAAAATGTGTGGGAGATGGGAGGCTTAGGAATCTTGACTTCTGTTCCTATAACACCCAGGGTGGTTTGCTTTCTCTGTGCCAGTAGT
GGGCATGTAGAGCAGACCTACTCCAATGAAGTCCATTGTGTTGAAGAGATTCTGAAGGAAATGACCCATTCATGGCCGCCTCCTTTGACA
GCAATACATACGCCTAGTACAGCTGAGCCATCCAAGTTTCCTTTCCCTACAAAGGACTCTCAGCATGTCAGTTCTGTAACCCAAAACCAA
AAACAATATGATACATCTTCAAAAACTCACTCAAATTCTCAGCAAGGAACGTCATCCATGCTCGAAGACGACCTTCAGCTCAGTGACAGT
GAGGACAGTGACAGTGAACAAACCCCAGAGAAGCCTCCCTCCTCATCTGCACCTCCAAGTGCTCCACAGTCCCTTCCAGAACCAGTGGCA
TCAGCACATTCCAGCAGTGCAGAGTCAGAAAGCACCAGTGACTCAGACAGTTCCTCAGACTCAGAGAGCGAGAGCAGTTCAAGTGACAGC
GAAGAAAATGAGCCCCTAGAAACCCCAGCTCCGGAGCCTGAGCCTCCAACAACAAACAAATGGCAGCTGGACAACTGGCTGACCAAAGTC
AGCCAGCCAGCTGCGCCACCAGAGGGCCCCAGGAGCACAGAGCCCCCACGGCGGCACCCAGAGAGTAAGGGCAGCAGCGACAGTGCCACG
AGTCAGGAGCATTCTGAATCCAAAGATCCTCCCCCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCACCCGAAGCCCCCCACCCCGGAAAG
AGGAGCTGTCAGAAGTCTCCGGCACAGCAGGAGCCCCCACAAAGGCAAACCGTTGGAACCAAACAACCCAAAAAACCTGTCAAGGCCTCT
GCCCGGGCAGGTTCACGGACCAGCCTGCAGGGGGAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCCCGAGACCAGACTTCCAAAGACAAG
CCCAAGGTGAAGACGAAAGGACGGCCCCGGGCCGCAGCAAGCAACGAACCCAAGCCAGCAGTGCCCCCCTCCAGTGAGAAGAAGAAGCAC
AAGAGCTCCCTCCCTGCCCCCTCTAAGGCTCTCTCAGGCCCAGAACCCGCGAAGGACAATGTGGAGGACAGGACCCCTGAGCACTTTGCT
CTTGTTCCCCTGACTGAGAGCCAGGGCCCACCCCACAGTGGCAGCGGCAGCAGGACTAGTGGCTGCCGCCAAGCCGTGGTGGTCCAGGAG
GACAGCCGCAAAGACAGACTCCCATTGCCTTTGAGAGACACCAAGCTGCTCTCACCGCTCAGGGACACTCCTCCCCCACAAAGCTTGATG
GTGAAGATCACCCTAGACCTGCTCTCTCGGATACCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGGAAAGCAGAAGATAAACAGCCGCCC
GCAGGGAAGAAGCACAGCTCTGAGAAGAGGAGCTCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGAAAGGGTGAAGCAGAAAGAGACTGT
GATAACAAGAAAATCAGACTGGAGAAGGAAATCAAATCACAGTCATCTTCATCTTCATCCTCCCACAAAGAATCTTCTAAAACAAAGCCC
TCCAGGCCCTCCTCACAGTCCTCAAAGAAGGAAATGCTCCCCCCGCCACCCGTGTCCTCGTCCTCCCAGAAGCCAGCCAAGCCTGCACTT
AAGAGGTCAAGGCGGGAAGCAGACACCTGTGGCCAGGACCCTCCCAAAAGTGCCAGCAGTACCAAGAGCAACCACAAAGACTCTTCCATT
CCCAAGCAGAGAAGAGTAGAGGGGAAGGGCTCCAGAAGCTCCTCGGAGCACAAGGGTTCTTCCGGAGATACTGCAAATCCTTTTCCAGTG
CCTTCTTTGCCAAATGGTAACTCTAAACCAGGGAAGCCTCAAGTGAAGTTTGACAAACAACAAGCAGACCTTCACATGAGGGAGGCAAAA
AAGATGAAGCAGAAAGCAGAGTTAATGACGGACAGGGTTGGAAAGGCTTTTAAGTACCTGGAAGCCGTCTTGTCCTTCATTGAGTGCGGA
ATTGCCACAGAGTCTGAAAGCCAGTCATCCAAGTCAGCTTACTCTGTCTACTCAGAAACTGTAGATCTCATTAAATTCATAATGTCATTA
AAATCCTTCTCAGATGCCACAGCGCCAACACAAGAGAAAATATTTGCTGTTTTATGCATGCGTTGCCAGTCCATTTTGAACATGGCGATG
TTTCGTTGTAAAAAAGACATAGCAATAAAGTATTCTCGTACTCTTAATAAACACTTCGAGAGTTCTTCCAAAGTCGCCCAGGCACCTTCT
CCATGCATTGCAAGAAGCACAGGCACACCATCCCCTCTTTCCCCAATGCCTTCTCCTGCCAGCTCCGTAGGGTCCCAGTCAAGTGCTGGC
AGTGTGGGGAGCAGTGGGGTGGCTGCCACTATCAGCACCCCAGTCACCATCCAGAATATGACATCTTCCTATGTCACCATCACATCCCAT
GTTCTTACCGCCTTTGACCTTTGGGAACAGGCCGAGGCCCTCACGAGGAAGAATAAAGAATTCTTTGCTCGGCTCAGCACAAATGTGTGC
ACCTTGGCCCTCAACAGCAGTTTGGTGGACCTGGTGCACTATACACGACAGGGTTTTCAGCAGCTACAAGAATTAACCAAAACACCTTAA

>In-frame_KMT2A_ENST00000534358_chr11_118355690_+_AFF1_ENST00000307808_chr4_88005270_+_6927nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGGAGGATTGTGAA
GCAGAAAATGTGTGGGAGATGGGAGGCTTAGGAATCTTGACTTCTGTTCCTATAACACCCAGGGTGGTTTGCTTTCTCTGTGCCAGTAGT
GGGCATGTAGAGCAGACCTACTCCAATGAAGTCCATTGTGTTGAAGAGATTCTGAAGGAAATGACCCATTCATGGCCGCCTCCTTTGACA
GCAATACATACGCCTAGTACAGCTGAGCCATCCAAGTTTCCTTTCCCTACAAAGGACTCTCAGCATGTCAGTTCTGTAACCCAAAACCAA
AAACAATATGATACATCTTCAAAAACTCACTCAAATTCTCAGCAAGGAACGTCATCCATGCTCGAAGACGACCTTCAGCTCAGTGACAGT
GAGGACAGTGACAGTGAACAAACCCCAGAGAAGCCTCCCTCCTCATCTGCACCTCCAAGTGCTCCACAGTCCCTTCCAGAACCAGTGGCA
TCAGCACATTCCAGCAGTGCAGAGTCAGAAAGCACCAGTGACTCAGACAGTTCCTCAGACTCAGAGAGCGAGAGCAGTTCAAGTGACAGC
GAAGAAAATGAGCCCCTAGAAACCCCAGCTCCGGAGCCTGAGCCTCCAACAACAAACAAATGGCAGCTGGACAACTGGCTGACCAAAGTC
AGCCAGCCAGCTGCGCCACCAGAGGGCCCCAGGAGCACAGAGCCCCCACGGCGGCACCCAGAGAGTAAGGGCAGCAGCGACAGTGCCACG
AGTCAGGAGCATTCTGAATCCAAAGATCCTCCCCCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCACCCGAAGCCCCCCACCCCGGAAAG
AGGAGCTGTCAGAAGTCTCCGGCACAGCAGGAGCCCCCACAAAGGCAAACCGTTGGAACCAAACAACCCAAAAAACCTGTCAAGGCCTCT
GCCCGGGCAGGTTCACGGACCAGCCTGCAGGGGGAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCCCGAGACCAGACTTCCAAAGACAAG
CCCAAGGTGAAGACGAAAGGACGGCCCCGGGCCGCAGCAAGCAACGAACCCAAGCCAGCAGTGCCCCCCTCCAGTGAGAAGAAGAAGCAC
AAGAGCTCCCTCCCTGCCCCCTCTAAGGCTCTCTCAGGCCCAGAACCCGCGAAGGACAATGTGGAGGACAGGACCCCTGAGCACTTTGCT
CTTGTTCCCCTGACTGAGAGCCAGGGCCCACCCCACAGTGGCAGCGGCAGCAGGACTAGTGGCTGCCGCCAAGCCGTGGTGGTCCAGGAG
GACAGCCGCAAAGACAGACTCCCATTGCCTTTGAGAGACACCAAGCTGCTCTCACCGCTCAGGGACACTCCTCCCCCACAAAGCTTGATG
GTGAAGATCACCCTAGACCTGCTCTCTCGGATACCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGGAAAGCAGAAGATAAACAGCCGCCC
GCAGGGAAGAAGCACAGCTCTGAGAAGAGGAGCTCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGAAAGGGTGAAGCAGAAAGAGACTGT
GATAACAAGAAAATCAGACTGGAGAAGGAAATCAAATCACAGTCATCTTCATCTTCATCCTCCCACAAAGAATCTTCTAAAACAAAGCCC
TCCAGGCCCTCCTCACAGTCCTCAAAGAAGGAAATGCTCCCCCCGCCACCCGTGTCCTCGTCCTCCCAGAAGCCAGCCAAGCCTGCACTT
AAGAGGTCAAGGCGGGAAGCAGACACCTGTGGCCAGGACCCTCCCAAAAGTGCCAGCAGTACCAAGAGCAACCACAAAGACTCTTCCATT
CCCAAGCAGAGAAGAGTAGAGGGGAAGGGCTCCAGAAGCTCCTCGGAGCACAAGGGTTCTTCCGGAGATACTGCAAATCCTTTTCCAGTG
CCTTCTTTGCCAAATGGTAACTCTAAACCAGGGAAGCCTCAAGTGAAGTTTGACAAACAACAAGCAGACCTTCACATGAGGGAGGCAAAA
AAGATGAAGCAGAAAGCAGAGTTAATGACGGACAGGGTTGGAAAGGCTTTTAAGTACCTGGAAGCCGTCTTGTCCTTCATTGAGTGCGGA
ATTGCCACAGAGTCTGAAAGCCAGTCATCCAAGTCAGCTTACTCTGTCTACTCAGAAACTGTAGATCTCATTAAATTCATAATGTCATTA
AAATCCTTCTCAGATGCCACAGCGCCAACACAAGAGAAAATATTTGCTGTTTTATGCATGCGTTGCCAGTCCATTTTGAACATGGCGATG
TTTCGTTGTAAAAAAGACATAGCAATAAAGTATTCTCGTACTCTTAATAAACACTTCGAGAGTTCTTCCAAAGTCGCCCAGGCACCTTCT
CCATGCATTGCAAGCACAGGCACACCATCCCCTCTTTCCCCAATGCCTTCTCCTGCCAGCTCCGTAGGGTCCCAGTCAAGTGCTGGCAGT
GTGGGGAGCAGTGGGGTGGCTGCCACTATCAGCACCCCAGTCACCATCCAGAATATGACATCTTCCTATGTCACCATCACATCCCATGTT
CTTACCGCCTTTGACCTTTGGGAACAGGCCGAGGCCCTCACGAGGAAGAATAAAGAATTCTTTGCTCGGCTCAGCACAAATGTGTGCACC

>In-frame_KMT2A_ENST00000389506_chr11_118355690_+_AFF1_ENST00000395146_chr4_88005270_+_6930nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGGAGGATTGTGAA
GCAGAAAATGTGTGGGAGATGGGAGGCTTAGGAATCTTGACTTCTGTTCCTATAACACCCAGGGTGGTTTGCTTTCTCTGTGCCAGTAGT
GGGCATGTAGAGCAGACCTACTCCAATGAAGTCCATTGTGTTGAAGAGATTCTGAAGGAAATGACCCATTCATGGCCGCCTCCTTTGACA
GCAATACATACGCCTAGTACAGCTGAGCCATCCAAGTTTCCTTTCCCTACAAAGGACTCTCAGCATGTCAGTTCTGTAACCCAAAACCAA
AAACAATATGATACATCTTCAAAAACTCACTCAAATTCTCAGCAAGGAACGTCATCCATGCTCGAAGACGACCTTCAGCTCAGTGACAGT
GAGGACAGTGACAGTGAACAAACCCCAGAGAAGCCTCCCTCCTCATCTGCACCTCCAAGTGCTCCACAGTCCCTTCCAGAACCAGTGGCA
TCAGCACATTCCAGCAGTGCAGAGTCAGAAAGCACCAGTGACTCAGACAGTTCCTCAGACTCAGAGAGCGAGAGCAGTTCAAGTGACAGC
GAAGAAAATGAGCCCCTAGAAACCCCAGCTCCGGAGCCTGAGCCTCCAACAACAAACAAATGGCAGCTGGACAACTGGCTGACCAAAGTC
AGCCAGCCAGCTGCGCCACCAGAGGGCCCCAGGAGCACAGAGCCCCCACGGCGGCACCCAGAGAGTAAGGGCAGCAGCGACAGTGCCACG
AGTCAGGAGCATTCTGAATCCAAAGATCCTCCCCCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCACCCGAAGCCCCCCACCCCGGAAAG
AGGAGCTGTCAGAAGTCTCCGGCACAGCAGGAGCCCCCACAAAGGCAAACCGTTGGAACCAAACAACCCAAAAAACCTGTCAAGGCCTCT
GCCCGGGCAGGTTCACGGACCAGCCTGCAGGGGGAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCCCGAGACCAGACTTCCAAAGACAAG
CCCAAGGTGAAGACGAAAGGACGGCCCCGGGCCGCAGCAAGCAACGAACCCAAGCCAGCAGTGCCCCCCTCCAGTGAGAAGAAGAAGCAC
AAGAGCTCCCTCCCTGCCCCCTCTAAGGCTCTCTCAGGCCCAGAACCCGCGAAGGACAATGTGGAGGACAGGACCCCTGAGCACTTTGCT
CTTGTTCCCCTGACTGAGAGCCAGGGCCCACCCCACAGTGGCAGCGGCAGCAGGACTAGTGGCTGCCGCCAAGCCGTGGTGGTCCAGGAG
GACAGCCGCAAAGACAGACTCCCATTGCCTTTGAGAGACACCAAGCTGCTCTCACCGCTCAGGGACACTCCTCCCCCACAAAGCTTGATG
GTGAAGATCACCCTAGACCTGCTCTCTCGGATACCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGGAAAGCAGAAGATAAACAGCCGCCC
GCAGGGAAGAAGCACAGCTCTGAGAAGAGGAGCTCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGAAAGGGTGAAGCAGAAAGAGACTGT
GATAACAAGAAAATCAGACTGGAGAAGGAAATCAAATCACAGTCATCTTCATCTTCATCCTCCCACAAAGAATCTTCTAAAACAAAGCCC
TCCAGGCCCTCCTCACAGTCCTCAAAGAAGGAAATGCTCCCCCCGCCACCCGTGTCCTCGTCCTCCCAGAAGCCAGCCAAGCCTGCACTT
AAGAGGTCAAGGCGGGAAGCAGACACCTGTGGCCAGGACCCTCCCAAAAGTGCCAGCAGTACCAAGAGCAACCACAAAGACTCTTCCATT
CCCAAGCAGAGAAGAGTAGAGGGGAAGGGCTCCAGAAGCTCCTCGGAGCACAAGGGTTCTTCCGGAGATACTGCAAATCCTTTTCCAGTG
CCTTCTTTGCCAAATGGTAACTCTAAACCAGGGAAGCCTCAAGTGAAGTTTGACAAACAACAAGCAGACCTTCACATGAGGGAGGCAAAA
AAGATGAAGCAGAAAGCAGAGTTAATGACGGACAGGGTTGGAAAGGCTTTTAAGTACCTGGAAGCCGTCTTGTCCTTCATTGAGTGCGGA
ATTGCCACAGAGTCTGAAAGCCAGTCATCCAAGTCAGCTTACTCTGTCTACTCAGAAACTGTAGATCTCATTAAATTCATAATGTCATTA
AAATCCTTCTCAGATGCCACAGCGCCAACACAAGAGAAAATATTTGCTGTTTTATGCATGCGTTGCCAGTCCATTTTGAACATGGCGATG
TTTCGTTGTAAAAAAGACATAGCAATAAAGTATTCTCGTACTCTTAATAAACACTTCGAGAGTTCTTCCAAAGTCGCCCAGGCACCTTCT
CCATGCATTGCAAGAAGCACAGGCACACCATCCCCTCTTTCCCCAATGCCTTCTCCTGCCAGCTCCGTAGGGTCCCAGTCAAGTGCTGGC
AGTGTGGGGAGCAGTGGGGTGGCTGCCACTATCAGCACCCCAGTCACCATCCAGAATATGACATCTTCCTATGTCACCATCACATCCCAT
GTTCTTACCGCCTTTGACCTTTGGGAACAGGCCGAGGCCCTCACGAGGAAGAATAAAGAATTCTTTGCTCGGCTCAGCACAAATGTGTGC
ACCTTGGCCCTCAACAGCAGTTTGGTGGACCTGGTGCACTATACACGACAGGGTTTTCAGCAGCTACAAGAATTAACCAAAACACCTTAA

>In-frame_KMT2A_ENST00000389506_chr11_118355690_+_AFF1_ENST00000307808_chr4_88005270_+_6927nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGGAGGATTGTGAA
GCAGAAAATGTGTGGGAGATGGGAGGCTTAGGAATCTTGACTTCTGTTCCTATAACACCCAGGGTGGTTTGCTTTCTCTGTGCCAGTAGT
GGGCATGTAGAGCAGACCTACTCCAATGAAGTCCATTGTGTTGAAGAGATTCTGAAGGAAATGACCCATTCATGGCCGCCTCCTTTGACA
GCAATACATACGCCTAGTACAGCTGAGCCATCCAAGTTTCCTTTCCCTACAAAGGACTCTCAGCATGTCAGTTCTGTAACCCAAAACCAA
AAACAATATGATACATCTTCAAAAACTCACTCAAATTCTCAGCAAGGAACGTCATCCATGCTCGAAGACGACCTTCAGCTCAGTGACAGT
GAGGACAGTGACAGTGAACAAACCCCAGAGAAGCCTCCCTCCTCATCTGCACCTCCAAGTGCTCCACAGTCCCTTCCAGAACCAGTGGCA
TCAGCACATTCCAGCAGTGCAGAGTCAGAAAGCACCAGTGACTCAGACAGTTCCTCAGACTCAGAGAGCGAGAGCAGTTCAAGTGACAGC
GAAGAAAATGAGCCCCTAGAAACCCCAGCTCCGGAGCCTGAGCCTCCAACAACAAACAAATGGCAGCTGGACAACTGGCTGACCAAAGTC
AGCCAGCCAGCTGCGCCACCAGAGGGCCCCAGGAGCACAGAGCCCCCACGGCGGCACCCAGAGAGTAAGGGCAGCAGCGACAGTGCCACG
AGTCAGGAGCATTCTGAATCCAAAGATCCTCCCCCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCACCCGAAGCCCCCCACCCCGGAAAG
AGGAGCTGTCAGAAGTCTCCGGCACAGCAGGAGCCCCCACAAAGGCAAACCGTTGGAACCAAACAACCCAAAAAACCTGTCAAGGCCTCT
GCCCGGGCAGGTTCACGGACCAGCCTGCAGGGGGAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCCCGAGACCAGACTTCCAAAGACAAG
CCCAAGGTGAAGACGAAAGGACGGCCCCGGGCCGCAGCAAGCAACGAACCCAAGCCAGCAGTGCCCCCCTCCAGTGAGAAGAAGAAGCAC
AAGAGCTCCCTCCCTGCCCCCTCTAAGGCTCTCTCAGGCCCAGAACCCGCGAAGGACAATGTGGAGGACAGGACCCCTGAGCACTTTGCT
CTTGTTCCCCTGACTGAGAGCCAGGGCCCACCCCACAGTGGCAGCGGCAGCAGGACTAGTGGCTGCCGCCAAGCCGTGGTGGTCCAGGAG
GACAGCCGCAAAGACAGACTCCCATTGCCTTTGAGAGACACCAAGCTGCTCTCACCGCTCAGGGACACTCCTCCCCCACAAAGCTTGATG
GTGAAGATCACCCTAGACCTGCTCTCTCGGATACCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGGAAAGCAGAAGATAAACAGCCGCCC
GCAGGGAAGAAGCACAGCTCTGAGAAGAGGAGCTCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGAAAGGGTGAAGCAGAAAGAGACTGT
GATAACAAGAAAATCAGACTGGAGAAGGAAATCAAATCACAGTCATCTTCATCTTCATCCTCCCACAAAGAATCTTCTAAAACAAAGCCC
TCCAGGCCCTCCTCACAGTCCTCAAAGAAGGAAATGCTCCCCCCGCCACCCGTGTCCTCGTCCTCCCAGAAGCCAGCCAAGCCTGCACTT
AAGAGGTCAAGGCGGGAAGCAGACACCTGTGGCCAGGACCCTCCCAAAAGTGCCAGCAGTACCAAGAGCAACCACAAAGACTCTTCCATT
CCCAAGCAGAGAAGAGTAGAGGGGAAGGGCTCCAGAAGCTCCTCGGAGCACAAGGGTTCTTCCGGAGATACTGCAAATCCTTTTCCAGTG
CCTTCTTTGCCAAATGGTAACTCTAAACCAGGGAAGCCTCAAGTGAAGTTTGACAAACAACAAGCAGACCTTCACATGAGGGAGGCAAAA
AAGATGAAGCAGAAAGCAGAGTTAATGACGGACAGGGTTGGAAAGGCTTTTAAGTACCTGGAAGCCGTCTTGTCCTTCATTGAGTGCGGA
ATTGCCACAGAGTCTGAAAGCCAGTCATCCAAGTCAGCTTACTCTGTCTACTCAGAAACTGTAGATCTCATTAAATTCATAATGTCATTA
AAATCCTTCTCAGATGCCACAGCGCCAACACAAGAGAAAATATTTGCTGTTTTATGCATGCGTTGCCAGTCCATTTTGAACATGGCGATG
TTTCGTTGTAAAAAAGACATAGCAATAAAGTATTCTCGTACTCTTAATAAACACTTCGAGAGTTCTTCCAAAGTCGCCCAGGCACCTTCT
CCATGCATTGCAAGCACAGGCACACCATCCCCTCTTTCCCCAATGCCTTCTCCTGCCAGCTCCGTAGGGTCCCAGTCAAGTGCTGGCAGT
GTGGGGAGCAGTGGGGTGGCTGCCACTATCAGCACCCCAGTCACCATCCAGAATATGACATCTTCCTATGTCACCATCACATCCCATGTT
CTTACCGCCTTTGACCTTTGGGAACAGGCCGAGGCCCTCACGAGGAAGAATAAAGAATTCTTTGCTCGGCTCAGCACAAATGTGTGCACC

>In-frame_KMT2A_ENST00000534358_chr11_118353211_+_AFF1_ENST00000395146_chr4_88011134_+_6639nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAATGACCCATTCATGGCCGCCTCCTTTGACAGCAATACATACGCCTAGTACA
GCTGAGCCATCCAAGTTTCCTTTCCCTACAAAGGACTCTCAGCATGTCAGTTCTGTAACCCAAAACCAAAAACAATATGATACATCTTCA
AAAACTCACTCAAATTCTCAGCAAGGAACGTCATCCATGCTCGAAGACGACCTTCAGCTCAGTGACAGTGAGGACAGTGACAGTGAACAA
ACCCCAGAGAAGCCTCCCTCCTCATCTGCACCTCCAAGTGCTCCACAGTCCCTTCCAGAACCAGTGGCATCAGCACATTCCAGCAGTGCA
GAGTCAGAAAGCACCAGTGACTCAGACAGTTCCTCAGACTCAGAGAGCGAGAGCAGTTCAAGTGACAGCGAAGAAAATGAGCCCCTAGAA
ACCCCAGCTCCGGAGCCTGAGCCTCCAACAACAAACAAATGGCAGCTGGACAACTGGCTGACCAAAGTCAGCCAGCCAGCTGCGCCACCA
GAGGGCCCCAGGAGCACAGAGCCCCCACGGCGGCACCCAGAGAGTAAGGGCAGCAGCGACAGTGCCACGAGTCAGGAGCATTCTGAATCC
AAAGATCCTCCCCCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCACCCGAAGCCCCCCACCCCGGAAAGAGGAGCTGTCAGAAGTCTCCG
GCACAGCAGGAGCCCCCACAAAGGCAAACCGTTGGAACCAAACAACCCAAAAAACCTGTCAAGGCCTCTGCCCGGGCAGGTTCACGGACC
AGCCTGCAGGGGGAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCCCGAGACCAGACTTCCAAAGACAAGCCCAAGGTGAAGACGAAAGGA
CGGCCCCGGGCCGCAGCAAGCAACGAACCCAAGCCAGCAGTGCCCCCCTCCAGTGAGAAGAAGAAGCACAAGAGCTCCCTCCCTGCCCCC
TCTAAGGCTCTCTCAGGCCCAGAACCCGCGAAGGACAATGTGGAGGACAGGACCCCTGAGCACTTTGCTCTTGTTCCCCTGACTGAGAGC
CAGGGCCCACCCCACAGTGGCAGCGGCAGCAGGACTAGTGGCTGCCGCCAAGCCGTGGTGGTCCAGGAGGACAGCCGCAAAGACAGACTC
CCATTGCCTTTGAGAGACACCAAGCTGCTCTCACCGCTCAGGGACACTCCTCCCCCACAAAGCTTGATGGTGAAGATCACCCTAGACCTG
CTCTCTCGGATACCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGGAAAGCAGAAGATAAACAGCCGCCCGCAGGGAAGAAGCACAGCTCT
GAGAAGAGGAGCTCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGAAAGGGTGAAGCAGAAAGAGACTGTGATAACAAGAAAATCAGACTG
GAGAAGGAAATCAAATCACAGTCATCTTCATCTTCATCCTCCCACAAAGAATCTTCTAAAACAAAGCCCTCCAGGCCCTCCTCACAGTCC
TCAAAGAAGGAAATGCTCCCCCCGCCACCCGTGTCCTCGTCCTCCCAGAAGCCAGCCAAGCCTGCACTTAAGAGGTCAAGGCGGGAAGCA
GACACCTGTGGCCAGGACCCTCCCAAAAGTGCCAGCAGTACCAAGAGCAACCACAAAGACTCTTCCATTCCCAAGCAGAGAAGAGTAGAG
GGGAAGGGCTCCAGAAGCTCCTCGGAGCACAAGGGTTCTTCCGGAGATACTGCAAATCCTTTTCCAGTGCCTTCTTTGCCAAATGGTAAC
TCTAAACCAGGGAAGCCTCAAGTGAAGTTTGACAAACAACAAGCAGACCTTCACATGAGGGAGGCAAAAAAGATGAAGCAGAAAGCAGAG
TTAATGACGGACAGGGTTGGAAAGGCTTTTAAGTACCTGGAAGCCGTCTTGTCCTTCATTGAGTGCGGAATTGCCACAGAGTCTGAAAGC
CAGTCATCCAAGTCAGCTTACTCTGTCTACTCAGAAACTGTAGATCTCATTAAATTCATAATGTCATTAAAATCCTTCTCAGATGCCACA
GCGCCAACACAAGAGAAAATATTTGCTGTTTTATGCATGCGTTGCCAGTCCATTTTGAACATGGCGATGTTTCGTTGTAAAAAAGACATA
GCAATAAAGTATTCTCGTACTCTTAATAAACACTTCGAGAGTTCTTCCAAAGTCGCCCAGGCACCTTCTCCATGCATTGCAAGAAGCACA
GGCACACCATCCCCTCTTTCCCCAATGCCTTCTCCTGCCAGCTCCGTAGGGTCCCAGTCAAGTGCTGGCAGTGTGGGGAGCAGTGGGGTG
GCTGCCACTATCAGCACCCCAGTCACCATCCAGAATATGACATCTTCCTATGTCACCATCACATCCCATGTTCTTACCGCCTTTGACCTT
TGGGAACAGGCCGAGGCCCTCACGAGGAAGAATAAAGAATTCTTTGCTCGGCTCAGCACAAATGTGTGCACCTTGGCCCTCAACAGCAGT

>In-frame_KMT2A_ENST00000534358_chr11_118353211_+_AFF1_ENST00000307808_chr4_88011134_+_6636nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAATGACCCATTCATGGCCGCCTCCTTTGACAGCAATACATACGCCTAGTACA
GCTGAGCCATCCAAGTTTCCTTTCCCTACAAAGGACTCTCAGCATGTCAGTTCTGTAACCCAAAACCAAAAACAATATGATACATCTTCA
AAAACTCACTCAAATTCTCAGCAAGGAACGTCATCCATGCTCGAAGACGACCTTCAGCTCAGTGACAGTGAGGACAGTGACAGTGAACAA
ACCCCAGAGAAGCCTCCCTCCTCATCTGCACCTCCAAGTGCTCCACAGTCCCTTCCAGAACCAGTGGCATCAGCACATTCCAGCAGTGCA
GAGTCAGAAAGCACCAGTGACTCAGACAGTTCCTCAGACTCAGAGAGCGAGAGCAGTTCAAGTGACAGCGAAGAAAATGAGCCCCTAGAA
ACCCCAGCTCCGGAGCCTGAGCCTCCAACAACAAACAAATGGCAGCTGGACAACTGGCTGACCAAAGTCAGCCAGCCAGCTGCGCCACCA
GAGGGCCCCAGGAGCACAGAGCCCCCACGGCGGCACCCAGAGAGTAAGGGCAGCAGCGACAGTGCCACGAGTCAGGAGCATTCTGAATCC
AAAGATCCTCCCCCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCACCCGAAGCCCCCCACCCCGGAAAGAGGAGCTGTCAGAAGTCTCCG
GCACAGCAGGAGCCCCCACAAAGGCAAACCGTTGGAACCAAACAACCCAAAAAACCTGTCAAGGCCTCTGCCCGGGCAGGTTCACGGACC
AGCCTGCAGGGGGAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCCCGAGACCAGACTTCCAAAGACAAGCCCAAGGTGAAGACGAAAGGA
CGGCCCCGGGCCGCAGCAAGCAACGAACCCAAGCCAGCAGTGCCCCCCTCCAGTGAGAAGAAGAAGCACAAGAGCTCCCTCCCTGCCCCC
TCTAAGGCTCTCTCAGGCCCAGAACCCGCGAAGGACAATGTGGAGGACAGGACCCCTGAGCACTTTGCTCTTGTTCCCCTGACTGAGAGC
CAGGGCCCACCCCACAGTGGCAGCGGCAGCAGGACTAGTGGCTGCCGCCAAGCCGTGGTGGTCCAGGAGGACAGCCGCAAAGACAGACTC
CCATTGCCTTTGAGAGACACCAAGCTGCTCTCACCGCTCAGGGACACTCCTCCCCCACAAAGCTTGATGGTGAAGATCACCCTAGACCTG
CTCTCTCGGATACCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGGAAAGCAGAAGATAAACAGCCGCCCGCAGGGAAGAAGCACAGCTCT
GAGAAGAGGAGCTCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGAAAGGGTGAAGCAGAAAGAGACTGTGATAACAAGAAAATCAGACTG
GAGAAGGAAATCAAATCACAGTCATCTTCATCTTCATCCTCCCACAAAGAATCTTCTAAAACAAAGCCCTCCAGGCCCTCCTCACAGTCC
TCAAAGAAGGAAATGCTCCCCCCGCCACCCGTGTCCTCGTCCTCCCAGAAGCCAGCCAAGCCTGCACTTAAGAGGTCAAGGCGGGAAGCA
GACACCTGTGGCCAGGACCCTCCCAAAAGTGCCAGCAGTACCAAGAGCAACCACAAAGACTCTTCCATTCCCAAGCAGAGAAGAGTAGAG
GGGAAGGGCTCCAGAAGCTCCTCGGAGCACAAGGGTTCTTCCGGAGATACTGCAAATCCTTTTCCAGTGCCTTCTTTGCCAAATGGTAAC
TCTAAACCAGGGAAGCCTCAAGTGAAGTTTGACAAACAACAAGCAGACCTTCACATGAGGGAGGCAAAAAAGATGAAGCAGAAAGCAGAG
TTAATGACGGACAGGGTTGGAAAGGCTTTTAAGTACCTGGAAGCCGTCTTGTCCTTCATTGAGTGCGGAATTGCCACAGAGTCTGAAAGC
CAGTCATCCAAGTCAGCTTACTCTGTCTACTCAGAAACTGTAGATCTCATTAAATTCATAATGTCATTAAAATCCTTCTCAGATGCCACA
GCGCCAACACAAGAGAAAATATTTGCTGTTTTATGCATGCGTTGCCAGTCCATTTTGAACATGGCGATGTTTCGTTGTAAAAAAGACATA
GCAATAAAGTATTCTCGTACTCTTAATAAACACTTCGAGAGTTCTTCCAAAGTCGCCCAGGCACCTTCTCCATGCATTGCAAGCACAGGC
ACACCATCCCCTCTTTCCCCAATGCCTTCTCCTGCCAGCTCCGTAGGGTCCCAGTCAAGTGCTGGCAGTGTGGGGAGCAGTGGGGTGGCT
GCCACTATCAGCACCCCAGTCACCATCCAGAATATGACATCTTCCTATGTCACCATCACATCCCATGTTCTTACCGCCTTTGACCTTTGG
GAACAGGCCGAGGCCCTCACGAGGAAGAATAAAGAATTCTTTGCTCGGCTCAGCACAAATGTGTGCACCTTGGCCCTCAACAGCAGTTTG

>In-frame_KMT2A_ENST00000389506_chr11_118353211_+_AFF1_ENST00000395146_chr4_88011134_+_6639nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAATGACCCATTCATGGCCGCCTCCTTTGACAGCAATACATACGCCTAGTACA
GCTGAGCCATCCAAGTTTCCTTTCCCTACAAAGGACTCTCAGCATGTCAGTTCTGTAACCCAAAACCAAAAACAATATGATACATCTTCA
AAAACTCACTCAAATTCTCAGCAAGGAACGTCATCCATGCTCGAAGACGACCTTCAGCTCAGTGACAGTGAGGACAGTGACAGTGAACAA
ACCCCAGAGAAGCCTCCCTCCTCATCTGCACCTCCAAGTGCTCCACAGTCCCTTCCAGAACCAGTGGCATCAGCACATTCCAGCAGTGCA
GAGTCAGAAAGCACCAGTGACTCAGACAGTTCCTCAGACTCAGAGAGCGAGAGCAGTTCAAGTGACAGCGAAGAAAATGAGCCCCTAGAA
ACCCCAGCTCCGGAGCCTGAGCCTCCAACAACAAACAAATGGCAGCTGGACAACTGGCTGACCAAAGTCAGCCAGCCAGCTGCGCCACCA
GAGGGCCCCAGGAGCACAGAGCCCCCACGGCGGCACCCAGAGAGTAAGGGCAGCAGCGACAGTGCCACGAGTCAGGAGCATTCTGAATCC
AAAGATCCTCCCCCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCACCCGAAGCCCCCCACCCCGGAAAGAGGAGCTGTCAGAAGTCTCCG
GCACAGCAGGAGCCCCCACAAAGGCAAACCGTTGGAACCAAACAACCCAAAAAACCTGTCAAGGCCTCTGCCCGGGCAGGTTCACGGACC
AGCCTGCAGGGGGAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCCCGAGACCAGACTTCCAAAGACAAGCCCAAGGTGAAGACGAAAGGA
CGGCCCCGGGCCGCAGCAAGCAACGAACCCAAGCCAGCAGTGCCCCCCTCCAGTGAGAAGAAGAAGCACAAGAGCTCCCTCCCTGCCCCC
TCTAAGGCTCTCTCAGGCCCAGAACCCGCGAAGGACAATGTGGAGGACAGGACCCCTGAGCACTTTGCTCTTGTTCCCCTGACTGAGAGC
CAGGGCCCACCCCACAGTGGCAGCGGCAGCAGGACTAGTGGCTGCCGCCAAGCCGTGGTGGTCCAGGAGGACAGCCGCAAAGACAGACTC
CCATTGCCTTTGAGAGACACCAAGCTGCTCTCACCGCTCAGGGACACTCCTCCCCCACAAAGCTTGATGGTGAAGATCACCCTAGACCTG
CTCTCTCGGATACCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGGAAAGCAGAAGATAAACAGCCGCCCGCAGGGAAGAAGCACAGCTCT
GAGAAGAGGAGCTCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGAAAGGGTGAAGCAGAAAGAGACTGTGATAACAAGAAAATCAGACTG
GAGAAGGAAATCAAATCACAGTCATCTTCATCTTCATCCTCCCACAAAGAATCTTCTAAAACAAAGCCCTCCAGGCCCTCCTCACAGTCC
TCAAAGAAGGAAATGCTCCCCCCGCCACCCGTGTCCTCGTCCTCCCAGAAGCCAGCCAAGCCTGCACTTAAGAGGTCAAGGCGGGAAGCA
GACACCTGTGGCCAGGACCCTCCCAAAAGTGCCAGCAGTACCAAGAGCAACCACAAAGACTCTTCCATTCCCAAGCAGAGAAGAGTAGAG
GGGAAGGGCTCCAGAAGCTCCTCGGAGCACAAGGGTTCTTCCGGAGATACTGCAAATCCTTTTCCAGTGCCTTCTTTGCCAAATGGTAAC
TCTAAACCAGGGAAGCCTCAAGTGAAGTTTGACAAACAACAAGCAGACCTTCACATGAGGGAGGCAAAAAAGATGAAGCAGAAAGCAGAG
TTAATGACGGACAGGGTTGGAAAGGCTTTTAAGTACCTGGAAGCCGTCTTGTCCTTCATTGAGTGCGGAATTGCCACAGAGTCTGAAAGC
CAGTCATCCAAGTCAGCTTACTCTGTCTACTCAGAAACTGTAGATCTCATTAAATTCATAATGTCATTAAAATCCTTCTCAGATGCCACA
GCGCCAACACAAGAGAAAATATTTGCTGTTTTATGCATGCGTTGCCAGTCCATTTTGAACATGGCGATGTTTCGTTGTAAAAAAGACATA
GCAATAAAGTATTCTCGTACTCTTAATAAACACTTCGAGAGTTCTTCCAAAGTCGCCCAGGCACCTTCTCCATGCATTGCAAGAAGCACA
GGCACACCATCCCCTCTTTCCCCAATGCCTTCTCCTGCCAGCTCCGTAGGGTCCCAGTCAAGTGCTGGCAGTGTGGGGAGCAGTGGGGTG
GCTGCCACTATCAGCACCCCAGTCACCATCCAGAATATGACATCTTCCTATGTCACCATCACATCCCATGTTCTTACCGCCTTTGACCTT
TGGGAACAGGCCGAGGCCCTCACGAGGAAGAATAAAGAATTCTTTGCTCGGCTCAGCACAAATGTGTGCACCTTGGCCCTCAACAGCAGT

>In-frame_KMT2A_ENST00000389506_chr11_118353211_+_AFF1_ENST00000307808_chr4_88011134_+_6636nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAATGACCCATTCATGGCCGCCTCCTTTGACAGCAATACATACGCCTAGTACA
GCTGAGCCATCCAAGTTTCCTTTCCCTACAAAGGACTCTCAGCATGTCAGTTCTGTAACCCAAAACCAAAAACAATATGATACATCTTCA
AAAACTCACTCAAATTCTCAGCAAGGAACGTCATCCATGCTCGAAGACGACCTTCAGCTCAGTGACAGTGAGGACAGTGACAGTGAACAA
ACCCCAGAGAAGCCTCCCTCCTCATCTGCACCTCCAAGTGCTCCACAGTCCCTTCCAGAACCAGTGGCATCAGCACATTCCAGCAGTGCA
GAGTCAGAAAGCACCAGTGACTCAGACAGTTCCTCAGACTCAGAGAGCGAGAGCAGTTCAAGTGACAGCGAAGAAAATGAGCCCCTAGAA
ACCCCAGCTCCGGAGCCTGAGCCTCCAACAACAAACAAATGGCAGCTGGACAACTGGCTGACCAAAGTCAGCCAGCCAGCTGCGCCACCA
GAGGGCCCCAGGAGCACAGAGCCCCCACGGCGGCACCCAGAGAGTAAGGGCAGCAGCGACAGTGCCACGAGTCAGGAGCATTCTGAATCC
AAAGATCCTCCCCCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCACCCGAAGCCCCCCACCCCGGAAAGAGGAGCTGTCAGAAGTCTCCG
GCACAGCAGGAGCCCCCACAAAGGCAAACCGTTGGAACCAAACAACCCAAAAAACCTGTCAAGGCCTCTGCCCGGGCAGGTTCACGGACC
AGCCTGCAGGGGGAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCCCGAGACCAGACTTCCAAAGACAAGCCCAAGGTGAAGACGAAAGGA
CGGCCCCGGGCCGCAGCAAGCAACGAACCCAAGCCAGCAGTGCCCCCCTCCAGTGAGAAGAAGAAGCACAAGAGCTCCCTCCCTGCCCCC
TCTAAGGCTCTCTCAGGCCCAGAACCCGCGAAGGACAATGTGGAGGACAGGACCCCTGAGCACTTTGCTCTTGTTCCCCTGACTGAGAGC
CAGGGCCCACCCCACAGTGGCAGCGGCAGCAGGACTAGTGGCTGCCGCCAAGCCGTGGTGGTCCAGGAGGACAGCCGCAAAGACAGACTC
CCATTGCCTTTGAGAGACACCAAGCTGCTCTCACCGCTCAGGGACACTCCTCCCCCACAAAGCTTGATGGTGAAGATCACCCTAGACCTG
CTCTCTCGGATACCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGGAAAGCAGAAGATAAACAGCCGCCCGCAGGGAAGAAGCACAGCTCT
GAGAAGAGGAGCTCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGAAAGGGTGAAGCAGAAAGAGACTGTGATAACAAGAAAATCAGACTG
GAGAAGGAAATCAAATCACAGTCATCTTCATCTTCATCCTCCCACAAAGAATCTTCTAAAACAAAGCCCTCCAGGCCCTCCTCACAGTCC
TCAAAGAAGGAAATGCTCCCCCCGCCACCCGTGTCCTCGTCCTCCCAGAAGCCAGCCAAGCCTGCACTTAAGAGGTCAAGGCGGGAAGCA
GACACCTGTGGCCAGGACCCTCCCAAAAGTGCCAGCAGTACCAAGAGCAACCACAAAGACTCTTCCATTCCCAAGCAGAGAAGAGTAGAG
GGGAAGGGCTCCAGAAGCTCCTCGGAGCACAAGGGTTCTTCCGGAGATACTGCAAATCCTTTTCCAGTGCCTTCTTTGCCAAATGGTAAC
TCTAAACCAGGGAAGCCTCAAGTGAAGTTTGACAAACAACAAGCAGACCTTCACATGAGGGAGGCAAAAAAGATGAAGCAGAAAGCAGAG
TTAATGACGGACAGGGTTGGAAAGGCTTTTAAGTACCTGGAAGCCGTCTTGTCCTTCATTGAGTGCGGAATTGCCACAGAGTCTGAAAGC
CAGTCATCCAAGTCAGCTTACTCTGTCTACTCAGAAACTGTAGATCTCATTAAATTCATAATGTCATTAAAATCCTTCTCAGATGCCACA
GCGCCAACACAAGAGAAAATATTTGCTGTTTTATGCATGCGTTGCCAGTCCATTTTGAACATGGCGATGTTTCGTTGTAAAAAAGACATA
GCAATAAAGTATTCTCGTACTCTTAATAAACACTTCGAGAGTTCTTCCAAAGTCGCCCAGGCACCTTCTCCATGCATTGCAAGCACAGGC
ACACCATCCCCTCTTTCCCCAATGCCTTCTCCTGCCAGCTCCGTAGGGTCCCAGTCAAGTGCTGGCAGTGTGGGGAGCAGTGGGGTGGCT
GCCACTATCAGCACCCCAGTCACCATCCAGAATATGACATCTTCCTATGTCACCATCACATCCCATGTTCTTACCGCCTTTGACCTTTGG
GAACAGGCCGAGGCCCTCACGAGGAAGAATAAAGAATTCTTTGCTCGGCTCAGCACAAATGTGTGCACCTTGGCCCTCAACAGCAGTTTG

>In-frame_KMT2A_ENST00000354520_chr11_118353211_+_AFF1_ENST00000395146_chr4_88011134_+_6639nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAATGACCCATTCATGGCCGCCTCCTTTGACAGCAATACATACGCCTAGTACA
GCTGAGCCATCCAAGTTTCCTTTCCCTACAAAGGACTCTCAGCATGTCAGTTCTGTAACCCAAAACCAAAAACAATATGATACATCTTCA
AAAACTCACTCAAATTCTCAGCAAGGAACGTCATCCATGCTCGAAGACGACCTTCAGCTCAGTGACAGTGAGGACAGTGACAGTGAACAA
ACCCCAGAGAAGCCTCCCTCCTCATCTGCACCTCCAAGTGCTCCACAGTCCCTTCCAGAACCAGTGGCATCAGCACATTCCAGCAGTGCA
GAGTCAGAAAGCACCAGTGACTCAGACAGTTCCTCAGACTCAGAGAGCGAGAGCAGTTCAAGTGACAGCGAAGAAAATGAGCCCCTAGAA
ACCCCAGCTCCGGAGCCTGAGCCTCCAACAACAAACAAATGGCAGCTGGACAACTGGCTGACCAAAGTCAGCCAGCCAGCTGCGCCACCA
GAGGGCCCCAGGAGCACAGAGCCCCCACGGCGGCACCCAGAGAGTAAGGGCAGCAGCGACAGTGCCACGAGTCAGGAGCATTCTGAATCC
AAAGATCCTCCCCCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCACCCGAAGCCCCCCACCCCGGAAAGAGGAGCTGTCAGAAGTCTCCG
GCACAGCAGGAGCCCCCACAAAGGCAAACCGTTGGAACCAAACAACCCAAAAAACCTGTCAAGGCCTCTGCCCGGGCAGGTTCACGGACC
AGCCTGCAGGGGGAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCCCGAGACCAGACTTCCAAAGACAAGCCCAAGGTGAAGACGAAAGGA
CGGCCCCGGGCCGCAGCAAGCAACGAACCCAAGCCAGCAGTGCCCCCCTCCAGTGAGAAGAAGAAGCACAAGAGCTCCCTCCCTGCCCCC
TCTAAGGCTCTCTCAGGCCCAGAACCCGCGAAGGACAATGTGGAGGACAGGACCCCTGAGCACTTTGCTCTTGTTCCCCTGACTGAGAGC
CAGGGCCCACCCCACAGTGGCAGCGGCAGCAGGACTAGTGGCTGCCGCCAAGCCGTGGTGGTCCAGGAGGACAGCCGCAAAGACAGACTC
CCATTGCCTTTGAGAGACACCAAGCTGCTCTCACCGCTCAGGGACACTCCTCCCCCACAAAGCTTGATGGTGAAGATCACCCTAGACCTG
CTCTCTCGGATACCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGGAAAGCAGAAGATAAACAGCCGCCCGCAGGGAAGAAGCACAGCTCT
GAGAAGAGGAGCTCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGAAAGGGTGAAGCAGAAAGAGACTGTGATAACAAGAAAATCAGACTG
GAGAAGGAAATCAAATCACAGTCATCTTCATCTTCATCCTCCCACAAAGAATCTTCTAAAACAAAGCCCTCCAGGCCCTCCTCACAGTCC
TCAAAGAAGGAAATGCTCCCCCCGCCACCCGTGTCCTCGTCCTCCCAGAAGCCAGCCAAGCCTGCACTTAAGAGGTCAAGGCGGGAAGCA
GACACCTGTGGCCAGGACCCTCCCAAAAGTGCCAGCAGTACCAAGAGCAACCACAAAGACTCTTCCATTCCCAAGCAGAGAAGAGTAGAG
GGGAAGGGCTCCAGAAGCTCCTCGGAGCACAAGGGTTCTTCCGGAGATACTGCAAATCCTTTTCCAGTGCCTTCTTTGCCAAATGGTAAC
TCTAAACCAGGGAAGCCTCAAGTGAAGTTTGACAAACAACAAGCAGACCTTCACATGAGGGAGGCAAAAAAGATGAAGCAGAAAGCAGAG
TTAATGACGGACAGGGTTGGAAAGGCTTTTAAGTACCTGGAAGCCGTCTTGTCCTTCATTGAGTGCGGAATTGCCACAGAGTCTGAAAGC
CAGTCATCCAAGTCAGCTTACTCTGTCTACTCAGAAACTGTAGATCTCATTAAATTCATAATGTCATTAAAATCCTTCTCAGATGCCACA
GCGCCAACACAAGAGAAAATATTTGCTGTTTTATGCATGCGTTGCCAGTCCATTTTGAACATGGCGATGTTTCGTTGTAAAAAAGACATA
GCAATAAAGTATTCTCGTACTCTTAATAAACACTTCGAGAGTTCTTCCAAAGTCGCCCAGGCACCTTCTCCATGCATTGCAAGAAGCACA
GGCACACCATCCCCTCTTTCCCCAATGCCTTCTCCTGCCAGCTCCGTAGGGTCCCAGTCAAGTGCTGGCAGTGTGGGGAGCAGTGGGGTG
GCTGCCACTATCAGCACCCCAGTCACCATCCAGAATATGACATCTTCCTATGTCACCATCACATCCCATGTTCTTACCGCCTTTGACCTT
TGGGAACAGGCCGAGGCCCTCACGAGGAAGAATAAAGAATTCTTTGCTCGGCTCAGCACAAATGTGTGCACCTTGGCCCTCAACAGCAGT

>In-frame_KMT2A_ENST00000354520_chr11_118353211_+_AFF1_ENST00000307808_chr4_88011134_+_6636nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAATGACCCATTCATGGCCGCCTCCTTTGACAGCAATACATACGCCTAGTACA
GCTGAGCCATCCAAGTTTCCTTTCCCTACAAAGGACTCTCAGCATGTCAGTTCTGTAACCCAAAACCAAAAACAATATGATACATCTTCA
AAAACTCACTCAAATTCTCAGCAAGGAACGTCATCCATGCTCGAAGACGACCTTCAGCTCAGTGACAGTGAGGACAGTGACAGTGAACAA
ACCCCAGAGAAGCCTCCCTCCTCATCTGCACCTCCAAGTGCTCCACAGTCCCTTCCAGAACCAGTGGCATCAGCACATTCCAGCAGTGCA
GAGTCAGAAAGCACCAGTGACTCAGACAGTTCCTCAGACTCAGAGAGCGAGAGCAGTTCAAGTGACAGCGAAGAAAATGAGCCCCTAGAA
ACCCCAGCTCCGGAGCCTGAGCCTCCAACAACAAACAAATGGCAGCTGGACAACTGGCTGACCAAAGTCAGCCAGCCAGCTGCGCCACCA
GAGGGCCCCAGGAGCACAGAGCCCCCACGGCGGCACCCAGAGAGTAAGGGCAGCAGCGACAGTGCCACGAGTCAGGAGCATTCTGAATCC
AAAGATCCTCCCCCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCACCCGAAGCCCCCCACCCCGGAAAGAGGAGCTGTCAGAAGTCTCCG
GCACAGCAGGAGCCCCCACAAAGGCAAACCGTTGGAACCAAACAACCCAAAAAACCTGTCAAGGCCTCTGCCCGGGCAGGTTCACGGACC
AGCCTGCAGGGGGAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCCCGAGACCAGACTTCCAAAGACAAGCCCAAGGTGAAGACGAAAGGA
CGGCCCCGGGCCGCAGCAAGCAACGAACCCAAGCCAGCAGTGCCCCCCTCCAGTGAGAAGAAGAAGCACAAGAGCTCCCTCCCTGCCCCC
TCTAAGGCTCTCTCAGGCCCAGAACCCGCGAAGGACAATGTGGAGGACAGGACCCCTGAGCACTTTGCTCTTGTTCCCCTGACTGAGAGC
CAGGGCCCACCCCACAGTGGCAGCGGCAGCAGGACTAGTGGCTGCCGCCAAGCCGTGGTGGTCCAGGAGGACAGCCGCAAAGACAGACTC
CCATTGCCTTTGAGAGACACCAAGCTGCTCTCACCGCTCAGGGACACTCCTCCCCCACAAAGCTTGATGGTGAAGATCACCCTAGACCTG
CTCTCTCGGATACCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGGAAAGCAGAAGATAAACAGCCGCCCGCAGGGAAGAAGCACAGCTCT
GAGAAGAGGAGCTCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGAAAGGGTGAAGCAGAAAGAGACTGTGATAACAAGAAAATCAGACTG
GAGAAGGAAATCAAATCACAGTCATCTTCATCTTCATCCTCCCACAAAGAATCTTCTAAAACAAAGCCCTCCAGGCCCTCCTCACAGTCC
TCAAAGAAGGAAATGCTCCCCCCGCCACCCGTGTCCTCGTCCTCCCAGAAGCCAGCCAAGCCTGCACTTAAGAGGTCAAGGCGGGAAGCA
GACACCTGTGGCCAGGACCCTCCCAAAAGTGCCAGCAGTACCAAGAGCAACCACAAAGACTCTTCCATTCCCAAGCAGAGAAGAGTAGAG
GGGAAGGGCTCCAGAAGCTCCTCGGAGCACAAGGGTTCTTCCGGAGATACTGCAAATCCTTTTCCAGTGCCTTCTTTGCCAAATGGTAAC
TCTAAACCAGGGAAGCCTCAAGTGAAGTTTGACAAACAACAAGCAGACCTTCACATGAGGGAGGCAAAAAAGATGAAGCAGAAAGCAGAG
TTAATGACGGACAGGGTTGGAAAGGCTTTTAAGTACCTGGAAGCCGTCTTGTCCTTCATTGAGTGCGGAATTGCCACAGAGTCTGAAAGC
CAGTCATCCAAGTCAGCTTACTCTGTCTACTCAGAAACTGTAGATCTCATTAAATTCATAATGTCATTAAAATCCTTCTCAGATGCCACA
GCGCCAACACAAGAGAAAATATTTGCTGTTTTATGCATGCGTTGCCAGTCCATTTTGAACATGGCGATGTTTCGTTGTAAAAAAGACATA
GCAATAAAGTATTCTCGTACTCTTAATAAACACTTCGAGAGTTCTTCCAAAGTCGCCCAGGCACCTTCTCCATGCATTGCAAGCACAGGC
ACACCATCCCCTCTTTCCCCAATGCCTTCTCCTGCCAGCTCCGTAGGGTCCCAGTCAAGTGCTGGCAGTGTGGGGAGCAGTGGGGTGGCT
GCCACTATCAGCACCCCAGTCACCATCCAGAATATGACATCTTCCTATGTCACCATCACATCCCATGTTCTTACCGCCTTTGACCTTTGG
GAACAGGCCGAGGCCCTCACGAGGAAGAATAAAGAATTCTTTGCTCGGCTCAGCACAAATGTGTGCACCTTGGCCCTCAACAGCAGTTTG

>In-frame_KMT2A_ENST00000534358_chr11_118353210_+_AFF1_ENST00000395146_chr4_88005270_+_6684nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGCAGACCTACTCCAATGAAGTCCATTGTGTTGAAGAGATTCTGAAGGAAATGACC
CATTCATGGCCGCCTCCTTTGACAGCAATACATACGCCTAGTACAGCTGAGCCATCCAAGTTTCCTTTCCCTACAAAGGACTCTCAGCAT
GTCAGTTCTGTAACCCAAAACCAAAAACAATATGATACATCTTCAAAAACTCACTCAAATTCTCAGCAAGGAACGTCATCCATGCTCGAA
GACGACCTTCAGCTCAGTGACAGTGAGGACAGTGACAGTGAACAAACCCCAGAGAAGCCTCCCTCCTCATCTGCACCTCCAAGTGCTCCA
CAGTCCCTTCCAGAACCAGTGGCATCAGCACATTCCAGCAGTGCAGAGTCAGAAAGCACCAGTGACTCAGACAGTTCCTCAGACTCAGAG
AGCGAGAGCAGTTCAAGTGACAGCGAAGAAAATGAGCCCCTAGAAACCCCAGCTCCGGAGCCTGAGCCTCCAACAACAAACAAATGGCAG
CTGGACAACTGGCTGACCAAAGTCAGCCAGCCAGCTGCGCCACCAGAGGGCCCCAGGAGCACAGAGCCCCCACGGCGGCACCCAGAGAGT
AAGGGCAGCAGCGACAGTGCCACGAGTCAGGAGCATTCTGAATCCAAAGATCCTCCCCCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCA
CCCGAAGCCCCCCACCCCGGAAAGAGGAGCTGTCAGAAGTCTCCGGCACAGCAGGAGCCCCCACAAAGGCAAACCGTTGGAACCAAACAA
CCCAAAAAACCTGTCAAGGCCTCTGCCCGGGCAGGTTCACGGACCAGCCTGCAGGGGGAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCC
CGAGACCAGACTTCCAAAGACAAGCCCAAGGTGAAGACGAAAGGACGGCCCCGGGCCGCAGCAAGCAACGAACCCAAGCCAGCAGTGCCC
CCCTCCAGTGAGAAGAAGAAGCACAAGAGCTCCCTCCCTGCCCCCTCTAAGGCTCTCTCAGGCCCAGAACCCGCGAAGGACAATGTGGAG
GACAGGACCCCTGAGCACTTTGCTCTTGTTCCCCTGACTGAGAGCCAGGGCCCACCCCACAGTGGCAGCGGCAGCAGGACTAGTGGCTGC
CGCCAAGCCGTGGTGGTCCAGGAGGACAGCCGCAAAGACAGACTCCCATTGCCTTTGAGAGACACCAAGCTGCTCTCACCGCTCAGGGAC
ACTCCTCCCCCACAAAGCTTGATGGTGAAGATCACCCTAGACCTGCTCTCTCGGATACCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGG
AAAGCAGAAGATAAACAGCCGCCCGCAGGGAAGAAGCACAGCTCTGAGAAGAGGAGCTCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGA
AAGGGTGAAGCAGAAAGAGACTGTGATAACAAGAAAATCAGACTGGAGAAGGAAATCAAATCACAGTCATCTTCATCTTCATCCTCCCAC
AAAGAATCTTCTAAAACAAAGCCCTCCAGGCCCTCCTCACAGTCCTCAAAGAAGGAAATGCTCCCCCCGCCACCCGTGTCCTCGTCCTCC
CAGAAGCCAGCCAAGCCTGCACTTAAGAGGTCAAGGCGGGAAGCAGACACCTGTGGCCAGGACCCTCCCAAAAGTGCCAGCAGTACCAAG
AGCAACCACAAAGACTCTTCCATTCCCAAGCAGAGAAGAGTAGAGGGGAAGGGCTCCAGAAGCTCCTCGGAGCACAAGGGTTCTTCCGGA
GATACTGCAAATCCTTTTCCAGTGCCTTCTTTGCCAAATGGTAACTCTAAACCAGGGAAGCCTCAAGTGAAGTTTGACAAACAACAAGCA
GACCTTCACATGAGGGAGGCAAAAAAGATGAAGCAGAAAGCAGAGTTAATGACGGACAGGGTTGGAAAGGCTTTTAAGTACCTGGAAGCC
GTCTTGTCCTTCATTGAGTGCGGAATTGCCACAGAGTCTGAAAGCCAGTCATCCAAGTCAGCTTACTCTGTCTACTCAGAAACTGTAGAT
CTCATTAAATTCATAATGTCATTAAAATCCTTCTCAGATGCCACAGCGCCAACACAAGAGAAAATATTTGCTGTTTTATGCATGCGTTGC
CAGTCCATTTTGAACATGGCGATGTTTCGTTGTAAAAAAGACATAGCAATAAAGTATTCTCGTACTCTTAATAAACACTTCGAGAGTTCT
TCCAAAGTCGCCCAGGCACCTTCTCCATGCATTGCAAGAAGCACAGGCACACCATCCCCTCTTTCCCCAATGCCTTCTCCTGCCAGCTCC
GTAGGGTCCCAGTCAAGTGCTGGCAGTGTGGGGAGCAGTGGGGTGGCTGCCACTATCAGCACCCCAGTCACCATCCAGAATATGACATCT
TCCTATGTCACCATCACATCCCATGTTCTTACCGCCTTTGACCTTTGGGAACAGGCCGAGGCCCTCACGAGGAAGAATAAAGAATTCTTT
GCTCGGCTCAGCACAAATGTGTGCACCTTGGCCCTCAACAGCAGTTTGGTGGACCTGGTGCACTATACACGACAGGGTTTTCAGCAGCTA

>In-frame_KMT2A_ENST00000534358_chr11_118353210_+_AFF1_ENST00000307808_chr4_88005270_+_6681nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGCAGACCTACTCCAATGAAGTCCATTGTGTTGAAGAGATTCTGAAGGAAATGACC
CATTCATGGCCGCCTCCTTTGACAGCAATACATACGCCTAGTACAGCTGAGCCATCCAAGTTTCCTTTCCCTACAAAGGACTCTCAGCAT
GTCAGTTCTGTAACCCAAAACCAAAAACAATATGATACATCTTCAAAAACTCACTCAAATTCTCAGCAAGGAACGTCATCCATGCTCGAA
GACGACCTTCAGCTCAGTGACAGTGAGGACAGTGACAGTGAACAAACCCCAGAGAAGCCTCCCTCCTCATCTGCACCTCCAAGTGCTCCA
CAGTCCCTTCCAGAACCAGTGGCATCAGCACATTCCAGCAGTGCAGAGTCAGAAAGCACCAGTGACTCAGACAGTTCCTCAGACTCAGAG
AGCGAGAGCAGTTCAAGTGACAGCGAAGAAAATGAGCCCCTAGAAACCCCAGCTCCGGAGCCTGAGCCTCCAACAACAAACAAATGGCAG
CTGGACAACTGGCTGACCAAAGTCAGCCAGCCAGCTGCGCCACCAGAGGGCCCCAGGAGCACAGAGCCCCCACGGCGGCACCCAGAGAGT
AAGGGCAGCAGCGACAGTGCCACGAGTCAGGAGCATTCTGAATCCAAAGATCCTCCCCCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCA
CCCGAAGCCCCCCACCCCGGAAAGAGGAGCTGTCAGAAGTCTCCGGCACAGCAGGAGCCCCCACAAAGGCAAACCGTTGGAACCAAACAA
CCCAAAAAACCTGTCAAGGCCTCTGCCCGGGCAGGTTCACGGACCAGCCTGCAGGGGGAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCC
CGAGACCAGACTTCCAAAGACAAGCCCAAGGTGAAGACGAAAGGACGGCCCCGGGCCGCAGCAAGCAACGAACCCAAGCCAGCAGTGCCC
CCCTCCAGTGAGAAGAAGAAGCACAAGAGCTCCCTCCCTGCCCCCTCTAAGGCTCTCTCAGGCCCAGAACCCGCGAAGGACAATGTGGAG
GACAGGACCCCTGAGCACTTTGCTCTTGTTCCCCTGACTGAGAGCCAGGGCCCACCCCACAGTGGCAGCGGCAGCAGGACTAGTGGCTGC
CGCCAAGCCGTGGTGGTCCAGGAGGACAGCCGCAAAGACAGACTCCCATTGCCTTTGAGAGACACCAAGCTGCTCTCACCGCTCAGGGAC
ACTCCTCCCCCACAAAGCTTGATGGTGAAGATCACCCTAGACCTGCTCTCTCGGATACCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGG
AAAGCAGAAGATAAACAGCCGCCCGCAGGGAAGAAGCACAGCTCTGAGAAGAGGAGCTCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGA
AAGGGTGAAGCAGAAAGAGACTGTGATAACAAGAAAATCAGACTGGAGAAGGAAATCAAATCACAGTCATCTTCATCTTCATCCTCCCAC
AAAGAATCTTCTAAAACAAAGCCCTCCAGGCCCTCCTCACAGTCCTCAAAGAAGGAAATGCTCCCCCCGCCACCCGTGTCCTCGTCCTCC
CAGAAGCCAGCCAAGCCTGCACTTAAGAGGTCAAGGCGGGAAGCAGACACCTGTGGCCAGGACCCTCCCAAAAGTGCCAGCAGTACCAAG
AGCAACCACAAAGACTCTTCCATTCCCAAGCAGAGAAGAGTAGAGGGGAAGGGCTCCAGAAGCTCCTCGGAGCACAAGGGTTCTTCCGGA
GATACTGCAAATCCTTTTCCAGTGCCTTCTTTGCCAAATGGTAACTCTAAACCAGGGAAGCCTCAAGTGAAGTTTGACAAACAACAAGCA
GACCTTCACATGAGGGAGGCAAAAAAGATGAAGCAGAAAGCAGAGTTAATGACGGACAGGGTTGGAAAGGCTTTTAAGTACCTGGAAGCC
GTCTTGTCCTTCATTGAGTGCGGAATTGCCACAGAGTCTGAAAGCCAGTCATCCAAGTCAGCTTACTCTGTCTACTCAGAAACTGTAGAT
CTCATTAAATTCATAATGTCATTAAAATCCTTCTCAGATGCCACAGCGCCAACACAAGAGAAAATATTTGCTGTTTTATGCATGCGTTGC
CAGTCCATTTTGAACATGGCGATGTTTCGTTGTAAAAAAGACATAGCAATAAAGTATTCTCGTACTCTTAATAAACACTTCGAGAGTTCT
TCCAAAGTCGCCCAGGCACCTTCTCCATGCATTGCAAGCACAGGCACACCATCCCCTCTTTCCCCAATGCCTTCTCCTGCCAGCTCCGTA
GGGTCCCAGTCAAGTGCTGGCAGTGTGGGGAGCAGTGGGGTGGCTGCCACTATCAGCACCCCAGTCACCATCCAGAATATGACATCTTCC
TATGTCACCATCACATCCCATGTTCTTACCGCCTTTGACCTTTGGGAACAGGCCGAGGCCCTCACGAGGAAGAATAAAGAATTCTTTGCT
CGGCTCAGCACAAATGTGTGCACCTTGGCCCTCAACAGCAGTTTGGTGGACCTGGTGCACTATACACGACAGGGTTTTCAGCAGCTACAA

>In-frame_KMT2A_ENST00000389506_chr11_118353210_+_AFF1_ENST00000395146_chr4_88005270_+_6684nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGCAGACCTACTCCAATGAAGTCCATTGTGTTGAAGAGATTCTGAAGGAAATGACC
CATTCATGGCCGCCTCCTTTGACAGCAATACATACGCCTAGTACAGCTGAGCCATCCAAGTTTCCTTTCCCTACAAAGGACTCTCAGCAT
GTCAGTTCTGTAACCCAAAACCAAAAACAATATGATACATCTTCAAAAACTCACTCAAATTCTCAGCAAGGAACGTCATCCATGCTCGAA
GACGACCTTCAGCTCAGTGACAGTGAGGACAGTGACAGTGAACAAACCCCAGAGAAGCCTCCCTCCTCATCTGCACCTCCAAGTGCTCCA
CAGTCCCTTCCAGAACCAGTGGCATCAGCACATTCCAGCAGTGCAGAGTCAGAAAGCACCAGTGACTCAGACAGTTCCTCAGACTCAGAG
AGCGAGAGCAGTTCAAGTGACAGCGAAGAAAATGAGCCCCTAGAAACCCCAGCTCCGGAGCCTGAGCCTCCAACAACAAACAAATGGCAG
CTGGACAACTGGCTGACCAAAGTCAGCCAGCCAGCTGCGCCACCAGAGGGCCCCAGGAGCACAGAGCCCCCACGGCGGCACCCAGAGAGT
AAGGGCAGCAGCGACAGTGCCACGAGTCAGGAGCATTCTGAATCCAAAGATCCTCCCCCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCA
CCCGAAGCCCCCCACCCCGGAAAGAGGAGCTGTCAGAAGTCTCCGGCACAGCAGGAGCCCCCACAAAGGCAAACCGTTGGAACCAAACAA
CCCAAAAAACCTGTCAAGGCCTCTGCCCGGGCAGGTTCACGGACCAGCCTGCAGGGGGAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCC
CGAGACCAGACTTCCAAAGACAAGCCCAAGGTGAAGACGAAAGGACGGCCCCGGGCCGCAGCAAGCAACGAACCCAAGCCAGCAGTGCCC
CCCTCCAGTGAGAAGAAGAAGCACAAGAGCTCCCTCCCTGCCCCCTCTAAGGCTCTCTCAGGCCCAGAACCCGCGAAGGACAATGTGGAG
GACAGGACCCCTGAGCACTTTGCTCTTGTTCCCCTGACTGAGAGCCAGGGCCCACCCCACAGTGGCAGCGGCAGCAGGACTAGTGGCTGC
CGCCAAGCCGTGGTGGTCCAGGAGGACAGCCGCAAAGACAGACTCCCATTGCCTTTGAGAGACACCAAGCTGCTCTCACCGCTCAGGGAC
ACTCCTCCCCCACAAAGCTTGATGGTGAAGATCACCCTAGACCTGCTCTCTCGGATACCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGG
AAAGCAGAAGATAAACAGCCGCCCGCAGGGAAGAAGCACAGCTCTGAGAAGAGGAGCTCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGA
AAGGGTGAAGCAGAAAGAGACTGTGATAACAAGAAAATCAGACTGGAGAAGGAAATCAAATCACAGTCATCTTCATCTTCATCCTCCCAC
AAAGAATCTTCTAAAACAAAGCCCTCCAGGCCCTCCTCACAGTCCTCAAAGAAGGAAATGCTCCCCCCGCCACCCGTGTCCTCGTCCTCC
CAGAAGCCAGCCAAGCCTGCACTTAAGAGGTCAAGGCGGGAAGCAGACACCTGTGGCCAGGACCCTCCCAAAAGTGCCAGCAGTACCAAG
AGCAACCACAAAGACTCTTCCATTCCCAAGCAGAGAAGAGTAGAGGGGAAGGGCTCCAGAAGCTCCTCGGAGCACAAGGGTTCTTCCGGA
GATACTGCAAATCCTTTTCCAGTGCCTTCTTTGCCAAATGGTAACTCTAAACCAGGGAAGCCTCAAGTGAAGTTTGACAAACAACAAGCA
GACCTTCACATGAGGGAGGCAAAAAAGATGAAGCAGAAAGCAGAGTTAATGACGGACAGGGTTGGAAAGGCTTTTAAGTACCTGGAAGCC
GTCTTGTCCTTCATTGAGTGCGGAATTGCCACAGAGTCTGAAAGCCAGTCATCCAAGTCAGCTTACTCTGTCTACTCAGAAACTGTAGAT
CTCATTAAATTCATAATGTCATTAAAATCCTTCTCAGATGCCACAGCGCCAACACAAGAGAAAATATTTGCTGTTTTATGCATGCGTTGC
CAGTCCATTTTGAACATGGCGATGTTTCGTTGTAAAAAAGACATAGCAATAAAGTATTCTCGTACTCTTAATAAACACTTCGAGAGTTCT
TCCAAAGTCGCCCAGGCACCTTCTCCATGCATTGCAAGAAGCACAGGCACACCATCCCCTCTTTCCCCAATGCCTTCTCCTGCCAGCTCC
GTAGGGTCCCAGTCAAGTGCTGGCAGTGTGGGGAGCAGTGGGGTGGCTGCCACTATCAGCACCCCAGTCACCATCCAGAATATGACATCT
TCCTATGTCACCATCACATCCCATGTTCTTACCGCCTTTGACCTTTGGGAACAGGCCGAGGCCCTCACGAGGAAGAATAAAGAATTCTTT
GCTCGGCTCAGCACAAATGTGTGCACCTTGGCCCTCAACAGCAGTTTGGTGGACCTGGTGCACTATACACGACAGGGTTTTCAGCAGCTA

>In-frame_KMT2A_ENST00000389506_chr11_118353210_+_AFF1_ENST00000307808_chr4_88005270_+_6681nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGCAGACCTACTCCAATGAAGTCCATTGTGTTGAAGAGATTCTGAAGGAAATGACC
CATTCATGGCCGCCTCCTTTGACAGCAATACATACGCCTAGTACAGCTGAGCCATCCAAGTTTCCTTTCCCTACAAAGGACTCTCAGCAT
GTCAGTTCTGTAACCCAAAACCAAAAACAATATGATACATCTTCAAAAACTCACTCAAATTCTCAGCAAGGAACGTCATCCATGCTCGAA
GACGACCTTCAGCTCAGTGACAGTGAGGACAGTGACAGTGAACAAACCCCAGAGAAGCCTCCCTCCTCATCTGCACCTCCAAGTGCTCCA
CAGTCCCTTCCAGAACCAGTGGCATCAGCACATTCCAGCAGTGCAGAGTCAGAAAGCACCAGTGACTCAGACAGTTCCTCAGACTCAGAG
AGCGAGAGCAGTTCAAGTGACAGCGAAGAAAATGAGCCCCTAGAAACCCCAGCTCCGGAGCCTGAGCCTCCAACAACAAACAAATGGCAG
CTGGACAACTGGCTGACCAAAGTCAGCCAGCCAGCTGCGCCACCAGAGGGCCCCAGGAGCACAGAGCCCCCACGGCGGCACCCAGAGAGT
AAGGGCAGCAGCGACAGTGCCACGAGTCAGGAGCATTCTGAATCCAAAGATCCTCCCCCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCA
CCCGAAGCCCCCCACCCCGGAAAGAGGAGCTGTCAGAAGTCTCCGGCACAGCAGGAGCCCCCACAAAGGCAAACCGTTGGAACCAAACAA
CCCAAAAAACCTGTCAAGGCCTCTGCCCGGGCAGGTTCACGGACCAGCCTGCAGGGGGAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCC
CGAGACCAGACTTCCAAAGACAAGCCCAAGGTGAAGACGAAAGGACGGCCCCGGGCCGCAGCAAGCAACGAACCCAAGCCAGCAGTGCCC
CCCTCCAGTGAGAAGAAGAAGCACAAGAGCTCCCTCCCTGCCCCCTCTAAGGCTCTCTCAGGCCCAGAACCCGCGAAGGACAATGTGGAG
GACAGGACCCCTGAGCACTTTGCTCTTGTTCCCCTGACTGAGAGCCAGGGCCCACCCCACAGTGGCAGCGGCAGCAGGACTAGTGGCTGC
CGCCAAGCCGTGGTGGTCCAGGAGGACAGCCGCAAAGACAGACTCCCATTGCCTTTGAGAGACACCAAGCTGCTCTCACCGCTCAGGGAC
ACTCCTCCCCCACAAAGCTTGATGGTGAAGATCACCCTAGACCTGCTCTCTCGGATACCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGG
AAAGCAGAAGATAAACAGCCGCCCGCAGGGAAGAAGCACAGCTCTGAGAAGAGGAGCTCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGA
AAGGGTGAAGCAGAAAGAGACTGTGATAACAAGAAAATCAGACTGGAGAAGGAAATCAAATCACAGTCATCTTCATCTTCATCCTCCCAC
AAAGAATCTTCTAAAACAAAGCCCTCCAGGCCCTCCTCACAGTCCTCAAAGAAGGAAATGCTCCCCCCGCCACCCGTGTCCTCGTCCTCC
CAGAAGCCAGCCAAGCCTGCACTTAAGAGGTCAAGGCGGGAAGCAGACACCTGTGGCCAGGACCCTCCCAAAAGTGCCAGCAGTACCAAG
AGCAACCACAAAGACTCTTCCATTCCCAAGCAGAGAAGAGTAGAGGGGAAGGGCTCCAGAAGCTCCTCGGAGCACAAGGGTTCTTCCGGA
GATACTGCAAATCCTTTTCCAGTGCCTTCTTTGCCAAATGGTAACTCTAAACCAGGGAAGCCTCAAGTGAAGTTTGACAAACAACAAGCA
GACCTTCACATGAGGGAGGCAAAAAAGATGAAGCAGAAAGCAGAGTTAATGACGGACAGGGTTGGAAAGGCTTTTAAGTACCTGGAAGCC
GTCTTGTCCTTCATTGAGTGCGGAATTGCCACAGAGTCTGAAAGCCAGTCATCCAAGTCAGCTTACTCTGTCTACTCAGAAACTGTAGAT
CTCATTAAATTCATAATGTCATTAAAATCCTTCTCAGATGCCACAGCGCCAACACAAGAGAAAATATTTGCTGTTTTATGCATGCGTTGC
CAGTCCATTTTGAACATGGCGATGTTTCGTTGTAAAAAAGACATAGCAATAAAGTATTCTCGTACTCTTAATAAACACTTCGAGAGTTCT
TCCAAAGTCGCCCAGGCACCTTCTCCATGCATTGCAAGCACAGGCACACCATCCCCTCTTTCCCCAATGCCTTCTCCTGCCAGCTCCGTA
GGGTCCCAGTCAAGTGCTGGCAGTGTGGGGAGCAGTGGGGTGGCTGCCACTATCAGCACCCCAGTCACCATCCAGAATATGACATCTTCC
TATGTCACCATCACATCCCATGTTCTTACCGCCTTTGACCTTTGGGAACAGGCCGAGGCCCTCACGAGGAAGAATAAAGAATTCTTTGCT
CGGCTCAGCACAAATGTGTGCACCTTGGCCCTCAACAGCAGTTTGGTGGACCTGGTGCACTATACACGACAGGGTTTTCAGCAGCTACAA

>In-frame_KMT2A_ENST00000354520_chr11_118353210_+_AFF1_ENST00000395146_chr4_88005270_+_6684nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGCAGACCTACTCCAATGAAGTCCATTGTGTTGAAGAGATTCTGAAGGAAATGACC
CATTCATGGCCGCCTCCTTTGACAGCAATACATACGCCTAGTACAGCTGAGCCATCCAAGTTTCCTTTCCCTACAAAGGACTCTCAGCAT
GTCAGTTCTGTAACCCAAAACCAAAAACAATATGATACATCTTCAAAAACTCACTCAAATTCTCAGCAAGGAACGTCATCCATGCTCGAA
GACGACCTTCAGCTCAGTGACAGTGAGGACAGTGACAGTGAACAAACCCCAGAGAAGCCTCCCTCCTCATCTGCACCTCCAAGTGCTCCA
CAGTCCCTTCCAGAACCAGTGGCATCAGCACATTCCAGCAGTGCAGAGTCAGAAAGCACCAGTGACTCAGACAGTTCCTCAGACTCAGAG
AGCGAGAGCAGTTCAAGTGACAGCGAAGAAAATGAGCCCCTAGAAACCCCAGCTCCGGAGCCTGAGCCTCCAACAACAAACAAATGGCAG
CTGGACAACTGGCTGACCAAAGTCAGCCAGCCAGCTGCGCCACCAGAGGGCCCCAGGAGCACAGAGCCCCCACGGCGGCACCCAGAGAGT
AAGGGCAGCAGCGACAGTGCCACGAGTCAGGAGCATTCTGAATCCAAAGATCCTCCCCCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCA
CCCGAAGCCCCCCACCCCGGAAAGAGGAGCTGTCAGAAGTCTCCGGCACAGCAGGAGCCCCCACAAAGGCAAACCGTTGGAACCAAACAA
CCCAAAAAACCTGTCAAGGCCTCTGCCCGGGCAGGTTCACGGACCAGCCTGCAGGGGGAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCC
CGAGACCAGACTTCCAAAGACAAGCCCAAGGTGAAGACGAAAGGACGGCCCCGGGCCGCAGCAAGCAACGAACCCAAGCCAGCAGTGCCC
CCCTCCAGTGAGAAGAAGAAGCACAAGAGCTCCCTCCCTGCCCCCTCTAAGGCTCTCTCAGGCCCAGAACCCGCGAAGGACAATGTGGAG
GACAGGACCCCTGAGCACTTTGCTCTTGTTCCCCTGACTGAGAGCCAGGGCCCACCCCACAGTGGCAGCGGCAGCAGGACTAGTGGCTGC
CGCCAAGCCGTGGTGGTCCAGGAGGACAGCCGCAAAGACAGACTCCCATTGCCTTTGAGAGACACCAAGCTGCTCTCACCGCTCAGGGAC
ACTCCTCCCCCACAAAGCTTGATGGTGAAGATCACCCTAGACCTGCTCTCTCGGATACCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGG
AAAGCAGAAGATAAACAGCCGCCCGCAGGGAAGAAGCACAGCTCTGAGAAGAGGAGCTCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGA
AAGGGTGAAGCAGAAAGAGACTGTGATAACAAGAAAATCAGACTGGAGAAGGAAATCAAATCACAGTCATCTTCATCTTCATCCTCCCAC
AAAGAATCTTCTAAAACAAAGCCCTCCAGGCCCTCCTCACAGTCCTCAAAGAAGGAAATGCTCCCCCCGCCACCCGTGTCCTCGTCCTCC
CAGAAGCCAGCCAAGCCTGCACTTAAGAGGTCAAGGCGGGAAGCAGACACCTGTGGCCAGGACCCTCCCAAAAGTGCCAGCAGTACCAAG
AGCAACCACAAAGACTCTTCCATTCCCAAGCAGAGAAGAGTAGAGGGGAAGGGCTCCAGAAGCTCCTCGGAGCACAAGGGTTCTTCCGGA
GATACTGCAAATCCTTTTCCAGTGCCTTCTTTGCCAAATGGTAACTCTAAACCAGGGAAGCCTCAAGTGAAGTTTGACAAACAACAAGCA
GACCTTCACATGAGGGAGGCAAAAAAGATGAAGCAGAAAGCAGAGTTAATGACGGACAGGGTTGGAAAGGCTTTTAAGTACCTGGAAGCC
GTCTTGTCCTTCATTGAGTGCGGAATTGCCACAGAGTCTGAAAGCCAGTCATCCAAGTCAGCTTACTCTGTCTACTCAGAAACTGTAGAT
CTCATTAAATTCATAATGTCATTAAAATCCTTCTCAGATGCCACAGCGCCAACACAAGAGAAAATATTTGCTGTTTTATGCATGCGTTGC
CAGTCCATTTTGAACATGGCGATGTTTCGTTGTAAAAAAGACATAGCAATAAAGTATTCTCGTACTCTTAATAAACACTTCGAGAGTTCT
TCCAAAGTCGCCCAGGCACCTTCTCCATGCATTGCAAGAAGCACAGGCACACCATCCCCTCTTTCCCCAATGCCTTCTCCTGCCAGCTCC
GTAGGGTCCCAGTCAAGTGCTGGCAGTGTGGGGAGCAGTGGGGTGGCTGCCACTATCAGCACCCCAGTCACCATCCAGAATATGACATCT
TCCTATGTCACCATCACATCCCATGTTCTTACCGCCTTTGACCTTTGGGAACAGGCCGAGGCCCTCACGAGGAAGAATAAAGAATTCTTT
GCTCGGCTCAGCACAAATGTGTGCACCTTGGCCCTCAACAGCAGTTTGGTGGACCTGGTGCACTATACACGACAGGGTTTTCAGCAGCTA

>In-frame_KMT2A_ENST00000354520_chr11_118353210_+_AFF1_ENST00000307808_chr4_88005270_+_6681nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGCAGACCTACTCCAATGAAGTCCATTGTGTTGAAGAGATTCTGAAGGAAATGACC
CATTCATGGCCGCCTCCTTTGACAGCAATACATACGCCTAGTACAGCTGAGCCATCCAAGTTTCCTTTCCCTACAAAGGACTCTCAGCAT
GTCAGTTCTGTAACCCAAAACCAAAAACAATATGATACATCTTCAAAAACTCACTCAAATTCTCAGCAAGGAACGTCATCCATGCTCGAA
GACGACCTTCAGCTCAGTGACAGTGAGGACAGTGACAGTGAACAAACCCCAGAGAAGCCTCCCTCCTCATCTGCACCTCCAAGTGCTCCA
CAGTCCCTTCCAGAACCAGTGGCATCAGCACATTCCAGCAGTGCAGAGTCAGAAAGCACCAGTGACTCAGACAGTTCCTCAGACTCAGAG
AGCGAGAGCAGTTCAAGTGACAGCGAAGAAAATGAGCCCCTAGAAACCCCAGCTCCGGAGCCTGAGCCTCCAACAACAAACAAATGGCAG
CTGGACAACTGGCTGACCAAAGTCAGCCAGCCAGCTGCGCCACCAGAGGGCCCCAGGAGCACAGAGCCCCCACGGCGGCACCCAGAGAGT
AAGGGCAGCAGCGACAGTGCCACGAGTCAGGAGCATTCTGAATCCAAAGATCCTCCCCCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCA
CCCGAAGCCCCCCACCCCGGAAAGAGGAGCTGTCAGAAGTCTCCGGCACAGCAGGAGCCCCCACAAAGGCAAACCGTTGGAACCAAACAA
CCCAAAAAACCTGTCAAGGCCTCTGCCCGGGCAGGTTCACGGACCAGCCTGCAGGGGGAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCC
CGAGACCAGACTTCCAAAGACAAGCCCAAGGTGAAGACGAAAGGACGGCCCCGGGCCGCAGCAAGCAACGAACCCAAGCCAGCAGTGCCC
CCCTCCAGTGAGAAGAAGAAGCACAAGAGCTCCCTCCCTGCCCCCTCTAAGGCTCTCTCAGGCCCAGAACCCGCGAAGGACAATGTGGAG
GACAGGACCCCTGAGCACTTTGCTCTTGTTCCCCTGACTGAGAGCCAGGGCCCACCCCACAGTGGCAGCGGCAGCAGGACTAGTGGCTGC
CGCCAAGCCGTGGTGGTCCAGGAGGACAGCCGCAAAGACAGACTCCCATTGCCTTTGAGAGACACCAAGCTGCTCTCACCGCTCAGGGAC
ACTCCTCCCCCACAAAGCTTGATGGTGAAGATCACCCTAGACCTGCTCTCTCGGATACCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGG
AAAGCAGAAGATAAACAGCCGCCCGCAGGGAAGAAGCACAGCTCTGAGAAGAGGAGCTCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGA
AAGGGTGAAGCAGAAAGAGACTGTGATAACAAGAAAATCAGACTGGAGAAGGAAATCAAATCACAGTCATCTTCATCTTCATCCTCCCAC
AAAGAATCTTCTAAAACAAAGCCCTCCAGGCCCTCCTCACAGTCCTCAAAGAAGGAAATGCTCCCCCCGCCACCCGTGTCCTCGTCCTCC
CAGAAGCCAGCCAAGCCTGCACTTAAGAGGTCAAGGCGGGAAGCAGACACCTGTGGCCAGGACCCTCCCAAAAGTGCCAGCAGTACCAAG
AGCAACCACAAAGACTCTTCCATTCCCAAGCAGAGAAGAGTAGAGGGGAAGGGCTCCAGAAGCTCCTCGGAGCACAAGGGTTCTTCCGGA
GATACTGCAAATCCTTTTCCAGTGCCTTCTTTGCCAAATGGTAACTCTAAACCAGGGAAGCCTCAAGTGAAGTTTGACAAACAACAAGCA
GACCTTCACATGAGGGAGGCAAAAAAGATGAAGCAGAAAGCAGAGTTAATGACGGACAGGGTTGGAAAGGCTTTTAAGTACCTGGAAGCC
GTCTTGTCCTTCATTGAGTGCGGAATTGCCACAGAGTCTGAAAGCCAGTCATCCAAGTCAGCTTACTCTGTCTACTCAGAAACTGTAGAT
CTCATTAAATTCATAATGTCATTAAAATCCTTCTCAGATGCCACAGCGCCAACACAAGAGAAAATATTTGCTGTTTTATGCATGCGTTGC
CAGTCCATTTTGAACATGGCGATGTTTCGTTGTAAAAAAGACATAGCAATAAAGTATTCTCGTACTCTTAATAAACACTTCGAGAGTTCT
TCCAAAGTCGCCCAGGCACCTTCTCCATGCATTGCAAGCACAGGCACACCATCCCCTCTTTCCCCAATGCCTTCTCCTGCCAGCTCCGTA
GGGTCCCAGTCAAGTGCTGGCAGTGTGGGGAGCAGTGGGGTGGCTGCCACTATCAGCACCCCAGTCACCATCCAGAATATGACATCTTCC
TATGTCACCATCACATCCCATGTTCTTACCGCCTTTGACCTTTGGGAACAGGCCGAGGCCCTCACGAGGAAGAATAAAGAATTCTTTGCT
CGGCTCAGCACAAATGTGTGCACCTTGGCCCTCAACAGCAGTTTGGTGGACCTGGTGCACTATACACGACAGGGTTTTCAGCAGCTACAA

>In-frame_KMT2A_ENST00000534358_chr11_118355690_+_AFF1_ENST00000395146_chr4_88005270_+_6930nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGGAGGATTGTGAA
GCAGAAAATGTGTGGGAGATGGGAGGCTTAGGAATCTTGACTTCTGTTCCTATAACACCCAGGGTGGTTTGCTTTCTCTGTGCCAGTAGT
GGGCATGTAGAGCAGACCTACTCCAATGAAGTCCATTGTGTTGAAGAGATTCTGAAGGAAATGACCCATTCATGGCCGCCTCCTTTGACA
GCAATACATACGCCTAGTACAGCTGAGCCATCCAAGTTTCCTTTCCCTACAAAGGACTCTCAGCATGTCAGTTCTGTAACCCAAAACCAA
AAACAATATGATACATCTTCAAAAACTCACTCAAATTCTCAGCAAGGAACGTCATCCATGCTCGAAGACGACCTTCAGCTCAGTGACAGT
GAGGACAGTGACAGTGAACAAACCCCAGAGAAGCCTCCCTCCTCATCTGCACCTCCAAGTGCTCCACAGTCCCTTCCAGAACCAGTGGCA
TCAGCACATTCCAGCAGTGCAGAGTCAGAAAGCACCAGTGACTCAGACAGTTCCTCAGACTCAGAGAGCGAGAGCAGTTCAAGTGACAGC
GAAGAAAATGAGCCCCTAGAAACCCCAGCTCCGGAGCCTGAGCCTCCAACAACAAACAAATGGCAGCTGGACAACTGGCTGACCAAAGTC
AGCCAGCCAGCTGCGCCACCAGAGGGCCCCAGGAGCACAGAGCCCCCACGGCGGCACCCAGAGAGTAAGGGCAGCAGCGACAGTGCCACG
AGTCAGGAGCATTCTGAATCCAAAGATCCTCCCCCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCACCCGAAGCCCCCCACCCCGGAAAG
AGGAGCTGTCAGAAGTCTCCGGCACAGCAGGAGCCCCCACAAAGGCAAACCGTTGGAACCAAACAACCCAAAAAACCTGTCAAGGCCTCT
GCCCGGGCAGGTTCACGGACCAGCCTGCAGGGGGAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCCCGAGACCAGACTTCCAAAGACAAG
CCCAAGGTGAAGACGAAAGGACGGCCCCGGGCCGCAGCAAGCAACGAACCCAAGCCAGCAGTGCCCCCCTCCAGTGAGAAGAAGAAGCAC
AAGAGCTCCCTCCCTGCCCCCTCTAAGGCTCTCTCAGGCCCAGAACCCGCGAAGGACAATGTGGAGGACAGGACCCCTGAGCACTTTGCT
CTTGTTCCCCTGACTGAGAGCCAGGGCCCACCCCACAGTGGCAGCGGCAGCAGGACTAGTGGCTGCCGCCAAGCCGTGGTGGTCCAGGAG
GACAGCCGCAAAGACAGACTCCCATTGCCTTTGAGAGACACCAAGCTGCTCTCACCGCTCAGGGACACTCCTCCCCCACAAAGCTTGATG
GTGAAGATCACCCTAGACCTGCTCTCTCGGATACCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGGAAAGCAGAAGATAAACAGCCGCCC
GCAGGGAAGAAGCACAGCTCTGAGAAGAGGAGCTCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGAAAGGGTGAAGCAGAAAGAGACTGT
GATAACAAGAAAATCAGACTGGAGAAGGAAATCAAATCACAGTCATCTTCATCTTCATCCTCCCACAAAGAATCTTCTAAAACAAAGCCC
TCCAGGCCCTCCTCACAGTCCTCAAAGAAGGAAATGCTCCCCCCGCCACCCGTGTCCTCGTCCTCCCAGAAGCCAGCCAAGCCTGCACTT
AAGAGGTCAAGGCGGGAAGCAGACACCTGTGGCCAGGACCCTCCCAAAAGTGCCAGCAGTACCAAGAGCAACCACAAAGACTCTTCCATT
CCCAAGCAGAGAAGAGTAGAGGGGAAGGGCTCCAGAAGCTCCTCGGAGCACAAGGGTTCTTCCGGAGATACTGCAAATCCTTTTCCAGTG
CCTTCTTTGCCAAATGGTAACTCTAAACCAGGGAAGCCTCAAGTGAAGTTTGACAAACAACAAGCAGACCTTCACATGAGGGAGGCAAAA
AAGATGAAGCAGAAAGCAGAGTTAATGACGGACAGGGTTGGAAAGGCTTTTAAGTACCTGGAAGCCGTCTTGTCCTTCATTGAGTGCGGA
ATTGCCACAGAGTCTGAAAGCCAGTCATCCAAGTCAGCTTACTCTGTCTACTCAGAAACTGTAGATCTCATTAAATTCATAATGTCATTA
AAATCCTTCTCAGATGCCACAGCGCCAACACAAGAGAAAATATTTGCTGTTTTATGCATGCGTTGCCAGTCCATTTTGAACATGGCGATG
TTTCGTTGTAAAAAAGACATAGCAATAAAGTATTCTCGTACTCTTAATAAACACTTCGAGAGTTCTTCCAAAGTCGCCCAGGCACCTTCT
CCATGCATTGCAAGAAGCACAGGCACACCATCCCCTCTTTCCCCAATGCCTTCTCCTGCCAGCTCCGTAGGGTCCCAGTCAAGTGCTGGC
AGTGTGGGGAGCAGTGGGGTGGCTGCCACTATCAGCACCCCAGTCACCATCCAGAATATGACATCTTCCTATGTCACCATCACATCCCAT
GTTCTTACCGCCTTTGACCTTTGGGAACAGGCCGAGGCCCTCACGAGGAAGAATAAAGAATTCTTTGCTCGGCTCAGCACAAATGTGTGC
ACCTTGGCCCTCAACAGCAGTTTGGTGGACCTGGTGCACTATACACGACAGGGTTTTCAGCAGCTACAAGAATTAACCAAAACACCTTAA

>In-frame_KMT2A_ENST00000534358_chr11_118355690_+_AFF1_ENST00000307808_chr4_88005270_+_6927nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGGAGGATTGTGAA
GCAGAAAATGTGTGGGAGATGGGAGGCTTAGGAATCTTGACTTCTGTTCCTATAACACCCAGGGTGGTTTGCTTTCTCTGTGCCAGTAGT
GGGCATGTAGAGCAGACCTACTCCAATGAAGTCCATTGTGTTGAAGAGATTCTGAAGGAAATGACCCATTCATGGCCGCCTCCTTTGACA
GCAATACATACGCCTAGTACAGCTGAGCCATCCAAGTTTCCTTTCCCTACAAAGGACTCTCAGCATGTCAGTTCTGTAACCCAAAACCAA
AAACAATATGATACATCTTCAAAAACTCACTCAAATTCTCAGCAAGGAACGTCATCCATGCTCGAAGACGACCTTCAGCTCAGTGACAGT
GAGGACAGTGACAGTGAACAAACCCCAGAGAAGCCTCCCTCCTCATCTGCACCTCCAAGTGCTCCACAGTCCCTTCCAGAACCAGTGGCA
TCAGCACATTCCAGCAGTGCAGAGTCAGAAAGCACCAGTGACTCAGACAGTTCCTCAGACTCAGAGAGCGAGAGCAGTTCAAGTGACAGC
GAAGAAAATGAGCCCCTAGAAACCCCAGCTCCGGAGCCTGAGCCTCCAACAACAAACAAATGGCAGCTGGACAACTGGCTGACCAAAGTC
AGCCAGCCAGCTGCGCCACCAGAGGGCCCCAGGAGCACAGAGCCCCCACGGCGGCACCCAGAGAGTAAGGGCAGCAGCGACAGTGCCACG
AGTCAGGAGCATTCTGAATCCAAAGATCCTCCCCCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCACCCGAAGCCCCCCACCCCGGAAAG
AGGAGCTGTCAGAAGTCTCCGGCACAGCAGGAGCCCCCACAAAGGCAAACCGTTGGAACCAAACAACCCAAAAAACCTGTCAAGGCCTCT
GCCCGGGCAGGTTCACGGACCAGCCTGCAGGGGGAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCCCGAGACCAGACTTCCAAAGACAAG
CCCAAGGTGAAGACGAAAGGACGGCCCCGGGCCGCAGCAAGCAACGAACCCAAGCCAGCAGTGCCCCCCTCCAGTGAGAAGAAGAAGCAC
AAGAGCTCCCTCCCTGCCCCCTCTAAGGCTCTCTCAGGCCCAGAACCCGCGAAGGACAATGTGGAGGACAGGACCCCTGAGCACTTTGCT
CTTGTTCCCCTGACTGAGAGCCAGGGCCCACCCCACAGTGGCAGCGGCAGCAGGACTAGTGGCTGCCGCCAAGCCGTGGTGGTCCAGGAG
GACAGCCGCAAAGACAGACTCCCATTGCCTTTGAGAGACACCAAGCTGCTCTCACCGCTCAGGGACACTCCTCCCCCACAAAGCTTGATG
GTGAAGATCACCCTAGACCTGCTCTCTCGGATACCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGGAAAGCAGAAGATAAACAGCCGCCC
GCAGGGAAGAAGCACAGCTCTGAGAAGAGGAGCTCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGAAAGGGTGAAGCAGAAAGAGACTGT
GATAACAAGAAAATCAGACTGGAGAAGGAAATCAAATCACAGTCATCTTCATCTTCATCCTCCCACAAAGAATCTTCTAAAACAAAGCCC
TCCAGGCCCTCCTCACAGTCCTCAAAGAAGGAAATGCTCCCCCCGCCACCCGTGTCCTCGTCCTCCCAGAAGCCAGCCAAGCCTGCACTT
AAGAGGTCAAGGCGGGAAGCAGACACCTGTGGCCAGGACCCTCCCAAAAGTGCCAGCAGTACCAAGAGCAACCACAAAGACTCTTCCATT
CCCAAGCAGAGAAGAGTAGAGGGGAAGGGCTCCAGAAGCTCCTCGGAGCACAAGGGTTCTTCCGGAGATACTGCAAATCCTTTTCCAGTG
CCTTCTTTGCCAAATGGTAACTCTAAACCAGGGAAGCCTCAAGTGAAGTTTGACAAACAACAAGCAGACCTTCACATGAGGGAGGCAAAA
AAGATGAAGCAGAAAGCAGAGTTAATGACGGACAGGGTTGGAAAGGCTTTTAAGTACCTGGAAGCCGTCTTGTCCTTCATTGAGTGCGGA
ATTGCCACAGAGTCTGAAAGCCAGTCATCCAAGTCAGCTTACTCTGTCTACTCAGAAACTGTAGATCTCATTAAATTCATAATGTCATTA
AAATCCTTCTCAGATGCCACAGCGCCAACACAAGAGAAAATATTTGCTGTTTTATGCATGCGTTGCCAGTCCATTTTGAACATGGCGATG
TTTCGTTGTAAAAAAGACATAGCAATAAAGTATTCTCGTACTCTTAATAAACACTTCGAGAGTTCTTCCAAAGTCGCCCAGGCACCTTCT
CCATGCATTGCAAGCACAGGCACACCATCCCCTCTTTCCCCAATGCCTTCTCCTGCCAGCTCCGTAGGGTCCCAGTCAAGTGCTGGCAGT
GTGGGGAGCAGTGGGGTGGCTGCCACTATCAGCACCCCAGTCACCATCCAGAATATGACATCTTCCTATGTCACCATCACATCCCATGTT
CTTACCGCCTTTGACCTTTGGGAACAGGCCGAGGCCCTCACGAGGAAGAATAAAGAATTCTTTGCTCGGCTCAGCACAAATGTGTGCACC

>In-frame_KMT2A_ENST00000389506_chr11_118355690_+_AFF1_ENST00000395146_chr4_88005270_+_6930nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGGAGGATTGTGAA
GCAGAAAATGTGTGGGAGATGGGAGGCTTAGGAATCTTGACTTCTGTTCCTATAACACCCAGGGTGGTTTGCTTTCTCTGTGCCAGTAGT
GGGCATGTAGAGCAGACCTACTCCAATGAAGTCCATTGTGTTGAAGAGATTCTGAAGGAAATGACCCATTCATGGCCGCCTCCTTTGACA
GCAATACATACGCCTAGTACAGCTGAGCCATCCAAGTTTCCTTTCCCTACAAAGGACTCTCAGCATGTCAGTTCTGTAACCCAAAACCAA
AAACAATATGATACATCTTCAAAAACTCACTCAAATTCTCAGCAAGGAACGTCATCCATGCTCGAAGACGACCTTCAGCTCAGTGACAGT
GAGGACAGTGACAGTGAACAAACCCCAGAGAAGCCTCCCTCCTCATCTGCACCTCCAAGTGCTCCACAGTCCCTTCCAGAACCAGTGGCA
TCAGCACATTCCAGCAGTGCAGAGTCAGAAAGCACCAGTGACTCAGACAGTTCCTCAGACTCAGAGAGCGAGAGCAGTTCAAGTGACAGC
GAAGAAAATGAGCCCCTAGAAACCCCAGCTCCGGAGCCTGAGCCTCCAACAACAAACAAATGGCAGCTGGACAACTGGCTGACCAAAGTC
AGCCAGCCAGCTGCGCCACCAGAGGGCCCCAGGAGCACAGAGCCCCCACGGCGGCACCCAGAGAGTAAGGGCAGCAGCGACAGTGCCACG
AGTCAGGAGCATTCTGAATCCAAAGATCCTCCCCCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCACCCGAAGCCCCCCACCCCGGAAAG
AGGAGCTGTCAGAAGTCTCCGGCACAGCAGGAGCCCCCACAAAGGCAAACCGTTGGAACCAAACAACCCAAAAAACCTGTCAAGGCCTCT
GCCCGGGCAGGTTCACGGACCAGCCTGCAGGGGGAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCCCGAGACCAGACTTCCAAAGACAAG
CCCAAGGTGAAGACGAAAGGACGGCCCCGGGCCGCAGCAAGCAACGAACCCAAGCCAGCAGTGCCCCCCTCCAGTGAGAAGAAGAAGCAC
AAGAGCTCCCTCCCTGCCCCCTCTAAGGCTCTCTCAGGCCCAGAACCCGCGAAGGACAATGTGGAGGACAGGACCCCTGAGCACTTTGCT
CTTGTTCCCCTGACTGAGAGCCAGGGCCCACCCCACAGTGGCAGCGGCAGCAGGACTAGTGGCTGCCGCCAAGCCGTGGTGGTCCAGGAG
GACAGCCGCAAAGACAGACTCCCATTGCCTTTGAGAGACACCAAGCTGCTCTCACCGCTCAGGGACACTCCTCCCCCACAAAGCTTGATG
GTGAAGATCACCCTAGACCTGCTCTCTCGGATACCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGGAAAGCAGAAGATAAACAGCCGCCC
GCAGGGAAGAAGCACAGCTCTGAGAAGAGGAGCTCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGAAAGGGTGAAGCAGAAAGAGACTGT
GATAACAAGAAAATCAGACTGGAGAAGGAAATCAAATCACAGTCATCTTCATCTTCATCCTCCCACAAAGAATCTTCTAAAACAAAGCCC
TCCAGGCCCTCCTCACAGTCCTCAAAGAAGGAAATGCTCCCCCCGCCACCCGTGTCCTCGTCCTCCCAGAAGCCAGCCAAGCCTGCACTT
AAGAGGTCAAGGCGGGAAGCAGACACCTGTGGCCAGGACCCTCCCAAAAGTGCCAGCAGTACCAAGAGCAACCACAAAGACTCTTCCATT
CCCAAGCAGAGAAGAGTAGAGGGGAAGGGCTCCAGAAGCTCCTCGGAGCACAAGGGTTCTTCCGGAGATACTGCAAATCCTTTTCCAGTG
CCTTCTTTGCCAAATGGTAACTCTAAACCAGGGAAGCCTCAAGTGAAGTTTGACAAACAACAAGCAGACCTTCACATGAGGGAGGCAAAA
AAGATGAAGCAGAAAGCAGAGTTAATGACGGACAGGGTTGGAAAGGCTTTTAAGTACCTGGAAGCCGTCTTGTCCTTCATTGAGTGCGGA
ATTGCCACAGAGTCTGAAAGCCAGTCATCCAAGTCAGCTTACTCTGTCTACTCAGAAACTGTAGATCTCATTAAATTCATAATGTCATTA
AAATCCTTCTCAGATGCCACAGCGCCAACACAAGAGAAAATATTTGCTGTTTTATGCATGCGTTGCCAGTCCATTTTGAACATGGCGATG
TTTCGTTGTAAAAAAGACATAGCAATAAAGTATTCTCGTACTCTTAATAAACACTTCGAGAGTTCTTCCAAAGTCGCCCAGGCACCTTCT
CCATGCATTGCAAGAAGCACAGGCACACCATCCCCTCTTTCCCCAATGCCTTCTCCTGCCAGCTCCGTAGGGTCCCAGTCAAGTGCTGGC
AGTGTGGGGAGCAGTGGGGTGGCTGCCACTATCAGCACCCCAGTCACCATCCAGAATATGACATCTTCCTATGTCACCATCACATCCCAT
GTTCTTACCGCCTTTGACCTTTGGGAACAGGCCGAGGCCCTCACGAGGAAGAATAAAGAATTCTTTGCTCGGCTCAGCACAAATGTGTGC
ACCTTGGCCCTCAACAGCAGTTTGGTGGACCTGGTGCACTATACACGACAGGGTTTTCAGCAGCTACAAGAATTAACCAAAACACCTTAA

>In-frame_KMT2A_ENST00000389506_chr11_118355690_+_AFF1_ENST00000307808_chr4_88005270_+_6927nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTC
AGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGGAGGATTGTGAA
GCAGAAAATGTGTGGGAGATGGGAGGCTTAGGAATCTTGACTTCTGTTCCTATAACACCCAGGGTGGTTTGCTTTCTCTGTGCCAGTAGT
GGGCATGTAGAGCAGACCTACTCCAATGAAGTCCATTGTGTTGAAGAGATTCTGAAGGAAATGACCCATTCATGGCCGCCTCCTTTGACA
GCAATACATACGCCTAGTACAGCTGAGCCATCCAAGTTTCCTTTCCCTACAAAGGACTCTCAGCATGTCAGTTCTGTAACCCAAAACCAA
AAACAATATGATACATCTTCAAAAACTCACTCAAATTCTCAGCAAGGAACGTCATCCATGCTCGAAGACGACCTTCAGCTCAGTGACAGT
GAGGACAGTGACAGTGAACAAACCCCAGAGAAGCCTCCCTCCTCATCTGCACCTCCAAGTGCTCCACAGTCCCTTCCAGAACCAGTGGCA
TCAGCACATTCCAGCAGTGCAGAGTCAGAAAGCACCAGTGACTCAGACAGTTCCTCAGACTCAGAGAGCGAGAGCAGTTCAAGTGACAGC
GAAGAAAATGAGCCCCTAGAAACCCCAGCTCCGGAGCCTGAGCCTCCAACAACAAACAAATGGCAGCTGGACAACTGGCTGACCAAAGTC
AGCCAGCCAGCTGCGCCACCAGAGGGCCCCAGGAGCACAGAGCCCCCACGGCGGCACCCAGAGAGTAAGGGCAGCAGCGACAGTGCCACG
AGTCAGGAGCATTCTGAATCCAAAGATCCTCCCCCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCACCCGAAGCCCCCCACCCCGGAAAG
AGGAGCTGTCAGAAGTCTCCGGCACAGCAGGAGCCCCCACAAAGGCAAACCGTTGGAACCAAACAACCCAAAAAACCTGTCAAGGCCTCT
GCCCGGGCAGGTTCACGGACCAGCCTGCAGGGGGAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCCCGAGACCAGACTTCCAAAGACAAG
CCCAAGGTGAAGACGAAAGGACGGCCCCGGGCCGCAGCAAGCAACGAACCCAAGCCAGCAGTGCCCCCCTCCAGTGAGAAGAAGAAGCAC
AAGAGCTCCCTCCCTGCCCCCTCTAAGGCTCTCTCAGGCCCAGAACCCGCGAAGGACAATGTGGAGGACAGGACCCCTGAGCACTTTGCT
CTTGTTCCCCTGACTGAGAGCCAGGGCCCACCCCACAGTGGCAGCGGCAGCAGGACTAGTGGCTGCCGCCAAGCCGTGGTGGTCCAGGAG
GACAGCCGCAAAGACAGACTCCCATTGCCTTTGAGAGACACCAAGCTGCTCTCACCGCTCAGGGACACTCCTCCCCCACAAAGCTTGATG
GTGAAGATCACCCTAGACCTGCTCTCTCGGATACCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGGAAAGCAGAAGATAAACAGCCGCCC
GCAGGGAAGAAGCACAGCTCTGAGAAGAGGAGCTCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGAAAGGGTGAAGCAGAAAGAGACTGT
GATAACAAGAAAATCAGACTGGAGAAGGAAATCAAATCACAGTCATCTTCATCTTCATCCTCCCACAAAGAATCTTCTAAAACAAAGCCC
TCCAGGCCCTCCTCACAGTCCTCAAAGAAGGAAATGCTCCCCCCGCCACCCGTGTCCTCGTCCTCCCAGAAGCCAGCCAAGCCTGCACTT
AAGAGGTCAAGGCGGGAAGCAGACACCTGTGGCCAGGACCCTCCCAAAAGTGCCAGCAGTACCAAGAGCAACCACAAAGACTCTTCCATT
CCCAAGCAGAGAAGAGTAGAGGGGAAGGGCTCCAGAAGCTCCTCGGAGCACAAGGGTTCTTCCGGAGATACTGCAAATCCTTTTCCAGTG
CCTTCTTTGCCAAATGGTAACTCTAAACCAGGGAAGCCTCAAGTGAAGTTTGACAAACAACAAGCAGACCTTCACATGAGGGAGGCAAAA
AAGATGAAGCAGAAAGCAGAGTTAATGACGGACAGGGTTGGAAAGGCTTTTAAGTACCTGGAAGCCGTCTTGTCCTTCATTGAGTGCGGA
ATTGCCACAGAGTCTGAAAGCCAGTCATCCAAGTCAGCTTACTCTGTCTACTCAGAAACTGTAGATCTCATTAAATTCATAATGTCATTA
AAATCCTTCTCAGATGCCACAGCGCCAACACAAGAGAAAATATTTGCTGTTTTATGCATGCGTTGCCAGTCCATTTTGAACATGGCGATG
TTTCGTTGTAAAAAAGACATAGCAATAAAGTATTCTCGTACTCTTAATAAACACTTCGAGAGTTCTTCCAAAGTCGCCCAGGCACCTTCT
CCATGCATTGCAAGCACAGGCACACCATCCCCTCTTTCCCCAATGCCTTCTCCTGCCAGCTCCGTAGGGTCCCAGTCAAGTGCTGGCAGT
GTGGGGAGCAGTGGGGTGGCTGCCACTATCAGCACCCCAGTCACCATCCAGAATATGACATCTTCCTATGTCACCATCACATCCCATGTT
CTTACCGCCTTTGACCTTTGGGAACAGGCCGAGGCCCTCACGAGGAAGAATAAAGAATTCTTTGCTCGGCTCAGCACAAATGTGTGCACC

>In-frame_KMT2A_ENST00000534358_chr11_118355622_-_AFF1_ENST00000395146_chr4_87968221_+_0nt

>In-frame_KMT2A_ENST00000534358_chr11_118355622_-_AFF1_ENST00000307808_chr4_87968221_+_0nt

>In-frame_KMT2A_ENST00000389506_chr11_118355622_-_AFF1_ENST00000395146_chr4_87968221_+_0nt

>In-frame_KMT2A_ENST00000389506_chr11_118355622_-_AFF1_ENST00000307808_chr4_87968221_+_0nt

>In-frame_KMT2A_ENST00000534358_chr11_118353211_+_AFF1_ENST00000395146_chr4_88011134_+_6639nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAATGACCCATTCATGGCCGCCTCCTTTGACAGCAATACATACGCCTAGTACA
GCTGAGCCATCCAAGTTTCCTTTCCCTACAAAGGACTCTCAGCATGTCAGTTCTGTAACCCAAAACCAAAAACAATATGATACATCTTCA
AAAACTCACTCAAATTCTCAGCAAGGAACGTCATCCATGCTCGAAGACGACCTTCAGCTCAGTGACAGTGAGGACAGTGACAGTGAACAA
ACCCCAGAGAAGCCTCCCTCCTCATCTGCACCTCCAAGTGCTCCACAGTCCCTTCCAGAACCAGTGGCATCAGCACATTCCAGCAGTGCA
GAGTCAGAAAGCACCAGTGACTCAGACAGTTCCTCAGACTCAGAGAGCGAGAGCAGTTCAAGTGACAGCGAAGAAAATGAGCCCCTAGAA
ACCCCAGCTCCGGAGCCTGAGCCTCCAACAACAAACAAATGGCAGCTGGACAACTGGCTGACCAAAGTCAGCCAGCCAGCTGCGCCACCA
GAGGGCCCCAGGAGCACAGAGCCCCCACGGCGGCACCCAGAGAGTAAGGGCAGCAGCGACAGTGCCACGAGTCAGGAGCATTCTGAATCC
AAAGATCCTCCCCCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCACCCGAAGCCCCCCACCCCGGAAAGAGGAGCTGTCAGAAGTCTCCG
GCACAGCAGGAGCCCCCACAAAGGCAAACCGTTGGAACCAAACAACCCAAAAAACCTGTCAAGGCCTCTGCCCGGGCAGGTTCACGGACC
AGCCTGCAGGGGGAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCCCGAGACCAGACTTCCAAAGACAAGCCCAAGGTGAAGACGAAAGGA
CGGCCCCGGGCCGCAGCAAGCAACGAACCCAAGCCAGCAGTGCCCCCCTCCAGTGAGAAGAAGAAGCACAAGAGCTCCCTCCCTGCCCCC
TCTAAGGCTCTCTCAGGCCCAGAACCCGCGAAGGACAATGTGGAGGACAGGACCCCTGAGCACTTTGCTCTTGTTCCCCTGACTGAGAGC
CAGGGCCCACCCCACAGTGGCAGCGGCAGCAGGACTAGTGGCTGCCGCCAAGCCGTGGTGGTCCAGGAGGACAGCCGCAAAGACAGACTC
CCATTGCCTTTGAGAGACACCAAGCTGCTCTCACCGCTCAGGGACACTCCTCCCCCACAAAGCTTGATGGTGAAGATCACCCTAGACCTG
CTCTCTCGGATACCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGGAAAGCAGAAGATAAACAGCCGCCCGCAGGGAAGAAGCACAGCTCT
GAGAAGAGGAGCTCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGAAAGGGTGAAGCAGAAAGAGACTGTGATAACAAGAAAATCAGACTG
GAGAAGGAAATCAAATCACAGTCATCTTCATCTTCATCCTCCCACAAAGAATCTTCTAAAACAAAGCCCTCCAGGCCCTCCTCACAGTCC
TCAAAGAAGGAAATGCTCCCCCCGCCACCCGTGTCCTCGTCCTCCCAGAAGCCAGCCAAGCCTGCACTTAAGAGGTCAAGGCGGGAAGCA
GACACCTGTGGCCAGGACCCTCCCAAAAGTGCCAGCAGTACCAAGAGCAACCACAAAGACTCTTCCATTCCCAAGCAGAGAAGAGTAGAG
GGGAAGGGCTCCAGAAGCTCCTCGGAGCACAAGGGTTCTTCCGGAGATACTGCAAATCCTTTTCCAGTGCCTTCTTTGCCAAATGGTAAC
TCTAAACCAGGGAAGCCTCAAGTGAAGTTTGACAAACAACAAGCAGACCTTCACATGAGGGAGGCAAAAAAGATGAAGCAGAAAGCAGAG
TTAATGACGGACAGGGTTGGAAAGGCTTTTAAGTACCTGGAAGCCGTCTTGTCCTTCATTGAGTGCGGAATTGCCACAGAGTCTGAAAGC
CAGTCATCCAAGTCAGCTTACTCTGTCTACTCAGAAACTGTAGATCTCATTAAATTCATAATGTCATTAAAATCCTTCTCAGATGCCACA
GCGCCAACACAAGAGAAAATATTTGCTGTTTTATGCATGCGTTGCCAGTCCATTTTGAACATGGCGATGTTTCGTTGTAAAAAAGACATA
GCAATAAAGTATTCTCGTACTCTTAATAAACACTTCGAGAGTTCTTCCAAAGTCGCCCAGGCACCTTCTCCATGCATTGCAAGAAGCACA
GGCACACCATCCCCTCTTTCCCCAATGCCTTCTCCTGCCAGCTCCGTAGGGTCCCAGTCAAGTGCTGGCAGTGTGGGGAGCAGTGGGGTG
GCTGCCACTATCAGCACCCCAGTCACCATCCAGAATATGACATCTTCCTATGTCACCATCACATCCCATGTTCTTACCGCCTTTGACCTT
TGGGAACAGGCCGAGGCCCTCACGAGGAAGAATAAAGAATTCTTTGCTCGGCTCAGCACAAATGTGTGCACCTTGGCCCTCAACAGCAGT

>In-frame_KMT2A_ENST00000534358_chr11_118353211_+_AFF1_ENST00000307808_chr4_88011134_+_6636nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAATGACCCATTCATGGCCGCCTCCTTTGACAGCAATACATACGCCTAGTACA
GCTGAGCCATCCAAGTTTCCTTTCCCTACAAAGGACTCTCAGCATGTCAGTTCTGTAACCCAAAACCAAAAACAATATGATACATCTTCA
AAAACTCACTCAAATTCTCAGCAAGGAACGTCATCCATGCTCGAAGACGACCTTCAGCTCAGTGACAGTGAGGACAGTGACAGTGAACAA
ACCCCAGAGAAGCCTCCCTCCTCATCTGCACCTCCAAGTGCTCCACAGTCCCTTCCAGAACCAGTGGCATCAGCACATTCCAGCAGTGCA
GAGTCAGAAAGCACCAGTGACTCAGACAGTTCCTCAGACTCAGAGAGCGAGAGCAGTTCAAGTGACAGCGAAGAAAATGAGCCCCTAGAA
ACCCCAGCTCCGGAGCCTGAGCCTCCAACAACAAACAAATGGCAGCTGGACAACTGGCTGACCAAAGTCAGCCAGCCAGCTGCGCCACCA
GAGGGCCCCAGGAGCACAGAGCCCCCACGGCGGCACCCAGAGAGTAAGGGCAGCAGCGACAGTGCCACGAGTCAGGAGCATTCTGAATCC
AAAGATCCTCCCCCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCACCCGAAGCCCCCCACCCCGGAAAGAGGAGCTGTCAGAAGTCTCCG
GCACAGCAGGAGCCCCCACAAAGGCAAACCGTTGGAACCAAACAACCCAAAAAACCTGTCAAGGCCTCTGCCCGGGCAGGTTCACGGACC
AGCCTGCAGGGGGAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCCCGAGACCAGACTTCCAAAGACAAGCCCAAGGTGAAGACGAAAGGA
CGGCCCCGGGCCGCAGCAAGCAACGAACCCAAGCCAGCAGTGCCCCCCTCCAGTGAGAAGAAGAAGCACAAGAGCTCCCTCCCTGCCCCC
TCTAAGGCTCTCTCAGGCCCAGAACCCGCGAAGGACAATGTGGAGGACAGGACCCCTGAGCACTTTGCTCTTGTTCCCCTGACTGAGAGC
CAGGGCCCACCCCACAGTGGCAGCGGCAGCAGGACTAGTGGCTGCCGCCAAGCCGTGGTGGTCCAGGAGGACAGCCGCAAAGACAGACTC
CCATTGCCTTTGAGAGACACCAAGCTGCTCTCACCGCTCAGGGACACTCCTCCCCCACAAAGCTTGATGGTGAAGATCACCCTAGACCTG
CTCTCTCGGATACCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGGAAAGCAGAAGATAAACAGCCGCCCGCAGGGAAGAAGCACAGCTCT
GAGAAGAGGAGCTCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGAAAGGGTGAAGCAGAAAGAGACTGTGATAACAAGAAAATCAGACTG
GAGAAGGAAATCAAATCACAGTCATCTTCATCTTCATCCTCCCACAAAGAATCTTCTAAAACAAAGCCCTCCAGGCCCTCCTCACAGTCC
TCAAAGAAGGAAATGCTCCCCCCGCCACCCGTGTCCTCGTCCTCCCAGAAGCCAGCCAAGCCTGCACTTAAGAGGTCAAGGCGGGAAGCA
GACACCTGTGGCCAGGACCCTCCCAAAAGTGCCAGCAGTACCAAGAGCAACCACAAAGACTCTTCCATTCCCAAGCAGAGAAGAGTAGAG
GGGAAGGGCTCCAGAAGCTCCTCGGAGCACAAGGGTTCTTCCGGAGATACTGCAAATCCTTTTCCAGTGCCTTCTTTGCCAAATGGTAAC
TCTAAACCAGGGAAGCCTCAAGTGAAGTTTGACAAACAACAAGCAGACCTTCACATGAGGGAGGCAAAAAAGATGAAGCAGAAAGCAGAG
TTAATGACGGACAGGGTTGGAAAGGCTTTTAAGTACCTGGAAGCCGTCTTGTCCTTCATTGAGTGCGGAATTGCCACAGAGTCTGAAAGC
CAGTCATCCAAGTCAGCTTACTCTGTCTACTCAGAAACTGTAGATCTCATTAAATTCATAATGTCATTAAAATCCTTCTCAGATGCCACA
GCGCCAACACAAGAGAAAATATTTGCTGTTTTATGCATGCGTTGCCAGTCCATTTTGAACATGGCGATGTTTCGTTGTAAAAAAGACATA
GCAATAAAGTATTCTCGTACTCTTAATAAACACTTCGAGAGTTCTTCCAAAGTCGCCCAGGCACCTTCTCCATGCATTGCAAGCACAGGC
ACACCATCCCCTCTTTCCCCAATGCCTTCTCCTGCCAGCTCCGTAGGGTCCCAGTCAAGTGCTGGCAGTGTGGGGAGCAGTGGGGTGGCT
GCCACTATCAGCACCCCAGTCACCATCCAGAATATGACATCTTCCTATGTCACCATCACATCCCATGTTCTTACCGCCTTTGACCTTTGG
GAACAGGCCGAGGCCCTCACGAGGAAGAATAAAGAATTCTTTGCTCGGCTCAGCACAAATGTGTGCACCTTGGCCCTCAACAGCAGTTTG

>In-frame_KMT2A_ENST00000389506_chr11_118353211_+_AFF1_ENST00000395146_chr4_88011134_+_6639nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAATGACCCATTCATGGCCGCCTCCTTTGACAGCAATACATACGCCTAGTACA
GCTGAGCCATCCAAGTTTCCTTTCCCTACAAAGGACTCTCAGCATGTCAGTTCTGTAACCCAAAACCAAAAACAATATGATACATCTTCA
AAAACTCACTCAAATTCTCAGCAAGGAACGTCATCCATGCTCGAAGACGACCTTCAGCTCAGTGACAGTGAGGACAGTGACAGTGAACAA
ACCCCAGAGAAGCCTCCCTCCTCATCTGCACCTCCAAGTGCTCCACAGTCCCTTCCAGAACCAGTGGCATCAGCACATTCCAGCAGTGCA
GAGTCAGAAAGCACCAGTGACTCAGACAGTTCCTCAGACTCAGAGAGCGAGAGCAGTTCAAGTGACAGCGAAGAAAATGAGCCCCTAGAA
ACCCCAGCTCCGGAGCCTGAGCCTCCAACAACAAACAAATGGCAGCTGGACAACTGGCTGACCAAAGTCAGCCAGCCAGCTGCGCCACCA
GAGGGCCCCAGGAGCACAGAGCCCCCACGGCGGCACCCAGAGAGTAAGGGCAGCAGCGACAGTGCCACGAGTCAGGAGCATTCTGAATCC
AAAGATCCTCCCCCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCACCCGAAGCCCCCCACCCCGGAAAGAGGAGCTGTCAGAAGTCTCCG
GCACAGCAGGAGCCCCCACAAAGGCAAACCGTTGGAACCAAACAACCCAAAAAACCTGTCAAGGCCTCTGCCCGGGCAGGTTCACGGACC
AGCCTGCAGGGGGAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCCCGAGACCAGACTTCCAAAGACAAGCCCAAGGTGAAGACGAAAGGA
CGGCCCCGGGCCGCAGCAAGCAACGAACCCAAGCCAGCAGTGCCCCCCTCCAGTGAGAAGAAGAAGCACAAGAGCTCCCTCCCTGCCCCC
TCTAAGGCTCTCTCAGGCCCAGAACCCGCGAAGGACAATGTGGAGGACAGGACCCCTGAGCACTTTGCTCTTGTTCCCCTGACTGAGAGC
CAGGGCCCACCCCACAGTGGCAGCGGCAGCAGGACTAGTGGCTGCCGCCAAGCCGTGGTGGTCCAGGAGGACAGCCGCAAAGACAGACTC
CCATTGCCTTTGAGAGACACCAAGCTGCTCTCACCGCTCAGGGACACTCCTCCCCCACAAAGCTTGATGGTGAAGATCACCCTAGACCTG
CTCTCTCGGATACCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGGAAAGCAGAAGATAAACAGCCGCCCGCAGGGAAGAAGCACAGCTCT
GAGAAGAGGAGCTCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGAAAGGGTGAAGCAGAAAGAGACTGTGATAACAAGAAAATCAGACTG
GAGAAGGAAATCAAATCACAGTCATCTTCATCTTCATCCTCCCACAAAGAATCTTCTAAAACAAAGCCCTCCAGGCCCTCCTCACAGTCC
TCAAAGAAGGAAATGCTCCCCCCGCCACCCGTGTCCTCGTCCTCCCAGAAGCCAGCCAAGCCTGCACTTAAGAGGTCAAGGCGGGAAGCA
GACACCTGTGGCCAGGACCCTCCCAAAAGTGCCAGCAGTACCAAGAGCAACCACAAAGACTCTTCCATTCCCAAGCAGAGAAGAGTAGAG
GGGAAGGGCTCCAGAAGCTCCTCGGAGCACAAGGGTTCTTCCGGAGATACTGCAAATCCTTTTCCAGTGCCTTCTTTGCCAAATGGTAAC
TCTAAACCAGGGAAGCCTCAAGTGAAGTTTGACAAACAACAAGCAGACCTTCACATGAGGGAGGCAAAAAAGATGAAGCAGAAAGCAGAG
TTAATGACGGACAGGGTTGGAAAGGCTTTTAAGTACCTGGAAGCCGTCTTGTCCTTCATTGAGTGCGGAATTGCCACAGAGTCTGAAAGC
CAGTCATCCAAGTCAGCTTACTCTGTCTACTCAGAAACTGTAGATCTCATTAAATTCATAATGTCATTAAAATCCTTCTCAGATGCCACA
GCGCCAACACAAGAGAAAATATTTGCTGTTTTATGCATGCGTTGCCAGTCCATTTTGAACATGGCGATGTTTCGTTGTAAAAAAGACATA
GCAATAAAGTATTCTCGTACTCTTAATAAACACTTCGAGAGTTCTTCCAAAGTCGCCCAGGCACCTTCTCCATGCATTGCAAGAAGCACA
GGCACACCATCCCCTCTTTCCCCAATGCCTTCTCCTGCCAGCTCCGTAGGGTCCCAGTCAAGTGCTGGCAGTGTGGGGAGCAGTGGGGTG
GCTGCCACTATCAGCACCCCAGTCACCATCCAGAATATGACATCTTCCTATGTCACCATCACATCCCATGTTCTTACCGCCTTTGACCTT
TGGGAACAGGCCGAGGCCCTCACGAGGAAGAATAAAGAATTCTTTGCTCGGCTCAGCACAAATGTGTGCACCTTGGCCCTCAACAGCAGT

>In-frame_KMT2A_ENST00000389506_chr11_118353211_+_AFF1_ENST00000307808_chr4_88011134_+_6636nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAATGACCCATTCATGGCCGCCTCCTTTGACAGCAATACATACGCCTAGTACA
GCTGAGCCATCCAAGTTTCCTTTCCCTACAAAGGACTCTCAGCATGTCAGTTCTGTAACCCAAAACCAAAAACAATATGATACATCTTCA
AAAACTCACTCAAATTCTCAGCAAGGAACGTCATCCATGCTCGAAGACGACCTTCAGCTCAGTGACAGTGAGGACAGTGACAGTGAACAA
ACCCCAGAGAAGCCTCCCTCCTCATCTGCACCTCCAAGTGCTCCACAGTCCCTTCCAGAACCAGTGGCATCAGCACATTCCAGCAGTGCA
GAGTCAGAAAGCACCAGTGACTCAGACAGTTCCTCAGACTCAGAGAGCGAGAGCAGTTCAAGTGACAGCGAAGAAAATGAGCCCCTAGAA
ACCCCAGCTCCGGAGCCTGAGCCTCCAACAACAAACAAATGGCAGCTGGACAACTGGCTGACCAAAGTCAGCCAGCCAGCTGCGCCACCA
GAGGGCCCCAGGAGCACAGAGCCCCCACGGCGGCACCCAGAGAGTAAGGGCAGCAGCGACAGTGCCACGAGTCAGGAGCATTCTGAATCC
AAAGATCCTCCCCCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCACCCGAAGCCCCCCACCCCGGAAAGAGGAGCTGTCAGAAGTCTCCG
GCACAGCAGGAGCCCCCACAAAGGCAAACCGTTGGAACCAAACAACCCAAAAAACCTGTCAAGGCCTCTGCCCGGGCAGGTTCACGGACC
AGCCTGCAGGGGGAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCCCGAGACCAGACTTCCAAAGACAAGCCCAAGGTGAAGACGAAAGGA
CGGCCCCGGGCCGCAGCAAGCAACGAACCCAAGCCAGCAGTGCCCCCCTCCAGTGAGAAGAAGAAGCACAAGAGCTCCCTCCCTGCCCCC
TCTAAGGCTCTCTCAGGCCCAGAACCCGCGAAGGACAATGTGGAGGACAGGACCCCTGAGCACTTTGCTCTTGTTCCCCTGACTGAGAGC
CAGGGCCCACCCCACAGTGGCAGCGGCAGCAGGACTAGTGGCTGCCGCCAAGCCGTGGTGGTCCAGGAGGACAGCCGCAAAGACAGACTC
CCATTGCCTTTGAGAGACACCAAGCTGCTCTCACCGCTCAGGGACACTCCTCCCCCACAAAGCTTGATGGTGAAGATCACCCTAGACCTG
CTCTCTCGGATACCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGGAAAGCAGAAGATAAACAGCCGCCCGCAGGGAAGAAGCACAGCTCT
GAGAAGAGGAGCTCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGAAAGGGTGAAGCAGAAAGAGACTGTGATAACAAGAAAATCAGACTG
GAGAAGGAAATCAAATCACAGTCATCTTCATCTTCATCCTCCCACAAAGAATCTTCTAAAACAAAGCCCTCCAGGCCCTCCTCACAGTCC
TCAAAGAAGGAAATGCTCCCCCCGCCACCCGTGTCCTCGTCCTCCCAGAAGCCAGCCAAGCCTGCACTTAAGAGGTCAAGGCGGGAAGCA
GACACCTGTGGCCAGGACCCTCCCAAAAGTGCCAGCAGTACCAAGAGCAACCACAAAGACTCTTCCATTCCCAAGCAGAGAAGAGTAGAG
GGGAAGGGCTCCAGAAGCTCCTCGGAGCACAAGGGTTCTTCCGGAGATACTGCAAATCCTTTTCCAGTGCCTTCTTTGCCAAATGGTAAC
TCTAAACCAGGGAAGCCTCAAGTGAAGTTTGACAAACAACAAGCAGACCTTCACATGAGGGAGGCAAAAAAGATGAAGCAGAAAGCAGAG
TTAATGACGGACAGGGTTGGAAAGGCTTTTAAGTACCTGGAAGCCGTCTTGTCCTTCATTGAGTGCGGAATTGCCACAGAGTCTGAAAGC
CAGTCATCCAAGTCAGCTTACTCTGTCTACTCAGAAACTGTAGATCTCATTAAATTCATAATGTCATTAAAATCCTTCTCAGATGCCACA
GCGCCAACACAAGAGAAAATATTTGCTGTTTTATGCATGCGTTGCCAGTCCATTTTGAACATGGCGATGTTTCGTTGTAAAAAAGACATA
GCAATAAAGTATTCTCGTACTCTTAATAAACACTTCGAGAGTTCTTCCAAAGTCGCCCAGGCACCTTCTCCATGCATTGCAAGCACAGGC
ACACCATCCCCTCTTTCCCCAATGCCTTCTCCTGCCAGCTCCGTAGGGTCCCAGTCAAGTGCTGGCAGTGTGGGGAGCAGTGGGGTGGCT
GCCACTATCAGCACCCCAGTCACCATCCAGAATATGACATCTTCCTATGTCACCATCACATCCCATGTTCTTACCGCCTTTGACCTTTGG
GAACAGGCCGAGGCCCTCACGAGGAAGAATAAAGAATTCTTTGCTCGGCTCAGCACAAATGTGTGCACCTTGGCCCTCAACAGCAGTTTG

>In-frame_KMT2A_ENST00000354520_chr11_118353211_+_AFF1_ENST00000395146_chr4_88011134_+_6639nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAATGACCCATTCATGGCCGCCTCCTTTGACAGCAATACATACGCCTAGTACA
GCTGAGCCATCCAAGTTTCCTTTCCCTACAAAGGACTCTCAGCATGTCAGTTCTGTAACCCAAAACCAAAAACAATATGATACATCTTCA
AAAACTCACTCAAATTCTCAGCAAGGAACGTCATCCATGCTCGAAGACGACCTTCAGCTCAGTGACAGTGAGGACAGTGACAGTGAACAA
ACCCCAGAGAAGCCTCCCTCCTCATCTGCACCTCCAAGTGCTCCACAGTCCCTTCCAGAACCAGTGGCATCAGCACATTCCAGCAGTGCA
GAGTCAGAAAGCACCAGTGACTCAGACAGTTCCTCAGACTCAGAGAGCGAGAGCAGTTCAAGTGACAGCGAAGAAAATGAGCCCCTAGAA
ACCCCAGCTCCGGAGCCTGAGCCTCCAACAACAAACAAATGGCAGCTGGACAACTGGCTGACCAAAGTCAGCCAGCCAGCTGCGCCACCA
GAGGGCCCCAGGAGCACAGAGCCCCCACGGCGGCACCCAGAGAGTAAGGGCAGCAGCGACAGTGCCACGAGTCAGGAGCATTCTGAATCC
AAAGATCCTCCCCCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCACCCGAAGCCCCCCACCCCGGAAAGAGGAGCTGTCAGAAGTCTCCG
GCACAGCAGGAGCCCCCACAAAGGCAAACCGTTGGAACCAAACAACCCAAAAAACCTGTCAAGGCCTCTGCCCGGGCAGGTTCACGGACC
AGCCTGCAGGGGGAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCCCGAGACCAGACTTCCAAAGACAAGCCCAAGGTGAAGACGAAAGGA
CGGCCCCGGGCCGCAGCAAGCAACGAACCCAAGCCAGCAGTGCCCCCCTCCAGTGAGAAGAAGAAGCACAAGAGCTCCCTCCCTGCCCCC
TCTAAGGCTCTCTCAGGCCCAGAACCCGCGAAGGACAATGTGGAGGACAGGACCCCTGAGCACTTTGCTCTTGTTCCCCTGACTGAGAGC
CAGGGCCCACCCCACAGTGGCAGCGGCAGCAGGACTAGTGGCTGCCGCCAAGCCGTGGTGGTCCAGGAGGACAGCCGCAAAGACAGACTC
CCATTGCCTTTGAGAGACACCAAGCTGCTCTCACCGCTCAGGGACACTCCTCCCCCACAAAGCTTGATGGTGAAGATCACCCTAGACCTG
CTCTCTCGGATACCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGGAAAGCAGAAGATAAACAGCCGCCCGCAGGGAAGAAGCACAGCTCT
GAGAAGAGGAGCTCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGAAAGGGTGAAGCAGAAAGAGACTGTGATAACAAGAAAATCAGACTG
GAGAAGGAAATCAAATCACAGTCATCTTCATCTTCATCCTCCCACAAAGAATCTTCTAAAACAAAGCCCTCCAGGCCCTCCTCACAGTCC
TCAAAGAAGGAAATGCTCCCCCCGCCACCCGTGTCCTCGTCCTCCCAGAAGCCAGCCAAGCCTGCACTTAAGAGGTCAAGGCGGGAAGCA
GACACCTGTGGCCAGGACCCTCCCAAAAGTGCCAGCAGTACCAAGAGCAACCACAAAGACTCTTCCATTCCCAAGCAGAGAAGAGTAGAG
GGGAAGGGCTCCAGAAGCTCCTCGGAGCACAAGGGTTCTTCCGGAGATACTGCAAATCCTTTTCCAGTGCCTTCTTTGCCAAATGGTAAC
TCTAAACCAGGGAAGCCTCAAGTGAAGTTTGACAAACAACAAGCAGACCTTCACATGAGGGAGGCAAAAAAGATGAAGCAGAAAGCAGAG
TTAATGACGGACAGGGTTGGAAAGGCTTTTAAGTACCTGGAAGCCGTCTTGTCCTTCATTGAGTGCGGAATTGCCACAGAGTCTGAAAGC
CAGTCATCCAAGTCAGCTTACTCTGTCTACTCAGAAACTGTAGATCTCATTAAATTCATAATGTCATTAAAATCCTTCTCAGATGCCACA
GCGCCAACACAAGAGAAAATATTTGCTGTTTTATGCATGCGTTGCCAGTCCATTTTGAACATGGCGATGTTTCGTTGTAAAAAAGACATA
GCAATAAAGTATTCTCGTACTCTTAATAAACACTTCGAGAGTTCTTCCAAAGTCGCCCAGGCACCTTCTCCATGCATTGCAAGAAGCACA
GGCACACCATCCCCTCTTTCCCCAATGCCTTCTCCTGCCAGCTCCGTAGGGTCCCAGTCAAGTGCTGGCAGTGTGGGGAGCAGTGGGGTG
GCTGCCACTATCAGCACCCCAGTCACCATCCAGAATATGACATCTTCCTATGTCACCATCACATCCCATGTTCTTACCGCCTTTGACCTT
TGGGAACAGGCCGAGGCCCTCACGAGGAAGAATAAAGAATTCTTTGCTCGGCTCAGCACAAATGTGTGCACCTTGGCCCTCAACAGCAGT

>In-frame_KMT2A_ENST00000354520_chr11_118353211_+_AFF1_ENST00000307808_chr4_88011134_+_6636nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAATGACCCATTCATGGCCGCCTCCTTTGACAGCAATACATACGCCTAGTACA
GCTGAGCCATCCAAGTTTCCTTTCCCTACAAAGGACTCTCAGCATGTCAGTTCTGTAACCCAAAACCAAAAACAATATGATACATCTTCA
AAAACTCACTCAAATTCTCAGCAAGGAACGTCATCCATGCTCGAAGACGACCTTCAGCTCAGTGACAGTGAGGACAGTGACAGTGAACAA
ACCCCAGAGAAGCCTCCCTCCTCATCTGCACCTCCAAGTGCTCCACAGTCCCTTCCAGAACCAGTGGCATCAGCACATTCCAGCAGTGCA
GAGTCAGAAAGCACCAGTGACTCAGACAGTTCCTCAGACTCAGAGAGCGAGAGCAGTTCAAGTGACAGCGAAGAAAATGAGCCCCTAGAA
ACCCCAGCTCCGGAGCCTGAGCCTCCAACAACAAACAAATGGCAGCTGGACAACTGGCTGACCAAAGTCAGCCAGCCAGCTGCGCCACCA
GAGGGCCCCAGGAGCACAGAGCCCCCACGGCGGCACCCAGAGAGTAAGGGCAGCAGCGACAGTGCCACGAGTCAGGAGCATTCTGAATCC
AAAGATCCTCCCCCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCACCCGAAGCCCCCCACCCCGGAAAGAGGAGCTGTCAGAAGTCTCCG
GCACAGCAGGAGCCCCCACAAAGGCAAACCGTTGGAACCAAACAACCCAAAAAACCTGTCAAGGCCTCTGCCCGGGCAGGTTCACGGACC
AGCCTGCAGGGGGAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCCCGAGACCAGACTTCCAAAGACAAGCCCAAGGTGAAGACGAAAGGA
CGGCCCCGGGCCGCAGCAAGCAACGAACCCAAGCCAGCAGTGCCCCCCTCCAGTGAGAAGAAGAAGCACAAGAGCTCCCTCCCTGCCCCC
TCTAAGGCTCTCTCAGGCCCAGAACCCGCGAAGGACAATGTGGAGGACAGGACCCCTGAGCACTTTGCTCTTGTTCCCCTGACTGAGAGC
CAGGGCCCACCCCACAGTGGCAGCGGCAGCAGGACTAGTGGCTGCCGCCAAGCCGTGGTGGTCCAGGAGGACAGCCGCAAAGACAGACTC
CCATTGCCTTTGAGAGACACCAAGCTGCTCTCACCGCTCAGGGACACTCCTCCCCCACAAAGCTTGATGGTGAAGATCACCCTAGACCTG
CTCTCTCGGATACCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGGAAAGCAGAAGATAAACAGCCGCCCGCAGGGAAGAAGCACAGCTCT
GAGAAGAGGAGCTCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGAAAGGGTGAAGCAGAAAGAGACTGTGATAACAAGAAAATCAGACTG
GAGAAGGAAATCAAATCACAGTCATCTTCATCTTCATCCTCCCACAAAGAATCTTCTAAAACAAAGCCCTCCAGGCCCTCCTCACAGTCC
TCAAAGAAGGAAATGCTCCCCCCGCCACCCGTGTCCTCGTCCTCCCAGAAGCCAGCCAAGCCTGCACTTAAGAGGTCAAGGCGGGAAGCA
GACACCTGTGGCCAGGACCCTCCCAAAAGTGCCAGCAGTACCAAGAGCAACCACAAAGACTCTTCCATTCCCAAGCAGAGAAGAGTAGAG
GGGAAGGGCTCCAGAAGCTCCTCGGAGCACAAGGGTTCTTCCGGAGATACTGCAAATCCTTTTCCAGTGCCTTCTTTGCCAAATGGTAAC
TCTAAACCAGGGAAGCCTCAAGTGAAGTTTGACAAACAACAAGCAGACCTTCACATGAGGGAGGCAAAAAAGATGAAGCAGAAAGCAGAG
TTAATGACGGACAGGGTTGGAAAGGCTTTTAAGTACCTGGAAGCCGTCTTGTCCTTCATTGAGTGCGGAATTGCCACAGAGTCTGAAAGC
CAGTCATCCAAGTCAGCTTACTCTGTCTACTCAGAAACTGTAGATCTCATTAAATTCATAATGTCATTAAAATCCTTCTCAGATGCCACA
GCGCCAACACAAGAGAAAATATTTGCTGTTTTATGCATGCGTTGCCAGTCCATTTTGAACATGGCGATGTTTCGTTGTAAAAAAGACATA
GCAATAAAGTATTCTCGTACTCTTAATAAACACTTCGAGAGTTCTTCCAAAGTCGCCCAGGCACCTTCTCCATGCATTGCAAGCACAGGC
ACACCATCCCCTCTTTCCCCAATGCCTTCTCCTGCCAGCTCCGTAGGGTCCCAGTCAAGTGCTGGCAGTGTGGGGAGCAGTGGGGTGGCT
GCCACTATCAGCACCCCAGTCACCATCCAGAATATGACATCTTCCTATGTCACCATCACATCCCATGTTCTTACCGCCTTTGACCTTTGG
GAACAGGCCGAGGCCCTCACGAGGAAGAATAAAGAATTCTTTGCTCGGCTCAGCACAAATGTGTGCACCTTGGCCCTCAACAGCAGTTTG


* Fusion transcript sequences (Full-length transcript).
>In-frame_KMT2A_ENST00000534358_chr11_118353211_+_AFF1_ENST00000395146_chr4_88012943_+_11928nt
CTGCTTCACTTCACGGGGCGAACATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGG
GGCGCCGGGGCCTAGGGGGCGCCCCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGG
CGCCCCCCTCCCCCCCGGCTGTGGCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAG
CAGCCTCCTCGTCGTCCGCCTCGTCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCG
ACGCGGCGCTGCAGGTCTCGGCCGCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCG
GAGAGGATGAGCAATTCTTAGGTTTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTC
GAAAACCTCGTGGGAGACCTAGAAGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAG
AGACCAAATCTGGAGATAAGATCAAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAA
TCAAAATAACACATGGAAAGGACATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTA
CGTTTCAGCAAGCCACAAAGATTAAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAG
GAAGGAAGGGGGTACAAATTGTACGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTG
AACTGGAAAAGCCCCAGAAAGTCCGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTC
GAAGGATTAAGCCAGTTAGGATTATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGG
CTCAAAAGAAAATTGAAAAAGAAGCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTG
TTGTCAGTGCTATCTCCTCGCGGATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGAT
TAGAGTCTACACCGAATAGTAGATTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGT
CTTCAGACTCCTCTCGATCTAGTAGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGC
GGAGCGATACCCCTGAAGTTCATCCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAG
TGTCGGAGAGAAGTTTTGGATCTAGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTC
CACCTCTGCTGACTCCACCGCCACCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAG
CATCACCATTTTTGCCTGCTTCCACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAA
AGCATTCTAGGTCAGAGCCACAATACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGAC
CCCCTCCACTAACTCCCGAGGACGTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCC
ATTCTGGAACAAGGTTTGATATGCACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTG
AGTCTGTAACCTTGCCTAGTAATCGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTC
CTATTCGATCTGAACCAAGATCTCCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCC
CGTCTTCTGTCTCTTCCTCGTTAAGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCC
TGACTCAGTCTGGGGAATCTGCAGAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTA
CTCCTCTCTTCCCTTGGTTTACCCCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAG
ATGCTGACAAGAGCGTGGAGAAGGACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAA
GGAAAAAGGGATCAGAAATTCAGAGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCA
CTTCATCTTCTGCCAAAAAAGCAACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATA
CAACAGCTGTCAAAACCAAAATACTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCC
TGGAGAAGGAGAAAACCCTCTGCCTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGG
CAGACAAGCTTCCAATGACTGACAAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTC
TTAAACAAACCGACCAGCCCAAAGCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCA
GAAGAGCAGCTGTTGCCCTTGGCCGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAA
AGATTTTGTCTTCCATGGGGAATGATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTA
AACCTGTCACTAGAAACAAGGCACCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGG
TGCCTGAGGACTGTGGTGTTTGTACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAA
AATGTCAGAATCTACAATGGATGCCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCA
GTGAAAAGAAAGACAGCAAAGAGAGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTG
CCCCAAAGAAAAGCAGTAGTGAGCCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAAT
CCAAACAGGCCACCACTCCAGCTTCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAG
GACCGCCAAGAAAAGAAGTTCCCAAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCA
AACAGAAAAAAGTGGCTCCCCGCCCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGACTCTCAGCATGTCAGTTCTGTAACCCAAA
ACCAAAAACAATATGATACATCTTCAAAAACTCACTCAAATTCTCAGCAAGGAACGTCATCCATGCTCGAAGACGACCTTCAGCTCAGTG
ACAGTGAGGACAGTGACAGTGAACAAACCCCAGAGAAGCCTCCCTCCTCATCTGCACCTCCAAGTGCTCCACAGTCCCTTCCAGAACCAG
TGGCATCAGCACATTCCAGCAGTGCAGAGTCAGAAAGCACCAGTGACTCAGACAGTTCCTCAGACTCAGAGAGCGAGAGCAGTTCAAGTG
ACAGCGAAGAAAATGAGCCCCTAGAAACCCCAGCTCCGGAGCCTGAGCCTCCAACAACAAACAAATGGCAGCTGGACAACTGGCTGACCA
AAGTCAGCCAGCCAGCTGCGCCACCAGAGGGCCCCAGGAGCACAGAGCCCCCACGGCGGCACCCAGAGAGTAAGGGCAGCAGCGACAGTG
CCACGAGTCAGGAGCATTCTGAATCCAAAGATCCTCCCCCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCACCCGAAGCCCCCCACCCCG
GAAAGAGGAGCTGTCAGAAGTCTCCGGCACAGCAGGAGCCCCCACAAAGGCAAACCGTTGGAACCAAACAACCCAAAAAACCTGTCAAGG
CCTCTGCCCGGGCAGGTTCACGGACCAGCCTGCAGGGGGAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCCCGAGACCAGACTTCCAAAG
ACAAGCCCAAGGTGAAGACGAAAGGACGGCCCCGGGCCGCAGCAAGCAACGAACCCAAGCCAGCAGTGCCCCCCTCCAGTGAGAAGAAGA
AGCACAAGAGCTCCCTCCCTGCCCCCTCTAAGGCTCTCTCAGGCCCAGAACCCGCGAAGGACAATGTGGAGGACAGGACCCCTGAGCACT
TTGCTCTTGTTCCCCTGACTGAGAGCCAGGGCCCACCCCACAGTGGCAGCGGCAGCAGGACTAGTGGCTGCCGCCAAGCCGTGGTGGTCC
AGGAGGACAGCCGCAAAGACAGACTCCCATTGCCTTTGAGAGACACCAAGCTGCTCTCACCGCTCAGGGACACTCCTCCCCCACAAAGCT
TGATGGTGAAGATCACCCTAGACCTGCTCTCTCGGATACCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGGAAAGCAGAAGATAAACAGC
CGCCCGCAGGGAAGAAGCACAGCTCTGAGAAGAGGAGCTCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGAAAGGGTGAAGCAGAAAGAG
ACTGTGATAACAAGAAAATCAGACTGGAGAAGGAAATCAAATCACAGTCATCTTCATCTTCATCCTCCCACAAAGAATCTTCTAAAACAA
AGCCCTCCAGGCCCTCCTCACAGTCCTCAAAGAAGGAAATGCTCCCCCCGCCACCCGTGTCCTCGTCCTCCCAGAAGCCAGCCAAGCCTG
CACTTAAGAGGTCAAGGCGGGAAGCAGACACCTGTGGCCAGGACCCTCCCAAAAGTGCCAGCAGTACCAAGAGCAACCACAAAGACTCTT
CCATTCCCAAGCAGAGAAGAGTAGAGGGGAAGGGCTCCAGAAGCTCCTCGGAGCACAAGGGTTCTTCCGGAGATACTGCAAATCCTTTTC
CAGTGCCTTCTTTGCCAAATGGTAACTCTAAACCAGGGAAGCCTCAAGTGAAGTTTGACAAACAACAAGCAGACCTTCACATGAGGGAGG
CAAAAAAGATGAAGCAGAAAGCAGAGTTAATGACGGACAGGGTTGGAAAGGCTTTTAAGTACCTGGAAGCCGTCTTGTCCTTCATTGAGT
GCGGAATTGCCACAGAGTCTGAAAGCCAGTCATCCAAGTCAGCTTACTCTGTCTACTCAGAAACTGTAGATCTCATTAAATTCATAATGT
CATTAAAATCCTTCTCAGATGCCACAGCGCCAACACAAGAGAAAATATTTGCTGTTTTATGCATGCGTTGCCAGTCCATTTTGAACATGG
CGATGTTTCGTTGTAAAAAAGACATAGCAATAAAGTATTCTCGTACTCTTAATAAACACTTCGAGAGTTCTTCCAAAGTCGCCCAGGCAC
CTTCTCCATGCATTGCAAGAAGCACAGGCACACCATCCCCTCTTTCCCCAATGCCTTCTCCTGCCAGCTCCGTAGGGTCCCAGTCAAGTG
CTGGCAGTGTGGGGAGCAGTGGGGTGGCTGCCACTATCAGCACCCCAGTCACCATCCAGAATATGACATCTTCCTATGTCACCATCACAT
CCCATGTTCTTACCGCCTTTGACCTTTGGGAACAGGCCGAGGCCCTCACGAGGAAGAATAAAGAATTCTTTGCTCGGCTCAGCACAAATG
TGTGCACCTTGGCCCTCAACAGCAGTTTGGTGGACCTGGTGCACTATACACGACAGGGTTTTCAGCAGCTACAAGAATTAACCAAAACAC
CTTAATGGAGCCCCAGGTTGATTCAATGCCTTGGGAACTATTTTTGCACATTGGAAGCCTCAAAAACAGTCCAGACATTTGTTTCATCAG
GACACCAAACTCTAAAAAAGAAGCACCACGAGATGGCCAGGACATTTGTCCACTTAAACTCTCAACAACAGTGTGATCATTGGTTGGACA
CTGTGGTTATGCAGAAGCAGAGATGAGGAGGCTGGCCCCAGAGATGATCTTGCCCTTCCTAACTAAAGGACAGAAGTGCAATTTAGCTTA
AATGGGTGTATGAATGGTCTAGAAACATTTCTATTTTTTTTTTAAACCAGCAGGATACAAGTTGCAAATGAAATGAGGAGAAACAGTTTC
AACTCTGAAAGTGAATTTCACGTCATCTCAGTAGCCACGCTAGTCCATTCCCAGAAGGAAATTTTTTTTTTTAACAATGACTTTTGGTAA
AGGGTTTTGTGGATGATTTTTTTTCTTTTGAGTTTTGGGAGAAATATTTGTTTAGTAACTTCTAATGGCCATCTGTAAACCATAAGTAAT
GAAGGACTCCACTGTGCCCCACTTTCTGCCAATGAACAGTGGCTTGATAATACCAAGTATTGTTGTAATTTATAAAATTGAAGGCAACCC
CCGCTCCTGCCGCCCCCAATCTCCCCATTGCCTAGAGCGCTGCACATTGACCCCAGCTCTGACTTCTCATTACTGTGCTGAAAGTCAGCC
CACGTCGGAGCGGTGAGGAGGAGCCACAGCACATGGGGTGCCACCTCGAGGTCTGCACAGGAGGACTTGGCGCTGCCATTTCCTACCCCT
GCCATTTCCCACCCCTGCTTCAGCGAAAGGGACTCTCTAACAGGGCAGTCACTGTTGACTCTATTCTGAATTTCCTCCCTTGGGGAAGAA
GGGAACCAACATTTATACCTGACCAGATGGCTAAAGTGCTTTTAAAGTTTTGTTTAAGTAGAGCTGGAATTTGAGGTGCTGATCTGTGGT
CTACAGTTATGTGGTAACTCATGTTGTCCAGCCAACTCAGAGTTTCGTCAGTGAACAAGAAACATGAAATCTGCTTCTTAGAGAGGCTAT
ATTTTTCTGCTACAAATATTTTATATTTATAGCAAAACTAGACTTTCAGAGTCCTTGATTGTCTAGGGGAAGTTAACTCCCTGAGAGGAT
GTAGAGATTTGGGGTGGTTGATTAGACTTTTGAAAAACTCATCACCACATGCCTTCACTCCAGAGTGTTCTCAGCTAGATTTGATTTGGT
TGAGGAGGAACTGTGGCCCTCCGTAAGTTATTGCCATAGTGTATGCATTAAACCAAGTCCATTTTGAATGACCTAAAATGAAGTAACACA
ATCAGAAATCCCATGTGCCCATAAGCACAGATTTTTCTTTTTCATTGAAACTTTAAAGGTTATTATTGGAAACATTACTTTGAGTGCAGT
GTTTTTAAAAGCCAATTCTTTTTTATCCCTTTTAGAAGTAGAATTTGCACACTTACTACAATTGAGGAGTGTCATCTCTATAACTTTTTC
TCCGCCTTTGTCCCATTCTGCCCCTGTACATGTTTCCTACCAAGCATGTTTCACATTTTCCTATTAGTGGAGGAGGGAGAACCATATTTA
TTTATAATGAAGACATCTAAGATCCCTATGATGAATGCAGGAACTCTCTTGGTAGTTTGTAAATACACAAAGGGATGTGTCGAGGGATGG
GAGCGATGCTTATCTCTCACAGTGTGAGTGGTCTGTGTGAGGCTGTTCCTTCAGTTTCTTCTCCAGACTGTTCTTTGGTTGTCACTAAGT
CAGAGGTCTGGTCCCTCATGTTTAGGTGAAAGCCAGAGAATGACAGCTGTAGTCATATCTGAGCATAAGACCTTGATGTGTGATTCCTGA
TGACCGGTTTCATTTATTCATGTTATAAAGCAAAGCCCTGGTCCTTTTTAAACTACTAGTTTTAAAAACCTGTGTTAAATGAACAGTAAT
TGCCTGGTAGGTTTGGTGTGTGTGTAGCATTGTGTGTCCATCTGTTATATGTAAAGGACAAGGCACCAGAATCAGGCTTTATTTCGATAT
TGAAGATGTTATTTAACATCTTTCTTTTTTCCTTACTCCCTTAGCCATCCCCTCCCCTTTTGTCCTATCATTCCCTAGAACAAGCCACCT
GTCAATTGTGAAGGGTTGTGTTCTTTATGGCAGGTTCTATGCAGATTGTGCCAGAGCATGTGCGTGTTCTGTTGGCAAGCCACAGTGCTC
CCTTGACTGAAGACATTTCCAGGTAGATTTCTCAGCCAGCTCTAAAACAGATTGCTTTTTCAGTGGCCTTACTCTTTGTGGGTTTTTTTT
TTTTTCTCTGAACTTGATATAAAGATTTTATTTGTCCCTTGAAAAAGTAACAAATGTGCATAGATCAATTTGTACTACTTTGGTCATTGG
ATATTTCTGATCCTTATTGCATTGTACCTAAAGGAGAGTAACTAATGGTAACCTTTTTAATAGAGTATGTGAAAGGTAGTGGCTGATGAA
TCCTTAACGTTCATAGGGTCTTTTTGCTGTTACGGTTGTATATAGAGGTCTGAAGGATTTTTAAAATGATTTGCACTTTTTCACTGCATG
CTTACAATTCCCAAAGGCAAAATCTGTACTGAGGTAGATCATTTGAAAGGGCTAGATTATAAAATTAAGCCTTAGAGTATGGAAAGTTCT
TATAACAATAATAGTACACACTTCAGAGTAAGACAAATGCAAAGCATCTTAAGGAGTGAAAATAGAGTGTAAATCTTGCCTTTGGCACTA
CAAGGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTCTTTAGTAGGAAATGGAAGAACACTGTTTTATTTTTTAAAGTGTTTAATGTTTC
TGTCCTTTCTGTGAATTATTGAATTTAAGAGCCCTGCTAAATAATGAAAAAACACTTTACTAAAATTTATCAAATTATACTGGGTTCGGA
TTGTGAAAACATTGGCCACCTAGTAGCAGTGGTGAGGAGTGGGAGGGCCCAGCAAGCATTTATCAGAAATAGAATCACAATAGGAGGAGA
ATTTGACTGTCTGATATTATGATTTGATTACAATACTGAATGGGAAAAGTATCTAATATTTTGTAACAAAAAGACCTTCATATTATCTGT
TTTGACCAAAATATGTAGCTATTTCCCTTACACAGATTGGACCGCACTTATCTCCCTTGTCCTGTATCCTTTAATTTCAGGTCTCAGGAT
GTTTAGAAAGCTAAAACCCCCTACCCCTTTCTGGCTGAAAACTTGCCTTATTTGGTATCTTACACATTAATGTTACTAGCATCAGGAGCT
TACTGTTTTATTATGATTCATCTTCAGTAATTTTTAGAAGCAAGAAGAAAGCCATTGTGTCCTCTACAATTAACAAAACTTATCTCTGAT
ATACAAAGGGATATAAATATATACACTTAAATAGAGAAAAAGAGGTTGATTGAATTGTGCCTTTGAGTGAACCCAGTTTTTAAATACCGC
TGTGTTTGTTTCGCCATGGCTTCAGGGATGCTACATGGCTCTTGCACCTTTTACTCCTCTGCTTTATGAAGTTTGAGTTGTATTTGTGCA
TCTTAAAGTAGGTTGAGGCTTGAGGCTGGGCTTTCGGGTTTTTTTGTTTTTTGTTTTGTTTTGTTTTGTTTTGTTTTCTTGTACTTAAAC
CTGCTTGCTTCCTACCACAGATTCTTTATTTTCCCAAACACTACAAAAAAACTTTTAAAACTTTGCCATTTCATCTGTTTACACTCTTTG
CCACTGATTAGCAGTATTTAAATCTTGCAAGAATATTTTGTGCTTTCTTTAGAAACACAAGAGTATAGATTTTTCTCACTGAAAAGTGAG
AGTTACGCATTGCAGCCATGAAGGGATGCTAGGATCAATTATGGCAGTACCTTTTTTCCCCTCCTGTTCTTGAGCCAGTTGTCTCTTTTG
TTTTGGGTCCCACTTAGGATTAATGGATGTAAGGTATTTTCCTGTGCCTTTATTTTGTGTCATTCTATTGGAAGGAGGTGTAACGGCAGA
ATAGCATCGTGTTGGGGGTTTTCCTTCAAACACTGCAAGTGATATTGCCACCATGTGAACCTCAAATATGCAATCCAGTTGTGTTGGTTT
CTCGGTGACTTGGAGTGTTCATCTCTTCATGAATTGTGAGCACTGACCATGTTCTTCAGTTCTTAATTATGGTGAGTTGACAAATACCAA
CTACTGCTTTTCTTTAGGTGGCTATAAATTTCTTACTGTCAGGAGGAAATGACATTATATTCTGTTCCACTGAACGTCAGAGATCAGCAG
GCACTGTACTGGGTAGAGAAGTGCCTATACTTCTCTACCTAAGAGGGCAGGAGGGAAACCCTACAGCTCCTTGTGAGCCTATATATTAGT
ATATCGGCCTGGAGAGGACAAGGGAATAAGACCACTCATAGTGAGGCTGGCCAAGCTGCACTGGTCGGACCAGGCAGTGGCTGACCTAAG
GAAGACAACTTGCTTTGCTTAAAAGTAGATTTTTTAAGCAATGCTTAACACAGGCAGCATTCACCTTTGTTCAGGCCATCGACATGTATT
GTTAAAATTACTGCATATCCCCCTCAGATATCAAGTATACACTGTTCATGTTGGGGTTGTGTGTGTGTATGTGTGTATGTACGCACGCAT
GTGTCCCAAATCTTGTTTTAATTTTTTTTTTCTGAATGTGATCATGTTTTGGATGATACCTGAGCAGGGTTGCCTTTTTTTTATTTATTA
CCATTATATATTATATTATATTATATTATATATTTTTTGCTTTCTTATAACTTTGGAGGAAAGTCAAATCTTGGTATTATTAAAATTGTT
TTAAAAAGGAGTAAATTTTCCAGTTGATAAATGAAAATCACTGGCCTATGTTTAATAAGTTTTTCTTTAATTACTGTGGAATAACGTGCC
AGCTATCATCAACACAATGATTTTGTACATAGGGTAGGGAAGCAGTGATGCTCTCAATGGGAAGATGTGCAACACAAATTAAGGGGAACT
CCATGTATTTTACCTACTTCAGCAATGGAACTGCAACTTGGGGCTTTGTGAATAAAATTTAGCTGCCTTGTATAGTCGTTTGAAAGAATA
TGTGATCTGTGAGAGAATTATAGTTTTTTTTTAGAAGAAAAATCTGCAAAAGATCTTTCCAAAGACAATGTGCCACAGATCTTTTGTTCT
CTGTAATGAGGATTAATTGCTGTTTAAACAAAAATGTAATTGTTCATCTTTAAATTCTTTCCTTTTCATAAGAGGATCAAGCTGTAAAAA

>In-frame_KMT2A_ENST00000534358_chr11_118353211_+_AFF1_ENST00000307808_chr4_88012943_+_11909nt
CTGCTTCACTTCACGGGGCGAACATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGG
GGCGCCGGGGCCTAGGGGGCGCCCCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGG
CGCCCCCCTCCCCCCCGGCTGTGGCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAG
CAGCCTCCTCGTCGTCCGCCTCGTCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCG
ACGCGGCGCTGCAGGTCTCGGCCGCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCG
GAGAGGATGAGCAATTCTTAGGTTTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTC
GAAAACCTCGTGGGAGACCTAGAAGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAG
AGACCAAATCTGGAGATAAGATCAAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAA
TCAAAATAACACATGGAAAGGACATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTA
CGTTTCAGCAAGCCACAAAGATTAAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAG
GAAGGAAGGGGGTACAAATTGTACGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTG
AACTGGAAAAGCCCCAGAAAGTCCGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTC
GAAGGATTAAGCCAGTTAGGATTATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGG
CTCAAAAGAAAATTGAAAAAGAAGCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTG
TTGTCAGTGCTATCTCCTCGCGGATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGAT
TAGAGTCTACACCGAATAGTAGATTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGT
CTTCAGACTCCTCTCGATCTAGTAGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGC
GGAGCGATACCCCTGAAGTTCATCCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAG
TGTCGGAGAGAAGTTTTGGATCTAGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTC
CACCTCTGCTGACTCCACCGCCACCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAG
CATCACCATTTTTGCCTGCTTCCACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAA
AGCATTCTAGGTCAGAGCCACAATACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGAC
CCCCTCCACTAACTCCCGAGGACGTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCC
ATTCTGGAACAAGGTTTGATATGCACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTG
AGTCTGTAACCTTGCCTAGTAATCGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTC
CTATTCGATCTGAACCAAGATCTCCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCC
CGTCTTCTGTCTCTTCCTCGTTAAGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCC
TGACTCAGTCTGGGGAATCTGCAGAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTA
CTCCTCTCTTCCCTTGGTTTACCCCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAG
ATGCTGACAAGAGCGTGGAGAAGGACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAA
GGAAAAAGGGATCAGAAATTCAGAGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCA
CTTCATCTTCTGCCAAAAAAGCAACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATA
CAACAGCTGTCAAAACCAAAATACTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCC
TGGAGAAGGAGAAAACCCTCTGCCTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGG
CAGACAAGCTTCCAATGACTGACAAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTC
TTAAACAAACCGACCAGCCCAAAGCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCA
GAAGAGCAGCTGTTGCCCTTGGCCGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAA
AGATTTTGTCTTCCATGGGGAATGATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTA
AACCTGTCACTAGAAACAAGGCACCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGG
TGCCTGAGGACTGTGGTGTTTGTACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAA
AATGTCAGAATCTACAATGGATGCCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCA
GTGAAAAGAAAGACAGCAAAGAGAGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTG
CCCCAAAGAAAAGCAGTAGTGAGCCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAAT
CCAAACAGGCCACCACTCCAGCTTCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAG
GACCGCCAAGAAAAGAAGTTCCCAAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCA
AACAGAAAAAAGTGGCTCCCCGCCCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGACTCTCAGCATGTCAGTTCTGTAACCCAAA
ACCAAAAACAATATGATACATCTTCAAAAACTCACTCAAATTCTCAGCAAGGAACGTCATCCATGCTCGAAGACGACCTTCAGCTCAGTG
ACAGTGAGGACAGTGACAGTGAACAAACCCCAGAGAAGCCTCCCTCCTCATCTGCACCTCCAAGTGCTCCACAGTCCCTTCCAGAACCAG
TGGCATCAGCACATTCCAGCAGTGCAGAGTCAGAAAGCACCAGTGACTCAGACAGTTCCTCAGACTCAGAGAGCGAGAGCAGTTCAAGTG
ACAGCGAAGAAAATGAGCCCCTAGAAACCCCAGCTCCGGAGCCTGAGCCTCCAACAACAAACAAATGGCAGCTGGACAACTGGCTGACCA
AAGTCAGCCAGCCAGCTGCGCCACCAGAGGGCCCCAGGAGCACAGAGCCCCCACGGCGGCACCCAGAGAGTAAGGGCAGCAGCGACAGTG
CCACGAGTCAGGAGCATTCTGAATCCAAAGATCCTCCCCCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCACCCGAAGCCCCCCACCCCG
GAAAGAGGAGCTGTCAGAAGTCTCCGGCACAGCAGGAGCCCCCACAAAGGCAAACCGTTGGAACCAAACAACCCAAAAAACCTGTCAAGG
CCTCTGCCCGGGCAGGTTCACGGACCAGCCTGCAGGGGGAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCCCGAGACCAGACTTCCAAAG
ACAAGCCCAAGGTGAAGACGAAAGGACGGCCCCGGGCCGCAGCAAGCAACGAACCCAAGCCAGCAGTGCCCCCCTCCAGTGAGAAGAAGA
AGCACAAGAGCTCCCTCCCTGCCCCCTCTAAGGCTCTCTCAGGCCCAGAACCCGCGAAGGACAATGTGGAGGACAGGACCCCTGAGCACT
TTGCTCTTGTTCCCCTGACTGAGAGCCAGGGCCCACCCCACAGTGGCAGCGGCAGCAGGACTAGTGGCTGCCGCCAAGCCGTGGTGGTCC
AGGAGGACAGCCGCAAAGACAGACTCCCATTGCCTTTGAGAGACACCAAGCTGCTCTCACCGCTCAGGGACACTCCTCCCCCACAAAGCT
TGATGGTGAAGATCACCCTAGACCTGCTCTCTCGGATACCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGGAAAGCAGAAGATAAACAGC
CGCCCGCAGGGAAGAAGCACAGCTCTGAGAAGAGGAGCTCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGAAAGGGTGAAGCAGAAAGAG
ACTGTGATAACAAGAAAATCAGACTGGAGAAGGAAATCAAATCACAGTCATCTTCATCTTCATCCTCCCACAAAGAATCTTCTAAAACAA
AGCCCTCCAGGCCCTCCTCACAGTCCTCAAAGAAGGAAATGCTCCCCCCGCCACCCGTGTCCTCGTCCTCCCAGAAGCCAGCCAAGCCTG
CACTTAAGAGGTCAAGGCGGGAAGCAGACACCTGTGGCCAGGACCCTCCCAAAAGTGCCAGCAGTACCAAGAGCAACCACAAAGACTCTT
CCATTCCCAAGCAGAGAAGAGTAGAGGGGAAGGGCTCCAGAAGCTCCTCGGAGCACAAGGGTTCTTCCGGAGATACTGCAAATCCTTTTC
CAGTGCCTTCTTTGCCAAATGGTAACTCTAAACCAGGGAAGCCTCAAGTGAAGTTTGACAAACAACAAGCAGACCTTCACATGAGGGAGG
CAAAAAAGATGAAGCAGAAAGCAGAGTTAATGACGGACAGGGTTGGAAAGGCTTTTAAGTACCTGGAAGCCGTCTTGTCCTTCATTGAGT
GCGGAATTGCCACAGAGTCTGAAAGCCAGTCATCCAAGTCAGCTTACTCTGTCTACTCAGAAACTGTAGATCTCATTAAATTCATAATGT
CATTAAAATCCTTCTCAGATGCCACAGCGCCAACACAAGAGAAAATATTTGCTGTTTTATGCATGCGTTGCCAGTCCATTTTGAACATGG
CGATGTTTCGTTGTAAAAAAGACATAGCAATAAAGTATTCTCGTACTCTTAATAAACACTTCGAGAGTTCTTCCAAAGTCGCCCAGGCAC
CTTCTCCATGCATTGCAAGCACAGGCACACCATCCCCTCTTTCCCCAATGCCTTCTCCTGCCAGCTCCGTAGGGTCCCAGTCAAGTGCTG
GCAGTGTGGGGAGCAGTGGGGTGGCTGCCACTATCAGCACCCCAGTCACCATCCAGAATATGACATCTTCCTATGTCACCATCACATCCC
ATGTTCTTACCGCCTTTGACCTTTGGGAACAGGCCGAGGCCCTCACGAGGAAGAATAAAGAATTCTTTGCTCGGCTCAGCACAAATGTGT
GCACCTTGGCCCTCAACAGCAGTTTGGTGGACCTGGTGCACTATACACGACAGGGTTTTCAGCAGCTACAAGAATTAACCAAAACACCTT
AATGGAGCCCCAGGTTGATTCAATGCCTTGGGAACTATTTTTGCACATTGGAAGCCTCAAAAACAGTCCAGACATTTGTTTCATCAGGAC
ACCAAACTCTAAAAAAGAAGCACCACGAGATGGCCAGGACATTTGTCCACTTAAACTCTCAACAACAGTGTGATCATTGGTTGGACACTG
TGGTTATGCAGAAGCAGAGATGAGGAGGCTGGCCCCAGAGATGATCTTGCCCTTCCTAACTAAAGGACAGAAGTGCAATTTAGCTTAAAT
GGGTGTATGAATGGTCTAGAAACATTTCTATTTTTTTTTTAAACCAGCAGGATACAAGTTGCAAATGAAATGAGGAGAAACAGTTTCAAC
TCTGAAAGTGAATTTCACGTCATCTCAGTAGCCACGCTAGTCCATTCCCAGAAGGAAATTTTTTTTTTTAACAATGACTTTTGGTAAAGG
GTTTTGTGGATGATTTTTTTTCTTTTGAGTTTTGGGAGAAATATTTGTTTAGTAACTTCTAATGGCCATCTGTAAACCATAAGTAATGAA
GGACTCCACTGTGCCCCACTTTCTGCCAATGAACAGTGGCTTGATAATACCAAGTATTGTTGTAATTTATAAAATTGAAGGCAACCCCCG
CTCCTGCCGCCCCCAATCTCCCCATTGCCTAGAGCGCTGCACATTGACCCCAGCTCTGACTTCTCATTACTGTGCTGAAAGTCAGCCCAC
GTCGGAGCGGTGAGGAGGAGCCACAGCACATGGGGTGCCACCTCGAGGTCTGCACAGGAGGACTTGGCGCTGCCATTTCCTACCCCTGCC
ATTTCCCACCCCTGCTTCAGCGAAAGGGACTCTCTAACAGGGCAGTCACTGTTGACTCTATTCTGAATTTCCTCCCTTGGGGAAGAAGGG
AACCAACATTTATACCTGACCAGATGGCTAAAGTGCTTTTAAAGTTTTGTTTAAGTAGAGCTGGAATTTGAGGTGCTGATCTGTGGTCTA
CAGTTATGTGGTAACTCATGTTGTCCAGCCAACTCAGAGTTTCGTCAGTGAACAAGAAACATGAAATCTGCTTCTTAGAGAGGCTATATT
TTTCTGCTACAAATATTTTATATTTATAGCAAAACTAGACTTTCAGAGTCCTTGATTGTCTAGGGGAAGTTAACTCCCTGAGAGGATGTA
GAGATTTGGGGTGGTTGATTAGACTTTTGAAAAACTCATCACCACATGCCTTCACTCCAGAGTGTTCTCAGCTAGATTTGATTTGGTTGA
GGAGGAACTGTGGCCCTCCGTAAGTTATTGCCATAGTGTATGCATTAAACCAAGTCCATTTTGAATGACCTAAAATGAAGTAACACAATC
AGAAATCCCATGTGCCCATAAGCACAGATTTTTCTTTTTCATTGAAACTTTAAAGGTTATTATTGGAAACATTACTTTGAGTGCAGTGTT
TTTAAAAGCCAATTCTTTTTTATCCCTTTTAGAAGTAGAATTTGCACACTTACTACAATTGAGGAGTGTCATCTCTATAACTTTTTCTCC
GCCTTTGTCCCATTCTGCCCCTGTACATGTTTCCTACCAAGCATGTTTCACATTTTCCTATTAGTGGAGGAGGGAGAACCATATTTATTT
ATAATGAAGACATCTAAGATCCCTATGATGAATGCAGGAACTCTCTTGGTAGTTTGTAAATACACAAAGGGATGTGTCGAGGGATGGGAG
CGATGCTTATCTCTCACAGTGTGAGTGGTCTGTGTGAGGCTGTTCCTTCAGTTTCTTCTCCAGACTGTTCTTTGGTTGTCACTAAGTCAG
AGGTCTGGTCCCTCATGTTTAGGTGAAAGCCAGAGAATGACAGCTGTAGTCATATCTGAGCATAAGACCTTGATGTGTGATTCCTGATGA
CCGGTTTCATTTATTCATGTTATAAAGCAAAGCCCTGGTCCTTTTTAAACTACTAGTTTTAAAAACCTGTGTTAAATGAACAGTAATTGC
CTGGTAGGTTTGGTGTGTGTGTAGCATTGTGTGTCCATCTGTTATATGTAAAGGACAAGGCACCAGAATCAGGCTTTATTTCGATATTGA
AGATGTTATTTAACATCTTTCTTTTTTCCTTACTCCCTTAGCCATCCCCTCCCCTTTTGTCCTATCATTCCCTAGAACAAGCCACCTGTC
AATTGTGAAGGGTTGTGTTCTTTATGGCAGGTTCTATGCAGATTGTGCCAGAGCATGTGCGTGTTCTGTTGGCAAGCCACAGTGCTCCCT
TGACTGAAGACATTTCCAGGTAGATTTCTCAGCCAGCTCTAAAACAGATTGCTTTTTCAGTGGCCTTACTCTTTGTGGGTTTTTTTTTTT
TTCTCTGAACTTGATATAAAGATTTTATTTGTCCCTTGAAAAAGTAACAAATGTGCATAGATCAATTTGTACTACTTTGGTCATTGGATA
TTTCTGATCCTTATTGCATTGTACCTAAAGGAGAGTAACTAATGGTAACCTTTTTAATAGAGTATGTGAAAGGTAGTGGCTGATGAATCC
TTAACGTTCATAGGGTCTTTTTGCTGTTACGGTTGTATATAGAGGTCTGAAGGATTTTTAAAATGATTTGCACTTTTTCACTGCATGCTT
ACAATTCCCAAAGGCAAAATCTGTACTGAGGTAGATCATTTGAAAGGGCTAGATTATAAAATTAAGCCTTAGAGTATGGAAAGTTCTTAT
AACAATAATAGTACACACTTCAGAGTAAGACAAATGCAAAGCATCTTAAGGAGTGAAAATAGAGTGTAAATCTTGCCTTTGGCACTACAA
GGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTCTTTAGTAGGAAATGGAAGAACACTGTTTTATTTTTTAAAGTGTTTAATGTTTCTGT
CCTTTCTGTGAATTATTGAATTTAAGAGCCCTGCTAAATAATGAAAAAACACTTTACTAAAATTTATCAAATTATACTGGGTTCGGATTG
TGAAAACATTGGCCACCTAGTAGCAGTGGTGAGGAGTGGGAGGGCCCAGCAAGCATTTATCAGAAATAGAATCACAATAGGAGGAGAATT
TGACTGTCTGATATTATGATTTGATTACAATACTGAATGGGAAAAGTATCTAATATTTTGTAACAAAAAGACCTTCATATTATCTGTTTT
GACCAAAATATGTAGCTATTTCCCTTACACAGATTGGACCGCACTTATCTCCCTTGTCCTGTATCCTTTAATTTCAGGTCTCAGGATGTT
TAGAAAGCTAAAACCCCCTACCCCTTTCTGGCTGAAAACTTGCCTTATTTGGTATCTTACACATTAATGTTACTAGCATCAGGAGCTTAC
TGTTTTATTATGATTCATCTTCAGTAATTTTTAGAAGCAAGAAGAAAGCCATTGTGTCCTCTACAATTAACAAAACTTATCTCTGATATA
CAAAGGGATATAAATATATACACTTAAATAGAGAAAAAGAGGTTGATTGAATTGTGCCTTTGAGTGAACCCAGTTTTTAAATACCGCTGT
GTTTGTTTCGCCATGGCTTCAGGGATGCTACATGGCTCTTGCACCTTTTACTCCTCTGCTTTATGAAGTTTGAGTTGTATTTGTGCATCT
TAAAGTAGGTTGAGGCTTGAGGCTGGGCTTTCGGGTTTTTTTGTTTTTTGTTTTGTTTTGTTTTGTTTTGTTTTCTTGTACTTAAACCTG
CTTGCTTCCTACCACAGATTCTTTATTTTCCCAAACACTACAAAAAAACTTTTAAAACTTTGCCATTTCATCTGTTTACACTCTTTGCCA
CTGATTAGCAGTATTTAAATCTTGCAAGAATATTTTGTGCTTTCTTTAGAAACACAAGAGTATAGATTTTTCTCACTGAAAAGTGAGAGT
TACGCATTGCAGCCATGAAGGGATGCTAGGATCAATTATGGCAGTACCTTTTTTCCCCTCCTGTTCTTGAGCCAGTTGTCTCTTTTGTTT
TGGGTCCCACTTAGGATTAATGGATGTAAGGTATTTTCCTGTGCCTTTATTTTGTGTCATTCTATTGGAAGGAGGTGTAACGGCAGAATA
GCATCGTGTTGGGGGTTTTCCTTCAAACACTGCAAGTGATATTGCCACCATGTGAACCTCAAATATGCAATCCAGTTGTGTTGGTTTCTC
GGTGACTTGGAGTGTTCATCTCTTCATGAATTGTGAGCACTGACCATGTTCTTCAGTTCTTAATTATGGTGAGTTGACAAATACCAACTA
CTGCTTTTCTTTAGGTGGCTATAAATTTCTTACTGTCAGGAGGAAATGACATTATATTCTGTTCCACTGAACGTCAGAGATCAGCAGGCA
CTGTACTGGGTAGAGAAGTGCCTATACTTCTCTACCTAAGAGGGCAGGAGGGAAACCCTACAGCTCCTTGTGAGCCTATATATTAGTATA
TCGGCCTGGAGAGGACAAGGGAATAAGACCACTCATAGTGAGGCTGGCCAAGCTGCACTGGTCGGACCAGGCAGTGGCTGACCTAAGGAA
GACAACTTGCTTTGCTTAAAAGTAGATTTTTTAAGCAATGCTTAACACAGGCAGCATTCACCTTTGTTCAGGCCATCGACATGTATTGTT
AAAATTACTGCATATCCCCCTCAGATATCAAGTATACACTGTTCATGTTGGGGTTGTGTGTGTGTATGTGTGTATGTACGCACGCATGTG
TCCCAAATCTTGTTTTAATTTTTTTTTTCTGAATGTGATCATGTTTTGGATGATACCTGAGCAGGGTTGCCTTTTTTTTATTTATTACCA
TTATATATTATATTATATTATATTATATATTTTTTGCTTTCTTATAACTTTGGAGGAAAGTCAAATCTTGGTATTATTAAAATTGTTTTA
AAAAGGAGTAAATTTTCCAGTTGATAAATGAAAATCACTGGCCTATGTTTAATAAGTTTTTCTTTAATTACTGTGGAATAACGTGCCAGC
TATCATCAACACAATGATTTTGTACATAGGGTAGGGAAGCAGTGATGCTCTCAATGGGAAGATGTGCAACACAAATTAAGGGGAACTCCA
TGTATTTTACCTACTTCAGCAATGGAACTGCAACTTGGGGCTTTGTGAATAAAATTTAGCTGCCTTGTATAGTCGTTTGAAAGAATATGT
GATCTGTGAGAGAATTATAGTTTTTTTTTAGAAGAAAAATCTGCAAAAGATCTTTCCAAAGACAATGTGCCACAGATCTTTTGTTCTCTG
TAATGAGGATTAATTGCTGTTTAAACAAAAATGTAATTGTTCATCTTTAAATTCTTTCCTTTTCATAAGAGGATCAAGCTGTAAAAAAAC

>In-frame_KMT2A_ENST00000534358_chr11_118353211_+_AFF1_ENST00000544085_chr4_88012943_+_6985nt
CTGCTTCACTTCACGGGGCGAACATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGG
GGCGCCGGGGCCTAGGGGGCGCCCCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGG
CGCCCCCCTCCCCCCCGGCTGTGGCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAG
CAGCCTCCTCGTCGTCCGCCTCGTCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCG
ACGCGGCGCTGCAGGTCTCGGCCGCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCG
GAGAGGATGAGCAATTCTTAGGTTTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTC
GAAAACCTCGTGGGAGACCTAGAAGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAG
AGACCAAATCTGGAGATAAGATCAAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAA
TCAAAATAACACATGGAAAGGACATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTA
CGTTTCAGCAAGCCACAAAGATTAAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAG
GAAGGAAGGGGGTACAAATTGTACGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTG
AACTGGAAAAGCCCCAGAAAGTCCGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTC
GAAGGATTAAGCCAGTTAGGATTATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGG
CTCAAAAGAAAATTGAAAAAGAAGCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTG
TTGTCAGTGCTATCTCCTCGCGGATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGAT
TAGAGTCTACACCGAATAGTAGATTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGT
CTTCAGACTCCTCTCGATCTAGTAGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGC
GGAGCGATACCCCTGAAGTTCATCCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAG
TGTCGGAGAGAAGTTTTGGATCTAGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTC
CACCTCTGCTGACTCCACCGCCACCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAG
CATCACCATTTTTGCCTGCTTCCACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAA
AGCATTCTAGGTCAGAGCCACAATACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGAC
CCCCTCCACTAACTCCCGAGGACGTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCC
ATTCTGGAACAAGGTTTGATATGCACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTG
AGTCTGTAACCTTGCCTAGTAATCGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTC
CTATTCGATCTGAACCAAGATCTCCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCC
CGTCTTCTGTCTCTTCCTCGTTAAGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCC
TGACTCAGTCTGGGGAATCTGCAGAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTA
CTCCTCTCTTCCCTTGGTTTACCCCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAG
ATGCTGACAAGAGCGTGGAGAAGGACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAA
GGAAAAAGGGATCAGAAATTCAGAGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCA
CTTCATCTTCTGCCAAAAAAGCAACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATA
CAACAGCTGTCAAAACCAAAATACTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCC
TGGAGAAGGAGAAAACCCTCTGCCTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGG
CAGACAAGCTTCCAATGACTGACAAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTC
TTAAACAAACCGACCAGCCCAAAGCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCA
GAAGAGCAGCTGTTGCCCTTGGCCGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAA
AGATTTTGTCTTCCATGGGGAATGATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTA
AACCTGTCACTAGAAACAAGGCACCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGG
TGCCTGAGGACTGTGGTGTTTGTACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAA
AATGTCAGAATCTACAATGGATGCCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCA
GTGAAAAGAAAGACAGCAAAGAGAGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTG
CCCCAAAGAAAAGCAGTAGTGAGCCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAAT
CCAAACAGGCCACCACTCCAGCTTCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAG
GACCGCCAAGAAAAGAAGTTCCCAAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCA
AACAGAAAAAAGTGGCTCCCCGCCCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGACTCTCAGCATGTCAGTTCTGTAACCCAAA
ACCAAAAACAATATGATACATCTTCAAAAACTCACTCAAATTCTCAGCAAGGAACGTCATCCATGCTCGAAGACGACCTTCAGCTCAGTG
ACAGTGAGGACAGTGACAGTGAACAAACCCCAGAGAAGCCTCCCTCCTCATCTGCACCTCCAAGTGCTCCACAGTCCCTTCCAGAACCAG
TGGCATCAGCACATTCCAGCAGTGCAGAGTCAGAAAGCACCAGTGACTCAGACAGTTCCTCAGACTCAGAGAGCGAGAGCAGTTCAAGTG
ACAGCGAAGAAAATGAGCCCCTAGAAACCCCAGCTCCGGAGCCTGAGCCTCCAACAACAAACAAATGGCAGCTGGACAACTGGCTGACCA
AAGTCAGCCAGCCAGCTGCGCCACCAGAGGGCCCCAGGAGCACAGAGCCCCCACGGCGGCACCCAGAGAGTAAGGGCAGCAGCGACAGTG
CCACGAGTCAGGAGCATTCTGAATCCAAAGATCCTCCCCCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCACCCGAAGCCCCCCACCCCG
GAAAGAGGAGCTGTCAGAAGTCTCCGGCACAGCAGGAGCCCCCACAAAGGCAAACCGTTGGAACCAAACAACCCAAAAAACCTGTCAAGG
CCTCTGCCCGGGCAGGTTCACGGACCAGCCTGCAGGGGGAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCCCGAGACCAGACTTCCAAAG
ACAAGCCCAAGGTGAAGACGAAAGGACGGCCCCGGGCCGCAGCAAGCAACGAACCCAAGCCAGCAGTGCCCCCCTCCAGTGAGAAGAAGA
AGCACAAGAGCTCCCTCCCTGCCCCCTCTAAGGCTCTCTCAGGCCCAGAACCCGCGAAGGACAATGTGGAGGACAGGACCCCTGAGCACT
TTGCTCTTGTTCCCCTGACTGAGAGCCAGGGCCCACCCCACAGTGGCAGCGGCAGCAGGACTAGTGGCTGCCGCCAAGCCGTGGTGGTCC
AGGAGGACAGCCGCAAAGACAGACTCCCATTGCCTTTGAGAGACACCAAGCTGCTCTCACCGCTCAGGGACACTCCTCCCCCACAAAGCT
TGATGGTGAAGATCACCCTAGACCTGCTCTCTCGGATACCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGGAAAGCAGAAGATAAACAGC
CGCCCGCAGGGAAGAAGCACAGCTCTGAGAAGAGGAGCTCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGAAAGGGTGAAGCAGAAAGAG
ACTGTGATAACAAGAAAATCAGACTGGAGAAGGAAATCAAATCACAGTCATCTTCATCTTCATCCTCCCACAAAGAATCTTCTAAAACAA
AGCCCTCCAGGCCCTCCTCACAGTCCTCAAAGAAGGAAATGCTCCCCCCGCCACCCGTGTCCTCGTCCTCCCAGAAGCCAGCCAAGCCTG
CACTTAAGAGGTCAAGGCGGGAAGCAGACACCTGTGGCCAGGACCCTCCCAAAAGTGCCAGCAGTACCAAGAGCAACCACAAAGACTCTT
CCATTCCCAAGCAGAGAAGAGTAGAGGGGAAGGGCTCCAGAAGCTCCTCGGAGCACAAGGGTTCTTCCGGAGATACTGCAAATCCTTTTC
CAGTGCCTTCTTTGCCAAATGGTAACTCTAAACCAGGGAAGCCTCAAGTGAAGTTTGACAAACAACAAGCAGACCTTCACATGAGGGAGG
CAAAAAAGATGAAGCAGAAAGCAGAGTTAATGACGGACAGGGTTGGAAAGGCTTTTAAGTACCTGGAAGCCGTCTTGTCCTTCATTGAGT
GCGGAATTGCCACAGAGTCTGAAAGCCAGTCATCCAAGTCAGCTTACTCTGTCTACTCAGAAACTGTAGATCTCATTAAATTCATAATGT
CATTAAAATCCTTCTCAGATGCCACAGCGCCAACACAAGAGAAAATATTTGCTGTTTTATGCATGCGTTGCCAGTCCATTTTGAACATGG
CGATGTTTCGTTGTAAAAAAGACATAGCAATAAAGTATTCTCGTACTCTTAATAAACACTTCGAGAGTTCTTCCAAAGTCGCCCAGGCAC
CTTCTCCATGCATTGCAAGAAGCACAGGCACACCATCCCCTCTTTCCCCAATGCCTTCTCCTGCCAGCTCCGTAGGGTCCCAGTCAAGTG
CTGGCAGTGTGGGGAGCAGTGGGGTGGCTGCCACTATCAGCACCCCAGTCACCATCCAGAATATGACATCTTCCTATGTCACCATCACAT
CCCATGTTCTTACCGCCTTTGACCTTTGGGAACAGGCCGAGGCCCTCACGAGGAAGAATAAAGAATTCTTTGCTCGGCTCAGCACAAATG
TGTGCACCTTGGCCCTCAACAGCAGTTTGGTGGACCTGGTGCACTATACACGACAGGGTTTTCAGCAGCTACAAGAATTAACCAAAACAC
CTTAATGGAGCCCCAGGTTGATTCAATGCCTTGGGAACTATTTTTGCACATTGGAAGCCTCAAAAACAGTCCAGACATTTGTTTCATCAG
GACACCAAACTCTAAAAAAGAAGCACCACGAGATGGCCAGGACATTTGTCCACTTAAACTCTCAACAACAGTGTGATCATTGGTTGGACA
CTGTGGTTATGCAGAAGCAGAGATGAGGAGGCTGGCCCCAGAGATGATCTTGCCCTTCCTAACTAAAGGACAGAAGTGCAATTTAGCTTA
AATGGGTGTATGAATGGTCTAGAAACATTTCTATTTTTTTTTTAAACCAGCAGGATACAAGTTGCAAATGAAATGAGGAGAAACAGTTTC

>In-frame_KMT2A_ENST00000389506_chr11_118353211_+_AFF1_ENST00000395146_chr4_88012943_+_11905nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGACTCTCAGCATGTCAGTTCTGTAACCCAAAACCAAAAACAATATGATACATCT
TCAAAAACTCACTCAAATTCTCAGCAAGGAACGTCATCCATGCTCGAAGACGACCTTCAGCTCAGTGACAGTGAGGACAGTGACAGTGAA
CAAACCCCAGAGAAGCCTCCCTCCTCATCTGCACCTCCAAGTGCTCCACAGTCCCTTCCAGAACCAGTGGCATCAGCACATTCCAGCAGT
GCAGAGTCAGAAAGCACCAGTGACTCAGACAGTTCCTCAGACTCAGAGAGCGAGAGCAGTTCAAGTGACAGCGAAGAAAATGAGCCCCTA
GAAACCCCAGCTCCGGAGCCTGAGCCTCCAACAACAAACAAATGGCAGCTGGACAACTGGCTGACCAAAGTCAGCCAGCCAGCTGCGCCA
CCAGAGGGCCCCAGGAGCACAGAGCCCCCACGGCGGCACCCAGAGAGTAAGGGCAGCAGCGACAGTGCCACGAGTCAGGAGCATTCTGAA
TCCAAAGATCCTCCCCCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCACCCGAAGCCCCCCACCCCGGAAAGAGGAGCTGTCAGAAGTCT
CCGGCACAGCAGGAGCCCCCACAAAGGCAAACCGTTGGAACCAAACAACCCAAAAAACCTGTCAAGGCCTCTGCCCGGGCAGGTTCACGG
ACCAGCCTGCAGGGGGAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCCCGAGACCAGACTTCCAAAGACAAGCCCAAGGTGAAGACGAAA
GGACGGCCCCGGGCCGCAGCAAGCAACGAACCCAAGCCAGCAGTGCCCCCCTCCAGTGAGAAGAAGAAGCACAAGAGCTCCCTCCCTGCC
CCCTCTAAGGCTCTCTCAGGCCCAGAACCCGCGAAGGACAATGTGGAGGACAGGACCCCTGAGCACTTTGCTCTTGTTCCCCTGACTGAG
AGCCAGGGCCCACCCCACAGTGGCAGCGGCAGCAGGACTAGTGGCTGCCGCCAAGCCGTGGTGGTCCAGGAGGACAGCCGCAAAGACAGA
CTCCCATTGCCTTTGAGAGACACCAAGCTGCTCTCACCGCTCAGGGACACTCCTCCCCCACAAAGCTTGATGGTGAAGATCACCCTAGAC
CTGCTCTCTCGGATACCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGGAAAGCAGAAGATAAACAGCCGCCCGCAGGGAAGAAGCACAGC
TCTGAGAAGAGGAGCTCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGAAAGGGTGAAGCAGAAAGAGACTGTGATAACAAGAAAATCAGA
CTGGAGAAGGAAATCAAATCACAGTCATCTTCATCTTCATCCTCCCACAAAGAATCTTCTAAAACAAAGCCCTCCAGGCCCTCCTCACAG
TCCTCAAAGAAGGAAATGCTCCCCCCGCCACCCGTGTCCTCGTCCTCCCAGAAGCCAGCCAAGCCTGCACTTAAGAGGTCAAGGCGGGAA
GCAGACACCTGTGGCCAGGACCCTCCCAAAAGTGCCAGCAGTACCAAGAGCAACCACAAAGACTCTTCCATTCCCAAGCAGAGAAGAGTA
GAGGGGAAGGGCTCCAGAAGCTCCTCGGAGCACAAGGGTTCTTCCGGAGATACTGCAAATCCTTTTCCAGTGCCTTCTTTGCCAAATGGT
AACTCTAAACCAGGGAAGCCTCAAGTGAAGTTTGACAAACAACAAGCAGACCTTCACATGAGGGAGGCAAAAAAGATGAAGCAGAAAGCA
GAGTTAATGACGGACAGGGTTGGAAAGGCTTTTAAGTACCTGGAAGCCGTCTTGTCCTTCATTGAGTGCGGAATTGCCACAGAGTCTGAA
AGCCAGTCATCCAAGTCAGCTTACTCTGTCTACTCAGAAACTGTAGATCTCATTAAATTCATAATGTCATTAAAATCCTTCTCAGATGCC
ACAGCGCCAACACAAGAGAAAATATTTGCTGTTTTATGCATGCGTTGCCAGTCCATTTTGAACATGGCGATGTTTCGTTGTAAAAAAGAC
ATAGCAATAAAGTATTCTCGTACTCTTAATAAACACTTCGAGAGTTCTTCCAAAGTCGCCCAGGCACCTTCTCCATGCATTGCAAGAAGC
ACAGGCACACCATCCCCTCTTTCCCCAATGCCTTCTCCTGCCAGCTCCGTAGGGTCCCAGTCAAGTGCTGGCAGTGTGGGGAGCAGTGGG
GTGGCTGCCACTATCAGCACCCCAGTCACCATCCAGAATATGACATCTTCCTATGTCACCATCACATCCCATGTTCTTACCGCCTTTGAC
CTTTGGGAACAGGCCGAGGCCCTCACGAGGAAGAATAAAGAATTCTTTGCTCGGCTCAGCACAAATGTGTGCACCTTGGCCCTCAACAGC
AGTTTGGTGGACCTGGTGCACTATACACGACAGGGTTTTCAGCAGCTACAAGAATTAACCAAAACACCTTAATGGAGCCCCAGGTTGATT
CAATGCCTTGGGAACTATTTTTGCACATTGGAAGCCTCAAAAACAGTCCAGACATTTGTTTCATCAGGACACCAAACTCTAAAAAAGAAG
CACCACGAGATGGCCAGGACATTTGTCCACTTAAACTCTCAACAACAGTGTGATCATTGGTTGGACACTGTGGTTATGCAGAAGCAGAGA
TGAGGAGGCTGGCCCCAGAGATGATCTTGCCCTTCCTAACTAAAGGACAGAAGTGCAATTTAGCTTAAATGGGTGTATGAATGGTCTAGA
AACATTTCTATTTTTTTTTTAAACCAGCAGGATACAAGTTGCAAATGAAATGAGGAGAAACAGTTTCAACTCTGAAAGTGAATTTCACGT
CATCTCAGTAGCCACGCTAGTCCATTCCCAGAAGGAAATTTTTTTTTTTAACAATGACTTTTGGTAAAGGGTTTTGTGGATGATTTTTTT
TCTTTTGAGTTTTGGGAGAAATATTTGTTTAGTAACTTCTAATGGCCATCTGTAAACCATAAGTAATGAAGGACTCCACTGTGCCCCACT
TTCTGCCAATGAACAGTGGCTTGATAATACCAAGTATTGTTGTAATTTATAAAATTGAAGGCAACCCCCGCTCCTGCCGCCCCCAATCTC
CCCATTGCCTAGAGCGCTGCACATTGACCCCAGCTCTGACTTCTCATTACTGTGCTGAAAGTCAGCCCACGTCGGAGCGGTGAGGAGGAG
CCACAGCACATGGGGTGCCACCTCGAGGTCTGCACAGGAGGACTTGGCGCTGCCATTTCCTACCCCTGCCATTTCCCACCCCTGCTTCAG
CGAAAGGGACTCTCTAACAGGGCAGTCACTGTTGACTCTATTCTGAATTTCCTCCCTTGGGGAAGAAGGGAACCAACATTTATACCTGAC
CAGATGGCTAAAGTGCTTTTAAAGTTTTGTTTAAGTAGAGCTGGAATTTGAGGTGCTGATCTGTGGTCTACAGTTATGTGGTAACTCATG
TTGTCCAGCCAACTCAGAGTTTCGTCAGTGAACAAGAAACATGAAATCTGCTTCTTAGAGAGGCTATATTTTTCTGCTACAAATATTTTA
TATTTATAGCAAAACTAGACTTTCAGAGTCCTTGATTGTCTAGGGGAAGTTAACTCCCTGAGAGGATGTAGAGATTTGGGGTGGTTGATT
AGACTTTTGAAAAACTCATCACCACATGCCTTCACTCCAGAGTGTTCTCAGCTAGATTTGATTTGGTTGAGGAGGAACTGTGGCCCTCCG
TAAGTTATTGCCATAGTGTATGCATTAAACCAAGTCCATTTTGAATGACCTAAAATGAAGTAACACAATCAGAAATCCCATGTGCCCATA
AGCACAGATTTTTCTTTTTCATTGAAACTTTAAAGGTTATTATTGGAAACATTACTTTGAGTGCAGTGTTTTTAAAAGCCAATTCTTTTT
TATCCCTTTTAGAAGTAGAATTTGCACACTTACTACAATTGAGGAGTGTCATCTCTATAACTTTTTCTCCGCCTTTGTCCCATTCTGCCC
CTGTACATGTTTCCTACCAAGCATGTTTCACATTTTCCTATTAGTGGAGGAGGGAGAACCATATTTATTTATAATGAAGACATCTAAGAT
CCCTATGATGAATGCAGGAACTCTCTTGGTAGTTTGTAAATACACAAAGGGATGTGTCGAGGGATGGGAGCGATGCTTATCTCTCACAGT
GTGAGTGGTCTGTGTGAGGCTGTTCCTTCAGTTTCTTCTCCAGACTGTTCTTTGGTTGTCACTAAGTCAGAGGTCTGGTCCCTCATGTTT
AGGTGAAAGCCAGAGAATGACAGCTGTAGTCATATCTGAGCATAAGACCTTGATGTGTGATTCCTGATGACCGGTTTCATTTATTCATGT
TATAAAGCAAAGCCCTGGTCCTTTTTAAACTACTAGTTTTAAAAACCTGTGTTAAATGAACAGTAATTGCCTGGTAGGTTTGGTGTGTGT
GTAGCATTGTGTGTCCATCTGTTATATGTAAAGGACAAGGCACCAGAATCAGGCTTTATTTCGATATTGAAGATGTTATTTAACATCTTT
CTTTTTTCCTTACTCCCTTAGCCATCCCCTCCCCTTTTGTCCTATCATTCCCTAGAACAAGCCACCTGTCAATTGTGAAGGGTTGTGTTC
TTTATGGCAGGTTCTATGCAGATTGTGCCAGAGCATGTGCGTGTTCTGTTGGCAAGCCACAGTGCTCCCTTGACTGAAGACATTTCCAGG
TAGATTTCTCAGCCAGCTCTAAAACAGATTGCTTTTTCAGTGGCCTTACTCTTTGTGGGTTTTTTTTTTTTTCTCTGAACTTGATATAAA
GATTTTATTTGTCCCTTGAAAAAGTAACAAATGTGCATAGATCAATTTGTACTACTTTGGTCATTGGATATTTCTGATCCTTATTGCATT
GTACCTAAAGGAGAGTAACTAATGGTAACCTTTTTAATAGAGTATGTGAAAGGTAGTGGCTGATGAATCCTTAACGTTCATAGGGTCTTT
TTGCTGTTACGGTTGTATATAGAGGTCTGAAGGATTTTTAAAATGATTTGCACTTTTTCACTGCATGCTTACAATTCCCAAAGGCAAAAT
CTGTACTGAGGTAGATCATTTGAAAGGGCTAGATTATAAAATTAAGCCTTAGAGTATGGAAAGTTCTTATAACAATAATAGTACACACTT
CAGAGTAAGACAAATGCAAAGCATCTTAAGGAGTGAAAATAGAGTGTAAATCTTGCCTTTGGCACTACAAGGTGTGTGTGTGTGTGTGTG
TGTGTGTGTGTGTCTTTAGTAGGAAATGGAAGAACACTGTTTTATTTTTTAAAGTGTTTAATGTTTCTGTCCTTTCTGTGAATTATTGAA
TTTAAGAGCCCTGCTAAATAATGAAAAAACACTTTACTAAAATTTATCAAATTATACTGGGTTCGGATTGTGAAAACATTGGCCACCTAG
TAGCAGTGGTGAGGAGTGGGAGGGCCCAGCAAGCATTTATCAGAAATAGAATCACAATAGGAGGAGAATTTGACTGTCTGATATTATGAT
TTGATTACAATACTGAATGGGAAAAGTATCTAATATTTTGTAACAAAAAGACCTTCATATTATCTGTTTTGACCAAAATATGTAGCTATT
TCCCTTACACAGATTGGACCGCACTTATCTCCCTTGTCCTGTATCCTTTAATTTCAGGTCTCAGGATGTTTAGAAAGCTAAAACCCCCTA
CCCCTTTCTGGCTGAAAACTTGCCTTATTTGGTATCTTACACATTAATGTTACTAGCATCAGGAGCTTACTGTTTTATTATGATTCATCT
TCAGTAATTTTTAGAAGCAAGAAGAAAGCCATTGTGTCCTCTACAATTAACAAAACTTATCTCTGATATACAAAGGGATATAAATATATA
CACTTAAATAGAGAAAAAGAGGTTGATTGAATTGTGCCTTTGAGTGAACCCAGTTTTTAAATACCGCTGTGTTTGTTTCGCCATGGCTTC
AGGGATGCTACATGGCTCTTGCACCTTTTACTCCTCTGCTTTATGAAGTTTGAGTTGTATTTGTGCATCTTAAAGTAGGTTGAGGCTTGA
GGCTGGGCTTTCGGGTTTTTTTGTTTTTTGTTTTGTTTTGTTTTGTTTTGTTTTCTTGTACTTAAACCTGCTTGCTTCCTACCACAGATT
CTTTATTTTCCCAAACACTACAAAAAAACTTTTAAAACTTTGCCATTTCATCTGTTTACACTCTTTGCCACTGATTAGCAGTATTTAAAT
CTTGCAAGAATATTTTGTGCTTTCTTTAGAAACACAAGAGTATAGATTTTTCTCACTGAAAAGTGAGAGTTACGCATTGCAGCCATGAAG
GGATGCTAGGATCAATTATGGCAGTACCTTTTTTCCCCTCCTGTTCTTGAGCCAGTTGTCTCTTTTGTTTTGGGTCCCACTTAGGATTAA
TGGATGTAAGGTATTTTCCTGTGCCTTTATTTTGTGTCATTCTATTGGAAGGAGGTGTAACGGCAGAATAGCATCGTGTTGGGGGTTTTC
CTTCAAACACTGCAAGTGATATTGCCACCATGTGAACCTCAAATATGCAATCCAGTTGTGTTGGTTTCTCGGTGACTTGGAGTGTTCATC
TCTTCATGAATTGTGAGCACTGACCATGTTCTTCAGTTCTTAATTATGGTGAGTTGACAAATACCAACTACTGCTTTTCTTTAGGTGGCT
ATAAATTTCTTACTGTCAGGAGGAAATGACATTATATTCTGTTCCACTGAACGTCAGAGATCAGCAGGCACTGTACTGGGTAGAGAAGTG
CCTATACTTCTCTACCTAAGAGGGCAGGAGGGAAACCCTACAGCTCCTTGTGAGCCTATATATTAGTATATCGGCCTGGAGAGGACAAGG
GAATAAGACCACTCATAGTGAGGCTGGCCAAGCTGCACTGGTCGGACCAGGCAGTGGCTGACCTAAGGAAGACAACTTGCTTTGCTTAAA
AGTAGATTTTTTAAGCAATGCTTAACACAGGCAGCATTCACCTTTGTTCAGGCCATCGACATGTATTGTTAAAATTACTGCATATCCCCC
TCAGATATCAAGTATACACTGTTCATGTTGGGGTTGTGTGTGTGTATGTGTGTATGTACGCACGCATGTGTCCCAAATCTTGTTTTAATT
TTTTTTTTCTGAATGTGATCATGTTTTGGATGATACCTGAGCAGGGTTGCCTTTTTTTTATTTATTACCATTATATATTATATTATATTA
TATTATATATTTTTTGCTTTCTTATAACTTTGGAGGAAAGTCAAATCTTGGTATTATTAAAATTGTTTTAAAAAGGAGTAAATTTTCCAG
TTGATAAATGAAAATCACTGGCCTATGTTTAATAAGTTTTTCTTTAATTACTGTGGAATAACGTGCCAGCTATCATCAACACAATGATTT
TGTACATAGGGTAGGGAAGCAGTGATGCTCTCAATGGGAAGATGTGCAACACAAATTAAGGGGAACTCCATGTATTTTACCTACTTCAGC
AATGGAACTGCAACTTGGGGCTTTGTGAATAAAATTTAGCTGCCTTGTATAGTCGTTTGAAAGAATATGTGATCTGTGAGAGAATTATAG
TTTTTTTTTAGAAGAAAAATCTGCAAAAGATCTTTCCAAAGACAATGTGCCACAGATCTTTTGTTCTCTGTAATGAGGATTAATTGCTGT
TTAAACAAAAATGTAATTGTTCATCTTTAAATTCTTTCCTTTTCATAAGAGGATCAAGCTGTAAAAAAACAAAAAAATTAATAAAAATTT

>In-frame_KMT2A_ENST00000389506_chr11_118353211_+_AFF1_ENST00000307808_chr4_88012943_+_11886nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGACTCTCAGCATGTCAGTTCTGTAACCCAAAACCAAAAACAATATGATACATCT
TCAAAAACTCACTCAAATTCTCAGCAAGGAACGTCATCCATGCTCGAAGACGACCTTCAGCTCAGTGACAGTGAGGACAGTGACAGTGAA
CAAACCCCAGAGAAGCCTCCCTCCTCATCTGCACCTCCAAGTGCTCCACAGTCCCTTCCAGAACCAGTGGCATCAGCACATTCCAGCAGT
GCAGAGTCAGAAAGCACCAGTGACTCAGACAGTTCCTCAGACTCAGAGAGCGAGAGCAGTTCAAGTGACAGCGAAGAAAATGAGCCCCTA
GAAACCCCAGCTCCGGAGCCTGAGCCTCCAACAACAAACAAATGGCAGCTGGACAACTGGCTGACCAAAGTCAGCCAGCCAGCTGCGCCA
CCAGAGGGCCCCAGGAGCACAGAGCCCCCACGGCGGCACCCAGAGAGTAAGGGCAGCAGCGACAGTGCCACGAGTCAGGAGCATTCTGAA
TCCAAAGATCCTCCCCCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCACCCGAAGCCCCCCACCCCGGAAAGAGGAGCTGTCAGAAGTCT
CCGGCACAGCAGGAGCCCCCACAAAGGCAAACCGTTGGAACCAAACAACCCAAAAAACCTGTCAAGGCCTCTGCCCGGGCAGGTTCACGG
ACCAGCCTGCAGGGGGAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCCCGAGACCAGACTTCCAAAGACAAGCCCAAGGTGAAGACGAAA
GGACGGCCCCGGGCCGCAGCAAGCAACGAACCCAAGCCAGCAGTGCCCCCCTCCAGTGAGAAGAAGAAGCACAAGAGCTCCCTCCCTGCC
CCCTCTAAGGCTCTCTCAGGCCCAGAACCCGCGAAGGACAATGTGGAGGACAGGACCCCTGAGCACTTTGCTCTTGTTCCCCTGACTGAG
AGCCAGGGCCCACCCCACAGTGGCAGCGGCAGCAGGACTAGTGGCTGCCGCCAAGCCGTGGTGGTCCAGGAGGACAGCCGCAAAGACAGA
CTCCCATTGCCTTTGAGAGACACCAAGCTGCTCTCACCGCTCAGGGACACTCCTCCCCCACAAAGCTTGATGGTGAAGATCACCCTAGAC
CTGCTCTCTCGGATACCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGGAAAGCAGAAGATAAACAGCCGCCCGCAGGGAAGAAGCACAGC
TCTGAGAAGAGGAGCTCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGAAAGGGTGAAGCAGAAAGAGACTGTGATAACAAGAAAATCAGA
CTGGAGAAGGAAATCAAATCACAGTCATCTTCATCTTCATCCTCCCACAAAGAATCTTCTAAAACAAAGCCCTCCAGGCCCTCCTCACAG
TCCTCAAAGAAGGAAATGCTCCCCCCGCCACCCGTGTCCTCGTCCTCCCAGAAGCCAGCCAAGCCTGCACTTAAGAGGTCAAGGCGGGAA
GCAGACACCTGTGGCCAGGACCCTCCCAAAAGTGCCAGCAGTACCAAGAGCAACCACAAAGACTCTTCCATTCCCAAGCAGAGAAGAGTA
GAGGGGAAGGGCTCCAGAAGCTCCTCGGAGCACAAGGGTTCTTCCGGAGATACTGCAAATCCTTTTCCAGTGCCTTCTTTGCCAAATGGT
AACTCTAAACCAGGGAAGCCTCAAGTGAAGTTTGACAAACAACAAGCAGACCTTCACATGAGGGAGGCAAAAAAGATGAAGCAGAAAGCA
GAGTTAATGACGGACAGGGTTGGAAAGGCTTTTAAGTACCTGGAAGCCGTCTTGTCCTTCATTGAGTGCGGAATTGCCACAGAGTCTGAA
AGCCAGTCATCCAAGTCAGCTTACTCTGTCTACTCAGAAACTGTAGATCTCATTAAATTCATAATGTCATTAAAATCCTTCTCAGATGCC
ACAGCGCCAACACAAGAGAAAATATTTGCTGTTTTATGCATGCGTTGCCAGTCCATTTTGAACATGGCGATGTTTCGTTGTAAAAAAGAC
ATAGCAATAAAGTATTCTCGTACTCTTAATAAACACTTCGAGAGTTCTTCCAAAGTCGCCCAGGCACCTTCTCCATGCATTGCAAGCACA
GGCACACCATCCCCTCTTTCCCCAATGCCTTCTCCTGCCAGCTCCGTAGGGTCCCAGTCAAGTGCTGGCAGTGTGGGGAGCAGTGGGGTG
GCTGCCACTATCAGCACCCCAGTCACCATCCAGAATATGACATCTTCCTATGTCACCATCACATCCCATGTTCTTACCGCCTTTGACCTT
TGGGAACAGGCCGAGGCCCTCACGAGGAAGAATAAAGAATTCTTTGCTCGGCTCAGCACAAATGTGTGCACCTTGGCCCTCAACAGCAGT
TTGGTGGACCTGGTGCACTATACACGACAGGGTTTTCAGCAGCTACAAGAATTAACCAAAACACCTTAATGGAGCCCCAGGTTGATTCAA
TGCCTTGGGAACTATTTTTGCACATTGGAAGCCTCAAAAACAGTCCAGACATTTGTTTCATCAGGACACCAAACTCTAAAAAAGAAGCAC
CACGAGATGGCCAGGACATTTGTCCACTTAAACTCTCAACAACAGTGTGATCATTGGTTGGACACTGTGGTTATGCAGAAGCAGAGATGA
GGAGGCTGGCCCCAGAGATGATCTTGCCCTTCCTAACTAAAGGACAGAAGTGCAATTTAGCTTAAATGGGTGTATGAATGGTCTAGAAAC
ATTTCTATTTTTTTTTTAAACCAGCAGGATACAAGTTGCAAATGAAATGAGGAGAAACAGTTTCAACTCTGAAAGTGAATTTCACGTCAT
CTCAGTAGCCACGCTAGTCCATTCCCAGAAGGAAATTTTTTTTTTTAACAATGACTTTTGGTAAAGGGTTTTGTGGATGATTTTTTTTCT
TTTGAGTTTTGGGAGAAATATTTGTTTAGTAACTTCTAATGGCCATCTGTAAACCATAAGTAATGAAGGACTCCACTGTGCCCCACTTTC
TGCCAATGAACAGTGGCTTGATAATACCAAGTATTGTTGTAATTTATAAAATTGAAGGCAACCCCCGCTCCTGCCGCCCCCAATCTCCCC
ATTGCCTAGAGCGCTGCACATTGACCCCAGCTCTGACTTCTCATTACTGTGCTGAAAGTCAGCCCACGTCGGAGCGGTGAGGAGGAGCCA
CAGCACATGGGGTGCCACCTCGAGGTCTGCACAGGAGGACTTGGCGCTGCCATTTCCTACCCCTGCCATTTCCCACCCCTGCTTCAGCGA
AAGGGACTCTCTAACAGGGCAGTCACTGTTGACTCTATTCTGAATTTCCTCCCTTGGGGAAGAAGGGAACCAACATTTATACCTGACCAG
ATGGCTAAAGTGCTTTTAAAGTTTTGTTTAAGTAGAGCTGGAATTTGAGGTGCTGATCTGTGGTCTACAGTTATGTGGTAACTCATGTTG
TCCAGCCAACTCAGAGTTTCGTCAGTGAACAAGAAACATGAAATCTGCTTCTTAGAGAGGCTATATTTTTCTGCTACAAATATTTTATAT
TTATAGCAAAACTAGACTTTCAGAGTCCTTGATTGTCTAGGGGAAGTTAACTCCCTGAGAGGATGTAGAGATTTGGGGTGGTTGATTAGA
CTTTTGAAAAACTCATCACCACATGCCTTCACTCCAGAGTGTTCTCAGCTAGATTTGATTTGGTTGAGGAGGAACTGTGGCCCTCCGTAA
GTTATTGCCATAGTGTATGCATTAAACCAAGTCCATTTTGAATGACCTAAAATGAAGTAACACAATCAGAAATCCCATGTGCCCATAAGC
ACAGATTTTTCTTTTTCATTGAAACTTTAAAGGTTATTATTGGAAACATTACTTTGAGTGCAGTGTTTTTAAAAGCCAATTCTTTTTTAT
CCCTTTTAGAAGTAGAATTTGCACACTTACTACAATTGAGGAGTGTCATCTCTATAACTTTTTCTCCGCCTTTGTCCCATTCTGCCCCTG
TACATGTTTCCTACCAAGCATGTTTCACATTTTCCTATTAGTGGAGGAGGGAGAACCATATTTATTTATAATGAAGACATCTAAGATCCC
TATGATGAATGCAGGAACTCTCTTGGTAGTTTGTAAATACACAAAGGGATGTGTCGAGGGATGGGAGCGATGCTTATCTCTCACAGTGTG
AGTGGTCTGTGTGAGGCTGTTCCTTCAGTTTCTTCTCCAGACTGTTCTTTGGTTGTCACTAAGTCAGAGGTCTGGTCCCTCATGTTTAGG
TGAAAGCCAGAGAATGACAGCTGTAGTCATATCTGAGCATAAGACCTTGATGTGTGATTCCTGATGACCGGTTTCATTTATTCATGTTAT
AAAGCAAAGCCCTGGTCCTTTTTAAACTACTAGTTTTAAAAACCTGTGTTAAATGAACAGTAATTGCCTGGTAGGTTTGGTGTGTGTGTA
GCATTGTGTGTCCATCTGTTATATGTAAAGGACAAGGCACCAGAATCAGGCTTTATTTCGATATTGAAGATGTTATTTAACATCTTTCTT
TTTTCCTTACTCCCTTAGCCATCCCCTCCCCTTTTGTCCTATCATTCCCTAGAACAAGCCACCTGTCAATTGTGAAGGGTTGTGTTCTTT
ATGGCAGGTTCTATGCAGATTGTGCCAGAGCATGTGCGTGTTCTGTTGGCAAGCCACAGTGCTCCCTTGACTGAAGACATTTCCAGGTAG
ATTTCTCAGCCAGCTCTAAAACAGATTGCTTTTTCAGTGGCCTTACTCTTTGTGGGTTTTTTTTTTTTTCTCTGAACTTGATATAAAGAT
TTTATTTGTCCCTTGAAAAAGTAACAAATGTGCATAGATCAATTTGTACTACTTTGGTCATTGGATATTTCTGATCCTTATTGCATTGTA
CCTAAAGGAGAGTAACTAATGGTAACCTTTTTAATAGAGTATGTGAAAGGTAGTGGCTGATGAATCCTTAACGTTCATAGGGTCTTTTTG
CTGTTACGGTTGTATATAGAGGTCTGAAGGATTTTTAAAATGATTTGCACTTTTTCACTGCATGCTTACAATTCCCAAAGGCAAAATCTG
TACTGAGGTAGATCATTTGAAAGGGCTAGATTATAAAATTAAGCCTTAGAGTATGGAAAGTTCTTATAACAATAATAGTACACACTTCAG
AGTAAGACAAATGCAAAGCATCTTAAGGAGTGAAAATAGAGTGTAAATCTTGCCTTTGGCACTACAAGGTGTGTGTGTGTGTGTGTGTGT
GTGTGTGTGTCTTTAGTAGGAAATGGAAGAACACTGTTTTATTTTTTAAAGTGTTTAATGTTTCTGTCCTTTCTGTGAATTATTGAATTT
AAGAGCCCTGCTAAATAATGAAAAAACACTTTACTAAAATTTATCAAATTATACTGGGTTCGGATTGTGAAAACATTGGCCACCTAGTAG
CAGTGGTGAGGAGTGGGAGGGCCCAGCAAGCATTTATCAGAAATAGAATCACAATAGGAGGAGAATTTGACTGTCTGATATTATGATTTG
ATTACAATACTGAATGGGAAAAGTATCTAATATTTTGTAACAAAAAGACCTTCATATTATCTGTTTTGACCAAAATATGTAGCTATTTCC
CTTACACAGATTGGACCGCACTTATCTCCCTTGTCCTGTATCCTTTAATTTCAGGTCTCAGGATGTTTAGAAAGCTAAAACCCCCTACCC
CTTTCTGGCTGAAAACTTGCCTTATTTGGTATCTTACACATTAATGTTACTAGCATCAGGAGCTTACTGTTTTATTATGATTCATCTTCA
GTAATTTTTAGAAGCAAGAAGAAAGCCATTGTGTCCTCTACAATTAACAAAACTTATCTCTGATATACAAAGGGATATAAATATATACAC
TTAAATAGAGAAAAAGAGGTTGATTGAATTGTGCCTTTGAGTGAACCCAGTTTTTAAATACCGCTGTGTTTGTTTCGCCATGGCTTCAGG
GATGCTACATGGCTCTTGCACCTTTTACTCCTCTGCTTTATGAAGTTTGAGTTGTATTTGTGCATCTTAAAGTAGGTTGAGGCTTGAGGC
TGGGCTTTCGGGTTTTTTTGTTTTTTGTTTTGTTTTGTTTTGTTTTGTTTTCTTGTACTTAAACCTGCTTGCTTCCTACCACAGATTCTT
TATTTTCCCAAACACTACAAAAAAACTTTTAAAACTTTGCCATTTCATCTGTTTACACTCTTTGCCACTGATTAGCAGTATTTAAATCTT
GCAAGAATATTTTGTGCTTTCTTTAGAAACACAAGAGTATAGATTTTTCTCACTGAAAAGTGAGAGTTACGCATTGCAGCCATGAAGGGA
TGCTAGGATCAATTATGGCAGTACCTTTTTTCCCCTCCTGTTCTTGAGCCAGTTGTCTCTTTTGTTTTGGGTCCCACTTAGGATTAATGG
ATGTAAGGTATTTTCCTGTGCCTTTATTTTGTGTCATTCTATTGGAAGGAGGTGTAACGGCAGAATAGCATCGTGTTGGGGGTTTTCCTT
CAAACACTGCAAGTGATATTGCCACCATGTGAACCTCAAATATGCAATCCAGTTGTGTTGGTTTCTCGGTGACTTGGAGTGTTCATCTCT
TCATGAATTGTGAGCACTGACCATGTTCTTCAGTTCTTAATTATGGTGAGTTGACAAATACCAACTACTGCTTTTCTTTAGGTGGCTATA
AATTTCTTACTGTCAGGAGGAAATGACATTATATTCTGTTCCACTGAACGTCAGAGATCAGCAGGCACTGTACTGGGTAGAGAAGTGCCT
ATACTTCTCTACCTAAGAGGGCAGGAGGGAAACCCTACAGCTCCTTGTGAGCCTATATATTAGTATATCGGCCTGGAGAGGACAAGGGAA
TAAGACCACTCATAGTGAGGCTGGCCAAGCTGCACTGGTCGGACCAGGCAGTGGCTGACCTAAGGAAGACAACTTGCTTTGCTTAAAAGT
AGATTTTTTAAGCAATGCTTAACACAGGCAGCATTCACCTTTGTTCAGGCCATCGACATGTATTGTTAAAATTACTGCATATCCCCCTCA
GATATCAAGTATACACTGTTCATGTTGGGGTTGTGTGTGTGTATGTGTGTATGTACGCACGCATGTGTCCCAAATCTTGTTTTAATTTTT
TTTTTCTGAATGTGATCATGTTTTGGATGATACCTGAGCAGGGTTGCCTTTTTTTTATTTATTACCATTATATATTATATTATATTATAT
TATATATTTTTTGCTTTCTTATAACTTTGGAGGAAAGTCAAATCTTGGTATTATTAAAATTGTTTTAAAAAGGAGTAAATTTTCCAGTTG
ATAAATGAAAATCACTGGCCTATGTTTAATAAGTTTTTCTTTAATTACTGTGGAATAACGTGCCAGCTATCATCAACACAATGATTTTGT
ACATAGGGTAGGGAAGCAGTGATGCTCTCAATGGGAAGATGTGCAACACAAATTAAGGGGAACTCCATGTATTTTACCTACTTCAGCAAT
GGAACTGCAACTTGGGGCTTTGTGAATAAAATTTAGCTGCCTTGTATAGTCGTTTGAAAGAATATGTGATCTGTGAGAGAATTATAGTTT
TTTTTTAGAAGAAAAATCTGCAAAAGATCTTTCCAAAGACAATGTGCCACAGATCTTTTGTTCTCTGTAATGAGGATTAATTGCTGTTTA
AACAAAAATGTAATTGTTCATCTTTAAATTCTTTCCTTTTCATAAGAGGATCAAGCTGTAAAAAAACAAAAAAATTAATAAAAATTTCGA

>In-frame_KMT2A_ENST00000389506_chr11_118353211_+_AFF1_ENST00000544085_chr4_88012943_+_6962nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGACTCTCAGCATGTCAGTTCTGTAACCCAAAACCAAAAACAATATGATACATCT
TCAAAAACTCACTCAAATTCTCAGCAAGGAACGTCATCCATGCTCGAAGACGACCTTCAGCTCAGTGACAGTGAGGACAGTGACAGTGAA
CAAACCCCAGAGAAGCCTCCCTCCTCATCTGCACCTCCAAGTGCTCCACAGTCCCTTCCAGAACCAGTGGCATCAGCACATTCCAGCAGT
GCAGAGTCAGAAAGCACCAGTGACTCAGACAGTTCCTCAGACTCAGAGAGCGAGAGCAGTTCAAGTGACAGCGAAGAAAATGAGCCCCTA
GAAACCCCAGCTCCGGAGCCTGAGCCTCCAACAACAAACAAATGGCAGCTGGACAACTGGCTGACCAAAGTCAGCCAGCCAGCTGCGCCA
CCAGAGGGCCCCAGGAGCACAGAGCCCCCACGGCGGCACCCAGAGAGTAAGGGCAGCAGCGACAGTGCCACGAGTCAGGAGCATTCTGAA
TCCAAAGATCCTCCCCCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCACCCGAAGCCCCCCACCCCGGAAAGAGGAGCTGTCAGAAGTCT
CCGGCACAGCAGGAGCCCCCACAAAGGCAAACCGTTGGAACCAAACAACCCAAAAAACCTGTCAAGGCCTCTGCCCGGGCAGGTTCACGG
ACCAGCCTGCAGGGGGAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCCCGAGACCAGACTTCCAAAGACAAGCCCAAGGTGAAGACGAAA
GGACGGCCCCGGGCCGCAGCAAGCAACGAACCCAAGCCAGCAGTGCCCCCCTCCAGTGAGAAGAAGAAGCACAAGAGCTCCCTCCCTGCC
CCCTCTAAGGCTCTCTCAGGCCCAGAACCCGCGAAGGACAATGTGGAGGACAGGACCCCTGAGCACTTTGCTCTTGTTCCCCTGACTGAG
AGCCAGGGCCCACCCCACAGTGGCAGCGGCAGCAGGACTAGTGGCTGCCGCCAAGCCGTGGTGGTCCAGGAGGACAGCCGCAAAGACAGA
CTCCCATTGCCTTTGAGAGACACCAAGCTGCTCTCACCGCTCAGGGACACTCCTCCCCCACAAAGCTTGATGGTGAAGATCACCCTAGAC
CTGCTCTCTCGGATACCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGGAAAGCAGAAGATAAACAGCCGCCCGCAGGGAAGAAGCACAGC
TCTGAGAAGAGGAGCTCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGAAAGGGTGAAGCAGAAAGAGACTGTGATAACAAGAAAATCAGA
CTGGAGAAGGAAATCAAATCACAGTCATCTTCATCTTCATCCTCCCACAAAGAATCTTCTAAAACAAAGCCCTCCAGGCCCTCCTCACAG
TCCTCAAAGAAGGAAATGCTCCCCCCGCCACCCGTGTCCTCGTCCTCCCAGAAGCCAGCCAAGCCTGCACTTAAGAGGTCAAGGCGGGAA
GCAGACACCTGTGGCCAGGACCCTCCCAAAAGTGCCAGCAGTACCAAGAGCAACCACAAAGACTCTTCCATTCCCAAGCAGAGAAGAGTA
GAGGGGAAGGGCTCCAGAAGCTCCTCGGAGCACAAGGGTTCTTCCGGAGATACTGCAAATCCTTTTCCAGTGCCTTCTTTGCCAAATGGT
AACTCTAAACCAGGGAAGCCTCAAGTGAAGTTTGACAAACAACAAGCAGACCTTCACATGAGGGAGGCAAAAAAGATGAAGCAGAAAGCA
GAGTTAATGACGGACAGGGTTGGAAAGGCTTTTAAGTACCTGGAAGCCGTCTTGTCCTTCATTGAGTGCGGAATTGCCACAGAGTCTGAA
AGCCAGTCATCCAAGTCAGCTTACTCTGTCTACTCAGAAACTGTAGATCTCATTAAATTCATAATGTCATTAAAATCCTTCTCAGATGCC
ACAGCGCCAACACAAGAGAAAATATTTGCTGTTTTATGCATGCGTTGCCAGTCCATTTTGAACATGGCGATGTTTCGTTGTAAAAAAGAC
ATAGCAATAAAGTATTCTCGTACTCTTAATAAACACTTCGAGAGTTCTTCCAAAGTCGCCCAGGCACCTTCTCCATGCATTGCAAGAAGC
ACAGGCACACCATCCCCTCTTTCCCCAATGCCTTCTCCTGCCAGCTCCGTAGGGTCCCAGTCAAGTGCTGGCAGTGTGGGGAGCAGTGGG
GTGGCTGCCACTATCAGCACCCCAGTCACCATCCAGAATATGACATCTTCCTATGTCACCATCACATCCCATGTTCTTACCGCCTTTGAC
CTTTGGGAACAGGCCGAGGCCCTCACGAGGAAGAATAAAGAATTCTTTGCTCGGCTCAGCACAAATGTGTGCACCTTGGCCCTCAACAGC
AGTTTGGTGGACCTGGTGCACTATACACGACAGGGTTTTCAGCAGCTACAAGAATTAACCAAAACACCTTAATGGAGCCCCAGGTTGATT
CAATGCCTTGGGAACTATTTTTGCACATTGGAAGCCTCAAAAACAGTCCAGACATTTGTTTCATCAGGACACCAAACTCTAAAAAAGAAG
CACCACGAGATGGCCAGGACATTTGTCCACTTAAACTCTCAACAACAGTGTGATCATTGGTTGGACACTGTGGTTATGCAGAAGCAGAGA
TGAGGAGGCTGGCCCCAGAGATGATCTTGCCCTTCCTAACTAAAGGACAGAAGTGCAATTTAGCTTAAATGGGTGTATGAATGGTCTAGA
AACATTTCTATTTTTTTTTTAAACCAGCAGGATACAAGTTGCAAATGAAATGAGGAGAAACAGTTTCAACTCTGAAAGTGAATTTCACGT

>In-frame_KMT2A_ENST00000354520_chr11_118353211_+_AFF1_ENST00000395146_chr4_88012943_+_11905nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGACTCTCAGCATGTCAGTTCTGTAACCCAAAACCAAAAACAATATGATACATCT
TCAAAAACTCACTCAAATTCTCAGCAAGGAACGTCATCCATGCTCGAAGACGACCTTCAGCTCAGTGACAGTGAGGACAGTGACAGTGAA
CAAACCCCAGAGAAGCCTCCCTCCTCATCTGCACCTCCAAGTGCTCCACAGTCCCTTCCAGAACCAGTGGCATCAGCACATTCCAGCAGT
GCAGAGTCAGAAAGCACCAGTGACTCAGACAGTTCCTCAGACTCAGAGAGCGAGAGCAGTTCAAGTGACAGCGAAGAAAATGAGCCCCTA
GAAACCCCAGCTCCGGAGCCTGAGCCTCCAACAACAAACAAATGGCAGCTGGACAACTGGCTGACCAAAGTCAGCCAGCCAGCTGCGCCA
CCAGAGGGCCCCAGGAGCACAGAGCCCCCACGGCGGCACCCAGAGAGTAAGGGCAGCAGCGACAGTGCCACGAGTCAGGAGCATTCTGAA
TCCAAAGATCCTCCCCCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCACCCGAAGCCCCCCACCCCGGAAAGAGGAGCTGTCAGAAGTCT
CCGGCACAGCAGGAGCCCCCACAAAGGCAAACCGTTGGAACCAAACAACCCAAAAAACCTGTCAAGGCCTCTGCCCGGGCAGGTTCACGG
ACCAGCCTGCAGGGGGAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCCCGAGACCAGACTTCCAAAGACAAGCCCAAGGTGAAGACGAAA
GGACGGCCCCGGGCCGCAGCAAGCAACGAACCCAAGCCAGCAGTGCCCCCCTCCAGTGAGAAGAAGAAGCACAAGAGCTCCCTCCCTGCC
CCCTCTAAGGCTCTCTCAGGCCCAGAACCCGCGAAGGACAATGTGGAGGACAGGACCCCTGAGCACTTTGCTCTTGTTCCCCTGACTGAG
AGCCAGGGCCCACCCCACAGTGGCAGCGGCAGCAGGACTAGTGGCTGCCGCCAAGCCGTGGTGGTCCAGGAGGACAGCCGCAAAGACAGA
CTCCCATTGCCTTTGAGAGACACCAAGCTGCTCTCACCGCTCAGGGACACTCCTCCCCCACAAAGCTTGATGGTGAAGATCACCCTAGAC
CTGCTCTCTCGGATACCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGGAAAGCAGAAGATAAACAGCCGCCCGCAGGGAAGAAGCACAGC
TCTGAGAAGAGGAGCTCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGAAAGGGTGAAGCAGAAAGAGACTGTGATAACAAGAAAATCAGA
CTGGAGAAGGAAATCAAATCACAGTCATCTTCATCTTCATCCTCCCACAAAGAATCTTCTAAAACAAAGCCCTCCAGGCCCTCCTCACAG
TCCTCAAAGAAGGAAATGCTCCCCCCGCCACCCGTGTCCTCGTCCTCCCAGAAGCCAGCCAAGCCTGCACTTAAGAGGTCAAGGCGGGAA
GCAGACACCTGTGGCCAGGACCCTCCCAAAAGTGCCAGCAGTACCAAGAGCAACCACAAAGACTCTTCCATTCCCAAGCAGAGAAGAGTA
GAGGGGAAGGGCTCCAGAAGCTCCTCGGAGCACAAGGGTTCTTCCGGAGATACTGCAAATCCTTTTCCAGTGCCTTCTTTGCCAAATGGT
AACTCTAAACCAGGGAAGCCTCAAGTGAAGTTTGACAAACAACAAGCAGACCTTCACATGAGGGAGGCAAAAAAGATGAAGCAGAAAGCA
GAGTTAATGACGGACAGGGTTGGAAAGGCTTTTAAGTACCTGGAAGCCGTCTTGTCCTTCATTGAGTGCGGAATTGCCACAGAGTCTGAA
AGCCAGTCATCCAAGTCAGCTTACTCTGTCTACTCAGAAACTGTAGATCTCATTAAATTCATAATGTCATTAAAATCCTTCTCAGATGCC
ACAGCGCCAACACAAGAGAAAATATTTGCTGTTTTATGCATGCGTTGCCAGTCCATTTTGAACATGGCGATGTTTCGTTGTAAAAAAGAC
ATAGCAATAAAGTATTCTCGTACTCTTAATAAACACTTCGAGAGTTCTTCCAAAGTCGCCCAGGCACCTTCTCCATGCATTGCAAGAAGC
ACAGGCACACCATCCCCTCTTTCCCCAATGCCTTCTCCTGCCAGCTCCGTAGGGTCCCAGTCAAGTGCTGGCAGTGTGGGGAGCAGTGGG
GTGGCTGCCACTATCAGCACCCCAGTCACCATCCAGAATATGACATCTTCCTATGTCACCATCACATCCCATGTTCTTACCGCCTTTGAC
CTTTGGGAACAGGCCGAGGCCCTCACGAGGAAGAATAAAGAATTCTTTGCTCGGCTCAGCACAAATGTGTGCACCTTGGCCCTCAACAGC
AGTTTGGTGGACCTGGTGCACTATACACGACAGGGTTTTCAGCAGCTACAAGAATTAACCAAAACACCTTAATGGAGCCCCAGGTTGATT
CAATGCCTTGGGAACTATTTTTGCACATTGGAAGCCTCAAAAACAGTCCAGACATTTGTTTCATCAGGACACCAAACTCTAAAAAAGAAG
CACCACGAGATGGCCAGGACATTTGTCCACTTAAACTCTCAACAACAGTGTGATCATTGGTTGGACACTGTGGTTATGCAGAAGCAGAGA
TGAGGAGGCTGGCCCCAGAGATGATCTTGCCCTTCCTAACTAAAGGACAGAAGTGCAATTTAGCTTAAATGGGTGTATGAATGGTCTAGA
AACATTTCTATTTTTTTTTTAAACCAGCAGGATACAAGTTGCAAATGAAATGAGGAGAAACAGTTTCAACTCTGAAAGTGAATTTCACGT
CATCTCAGTAGCCACGCTAGTCCATTCCCAGAAGGAAATTTTTTTTTTTAACAATGACTTTTGGTAAAGGGTTTTGTGGATGATTTTTTT
TCTTTTGAGTTTTGGGAGAAATATTTGTTTAGTAACTTCTAATGGCCATCTGTAAACCATAAGTAATGAAGGACTCCACTGTGCCCCACT
TTCTGCCAATGAACAGTGGCTTGATAATACCAAGTATTGTTGTAATTTATAAAATTGAAGGCAACCCCCGCTCCTGCCGCCCCCAATCTC
CCCATTGCCTAGAGCGCTGCACATTGACCCCAGCTCTGACTTCTCATTACTGTGCTGAAAGTCAGCCCACGTCGGAGCGGTGAGGAGGAG
CCACAGCACATGGGGTGCCACCTCGAGGTCTGCACAGGAGGACTTGGCGCTGCCATTTCCTACCCCTGCCATTTCCCACCCCTGCTTCAG
CGAAAGGGACTCTCTAACAGGGCAGTCACTGTTGACTCTATTCTGAATTTCCTCCCTTGGGGAAGAAGGGAACCAACATTTATACCTGAC
CAGATGGCTAAAGTGCTTTTAAAGTTTTGTTTAAGTAGAGCTGGAATTTGAGGTGCTGATCTGTGGTCTACAGTTATGTGGTAACTCATG
TTGTCCAGCCAACTCAGAGTTTCGTCAGTGAACAAGAAACATGAAATCTGCTTCTTAGAGAGGCTATATTTTTCTGCTACAAATATTTTA
TATTTATAGCAAAACTAGACTTTCAGAGTCCTTGATTGTCTAGGGGAAGTTAACTCCCTGAGAGGATGTAGAGATTTGGGGTGGTTGATT
AGACTTTTGAAAAACTCATCACCACATGCCTTCACTCCAGAGTGTTCTCAGCTAGATTTGATTTGGTTGAGGAGGAACTGTGGCCCTCCG
TAAGTTATTGCCATAGTGTATGCATTAAACCAAGTCCATTTTGAATGACCTAAAATGAAGTAACACAATCAGAAATCCCATGTGCCCATA
AGCACAGATTTTTCTTTTTCATTGAAACTTTAAAGGTTATTATTGGAAACATTACTTTGAGTGCAGTGTTTTTAAAAGCCAATTCTTTTT
TATCCCTTTTAGAAGTAGAATTTGCACACTTACTACAATTGAGGAGTGTCATCTCTATAACTTTTTCTCCGCCTTTGTCCCATTCTGCCC
CTGTACATGTTTCCTACCAAGCATGTTTCACATTTTCCTATTAGTGGAGGAGGGAGAACCATATTTATTTATAATGAAGACATCTAAGAT
CCCTATGATGAATGCAGGAACTCTCTTGGTAGTTTGTAAATACACAAAGGGATGTGTCGAGGGATGGGAGCGATGCTTATCTCTCACAGT
GTGAGTGGTCTGTGTGAGGCTGTTCCTTCAGTTTCTTCTCCAGACTGTTCTTTGGTTGTCACTAAGTCAGAGGTCTGGTCCCTCATGTTT
AGGTGAAAGCCAGAGAATGACAGCTGTAGTCATATCTGAGCATAAGACCTTGATGTGTGATTCCTGATGACCGGTTTCATTTATTCATGT
TATAAAGCAAAGCCCTGGTCCTTTTTAAACTACTAGTTTTAAAAACCTGTGTTAAATGAACAGTAATTGCCTGGTAGGTTTGGTGTGTGT
GTAGCATTGTGTGTCCATCTGTTATATGTAAAGGACAAGGCACCAGAATCAGGCTTTATTTCGATATTGAAGATGTTATTTAACATCTTT
CTTTTTTCCTTACTCCCTTAGCCATCCCCTCCCCTTTTGTCCTATCATTCCCTAGAACAAGCCACCTGTCAATTGTGAAGGGTTGTGTTC
TTTATGGCAGGTTCTATGCAGATTGTGCCAGAGCATGTGCGTGTTCTGTTGGCAAGCCACAGTGCTCCCTTGACTGAAGACATTTCCAGG
TAGATTTCTCAGCCAGCTCTAAAACAGATTGCTTTTTCAGTGGCCTTACTCTTTGTGGGTTTTTTTTTTTTTCTCTGAACTTGATATAAA
GATTTTATTTGTCCCTTGAAAAAGTAACAAATGTGCATAGATCAATTTGTACTACTTTGGTCATTGGATATTTCTGATCCTTATTGCATT
GTACCTAAAGGAGAGTAACTAATGGTAACCTTTTTAATAGAGTATGTGAAAGGTAGTGGCTGATGAATCCTTAACGTTCATAGGGTCTTT
TTGCTGTTACGGTTGTATATAGAGGTCTGAAGGATTTTTAAAATGATTTGCACTTTTTCACTGCATGCTTACAATTCCCAAAGGCAAAAT
CTGTACTGAGGTAGATCATTTGAAAGGGCTAGATTATAAAATTAAGCCTTAGAGTATGGAAAGTTCTTATAACAATAATAGTACACACTT
CAGAGTAAGACAAATGCAAAGCATCTTAAGGAGTGAAAATAGAGTGTAAATCTTGCCTTTGGCACTACAAGGTGTGTGTGTGTGTGTGTG
TGTGTGTGTGTGTCTTTAGTAGGAAATGGAAGAACACTGTTTTATTTTTTAAAGTGTTTAATGTTTCTGTCCTTTCTGTGAATTATTGAA
TTTAAGAGCCCTGCTAAATAATGAAAAAACACTTTACTAAAATTTATCAAATTATACTGGGTTCGGATTGTGAAAACATTGGCCACCTAG
TAGCAGTGGTGAGGAGTGGGAGGGCCCAGCAAGCATTTATCAGAAATAGAATCACAATAGGAGGAGAATTTGACTGTCTGATATTATGAT
TTGATTACAATACTGAATGGGAAAAGTATCTAATATTTTGTAACAAAAAGACCTTCATATTATCTGTTTTGACCAAAATATGTAGCTATT
TCCCTTACACAGATTGGACCGCACTTATCTCCCTTGTCCTGTATCCTTTAATTTCAGGTCTCAGGATGTTTAGAAAGCTAAAACCCCCTA
CCCCTTTCTGGCTGAAAACTTGCCTTATTTGGTATCTTACACATTAATGTTACTAGCATCAGGAGCTTACTGTTTTATTATGATTCATCT
TCAGTAATTTTTAGAAGCAAGAAGAAAGCCATTGTGTCCTCTACAATTAACAAAACTTATCTCTGATATACAAAGGGATATAAATATATA
CACTTAAATAGAGAAAAAGAGGTTGATTGAATTGTGCCTTTGAGTGAACCCAGTTTTTAAATACCGCTGTGTTTGTTTCGCCATGGCTTC
AGGGATGCTACATGGCTCTTGCACCTTTTACTCCTCTGCTTTATGAAGTTTGAGTTGTATTTGTGCATCTTAAAGTAGGTTGAGGCTTGA
GGCTGGGCTTTCGGGTTTTTTTGTTTTTTGTTTTGTTTTGTTTTGTTTTGTTTTCTTGTACTTAAACCTGCTTGCTTCCTACCACAGATT
CTTTATTTTCCCAAACACTACAAAAAAACTTTTAAAACTTTGCCATTTCATCTGTTTACACTCTTTGCCACTGATTAGCAGTATTTAAAT
CTTGCAAGAATATTTTGTGCTTTCTTTAGAAACACAAGAGTATAGATTTTTCTCACTGAAAAGTGAGAGTTACGCATTGCAGCCATGAAG
GGATGCTAGGATCAATTATGGCAGTACCTTTTTTCCCCTCCTGTTCTTGAGCCAGTTGTCTCTTTTGTTTTGGGTCCCACTTAGGATTAA
TGGATGTAAGGTATTTTCCTGTGCCTTTATTTTGTGTCATTCTATTGGAAGGAGGTGTAACGGCAGAATAGCATCGTGTTGGGGGTTTTC
CTTCAAACACTGCAAGTGATATTGCCACCATGTGAACCTCAAATATGCAATCCAGTTGTGTTGGTTTCTCGGTGACTTGGAGTGTTCATC
TCTTCATGAATTGTGAGCACTGACCATGTTCTTCAGTTCTTAATTATGGTGAGTTGACAAATACCAACTACTGCTTTTCTTTAGGTGGCT
ATAAATTTCTTACTGTCAGGAGGAAATGACATTATATTCTGTTCCACTGAACGTCAGAGATCAGCAGGCACTGTACTGGGTAGAGAAGTG
CCTATACTTCTCTACCTAAGAGGGCAGGAGGGAAACCCTACAGCTCCTTGTGAGCCTATATATTAGTATATCGGCCTGGAGAGGACAAGG
GAATAAGACCACTCATAGTGAGGCTGGCCAAGCTGCACTGGTCGGACCAGGCAGTGGCTGACCTAAGGAAGACAACTTGCTTTGCTTAAA
AGTAGATTTTTTAAGCAATGCTTAACACAGGCAGCATTCACCTTTGTTCAGGCCATCGACATGTATTGTTAAAATTACTGCATATCCCCC
TCAGATATCAAGTATACACTGTTCATGTTGGGGTTGTGTGTGTGTATGTGTGTATGTACGCACGCATGTGTCCCAAATCTTGTTTTAATT
TTTTTTTTCTGAATGTGATCATGTTTTGGATGATACCTGAGCAGGGTTGCCTTTTTTTTATTTATTACCATTATATATTATATTATATTA
TATTATATATTTTTTGCTTTCTTATAACTTTGGAGGAAAGTCAAATCTTGGTATTATTAAAATTGTTTTAAAAAGGAGTAAATTTTCCAG
TTGATAAATGAAAATCACTGGCCTATGTTTAATAAGTTTTTCTTTAATTACTGTGGAATAACGTGCCAGCTATCATCAACACAATGATTT
TGTACATAGGGTAGGGAAGCAGTGATGCTCTCAATGGGAAGATGTGCAACACAAATTAAGGGGAACTCCATGTATTTTACCTACTTCAGC
AATGGAACTGCAACTTGGGGCTTTGTGAATAAAATTTAGCTGCCTTGTATAGTCGTTTGAAAGAATATGTGATCTGTGAGAGAATTATAG
TTTTTTTTTAGAAGAAAAATCTGCAAAAGATCTTTCCAAAGACAATGTGCCACAGATCTTTTGTTCTCTGTAATGAGGATTAATTGCTGT
TTAAACAAAAATGTAATTGTTCATCTTTAAATTCTTTCCTTTTCATAAGAGGATCAAGCTGTAAAAAAACAAAAAAATTAATAAAAATTT

>In-frame_KMT2A_ENST00000354520_chr11_118353211_+_AFF1_ENST00000307808_chr4_88012943_+_11886nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGACTCTCAGCATGTCAGTTCTGTAACCCAAAACCAAAAACAATATGATACATCT
TCAAAAACTCACTCAAATTCTCAGCAAGGAACGTCATCCATGCTCGAAGACGACCTTCAGCTCAGTGACAGTGAGGACAGTGACAGTGAA
CAAACCCCAGAGAAGCCTCCCTCCTCATCTGCACCTCCAAGTGCTCCACAGTCCCTTCCAGAACCAGTGGCATCAGCACATTCCAGCAGT
GCAGAGTCAGAAAGCACCAGTGACTCAGACAGTTCCTCAGACTCAGAGAGCGAGAGCAGTTCAAGTGACAGCGAAGAAAATGAGCCCCTA
GAAACCCCAGCTCCGGAGCCTGAGCCTCCAACAACAAACAAATGGCAGCTGGACAACTGGCTGACCAAAGTCAGCCAGCCAGCTGCGCCA
CCAGAGGGCCCCAGGAGCACAGAGCCCCCACGGCGGCACCCAGAGAGTAAGGGCAGCAGCGACAGTGCCACGAGTCAGGAGCATTCTGAA
TCCAAAGATCCTCCCCCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCACCCGAAGCCCCCCACCCCGGAAAGAGGAGCTGTCAGAAGTCT
CCGGCACAGCAGGAGCCCCCACAAAGGCAAACCGTTGGAACCAAACAACCCAAAAAACCTGTCAAGGCCTCTGCCCGGGCAGGTTCACGG
ACCAGCCTGCAGGGGGAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCCCGAGACCAGACTTCCAAAGACAAGCCCAAGGTGAAGACGAAA
GGACGGCCCCGGGCCGCAGCAAGCAACGAACCCAAGCCAGCAGTGCCCCCCTCCAGTGAGAAGAAGAAGCACAAGAGCTCCCTCCCTGCC
CCCTCTAAGGCTCTCTCAGGCCCAGAACCCGCGAAGGACAATGTGGAGGACAGGACCCCTGAGCACTTTGCTCTTGTTCCCCTGACTGAG
AGCCAGGGCCCACCCCACAGTGGCAGCGGCAGCAGGACTAGTGGCTGCCGCCAAGCCGTGGTGGTCCAGGAGGACAGCCGCAAAGACAGA
CTCCCATTGCCTTTGAGAGACACCAAGCTGCTCTCACCGCTCAGGGACACTCCTCCCCCACAAAGCTTGATGGTGAAGATCACCCTAGAC
CTGCTCTCTCGGATACCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGGAAAGCAGAAGATAAACAGCCGCCCGCAGGGAAGAAGCACAGC
TCTGAGAAGAGGAGCTCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGAAAGGGTGAAGCAGAAAGAGACTGTGATAACAAGAAAATCAGA
CTGGAGAAGGAAATCAAATCACAGTCATCTTCATCTTCATCCTCCCACAAAGAATCTTCTAAAACAAAGCCCTCCAGGCCCTCCTCACAG
TCCTCAAAGAAGGAAATGCTCCCCCCGCCACCCGTGTCCTCGTCCTCCCAGAAGCCAGCCAAGCCTGCACTTAAGAGGTCAAGGCGGGAA
GCAGACACCTGTGGCCAGGACCCTCCCAAAAGTGCCAGCAGTACCAAGAGCAACCACAAAGACTCTTCCATTCCCAAGCAGAGAAGAGTA
GAGGGGAAGGGCTCCAGAAGCTCCTCGGAGCACAAGGGTTCTTCCGGAGATACTGCAAATCCTTTTCCAGTGCCTTCTTTGCCAAATGGT
AACTCTAAACCAGGGAAGCCTCAAGTGAAGTTTGACAAACAACAAGCAGACCTTCACATGAGGGAGGCAAAAAAGATGAAGCAGAAAGCA
GAGTTAATGACGGACAGGGTTGGAAAGGCTTTTAAGTACCTGGAAGCCGTCTTGTCCTTCATTGAGTGCGGAATTGCCACAGAGTCTGAA
AGCCAGTCATCCAAGTCAGCTTACTCTGTCTACTCAGAAACTGTAGATCTCATTAAATTCATAATGTCATTAAAATCCTTCTCAGATGCC
ACAGCGCCAACACAAGAGAAAATATTTGCTGTTTTATGCATGCGTTGCCAGTCCATTTTGAACATGGCGATGTTTCGTTGTAAAAAAGAC
ATAGCAATAAAGTATTCTCGTACTCTTAATAAACACTTCGAGAGTTCTTCCAAAGTCGCCCAGGCACCTTCTCCATGCATTGCAAGCACA
GGCACACCATCCCCTCTTTCCCCAATGCCTTCTCCTGCCAGCTCCGTAGGGTCCCAGTCAAGTGCTGGCAGTGTGGGGAGCAGTGGGGTG
GCTGCCACTATCAGCACCCCAGTCACCATCCAGAATATGACATCTTCCTATGTCACCATCACATCCCATGTTCTTACCGCCTTTGACCTT
TGGGAACAGGCCGAGGCCCTCACGAGGAAGAATAAAGAATTCTTTGCTCGGCTCAGCACAAATGTGTGCACCTTGGCCCTCAACAGCAGT
TTGGTGGACCTGGTGCACTATACACGACAGGGTTTTCAGCAGCTACAAGAATTAACCAAAACACCTTAATGGAGCCCCAGGTTGATTCAA
TGCCTTGGGAACTATTTTTGCACATTGGAAGCCTCAAAAACAGTCCAGACATTTGTTTCATCAGGACACCAAACTCTAAAAAAGAAGCAC
CACGAGATGGCCAGGACATTTGTCCACTTAAACTCTCAACAACAGTGTGATCATTGGTTGGACACTGTGGTTATGCAGAAGCAGAGATGA
GGAGGCTGGCCCCAGAGATGATCTTGCCCTTCCTAACTAAAGGACAGAAGTGCAATTTAGCTTAAATGGGTGTATGAATGGTCTAGAAAC
ATTTCTATTTTTTTTTTAAACCAGCAGGATACAAGTTGCAAATGAAATGAGGAGAAACAGTTTCAACTCTGAAAGTGAATTTCACGTCAT
CTCAGTAGCCACGCTAGTCCATTCCCAGAAGGAAATTTTTTTTTTTAACAATGACTTTTGGTAAAGGGTTTTGTGGATGATTTTTTTTCT
TTTGAGTTTTGGGAGAAATATTTGTTTAGTAACTTCTAATGGCCATCTGTAAACCATAAGTAATGAAGGACTCCACTGTGCCCCACTTTC
TGCCAATGAACAGTGGCTTGATAATACCAAGTATTGTTGTAATTTATAAAATTGAAGGCAACCCCCGCTCCTGCCGCCCCCAATCTCCCC
ATTGCCTAGAGCGCTGCACATTGACCCCAGCTCTGACTTCTCATTACTGTGCTGAAAGTCAGCCCACGTCGGAGCGGTGAGGAGGAGCCA
CAGCACATGGGGTGCCACCTCGAGGTCTGCACAGGAGGACTTGGCGCTGCCATTTCCTACCCCTGCCATTTCCCACCCCTGCTTCAGCGA
AAGGGACTCTCTAACAGGGCAGTCACTGTTGACTCTATTCTGAATTTCCTCCCTTGGGGAAGAAGGGAACCAACATTTATACCTGACCAG
ATGGCTAAAGTGCTTTTAAAGTTTTGTTTAAGTAGAGCTGGAATTTGAGGTGCTGATCTGTGGTCTACAGTTATGTGGTAACTCATGTTG
TCCAGCCAACTCAGAGTTTCGTCAGTGAACAAGAAACATGAAATCTGCTTCTTAGAGAGGCTATATTTTTCTGCTACAAATATTTTATAT
TTATAGCAAAACTAGACTTTCAGAGTCCTTGATTGTCTAGGGGAAGTTAACTCCCTGAGAGGATGTAGAGATTTGGGGTGGTTGATTAGA
CTTTTGAAAAACTCATCACCACATGCCTTCACTCCAGAGTGTTCTCAGCTAGATTTGATTTGGTTGAGGAGGAACTGTGGCCCTCCGTAA
GTTATTGCCATAGTGTATGCATTAAACCAAGTCCATTTTGAATGACCTAAAATGAAGTAACACAATCAGAAATCCCATGTGCCCATAAGC
ACAGATTTTTCTTTTTCATTGAAACTTTAAAGGTTATTATTGGAAACATTACTTTGAGTGCAGTGTTTTTAAAAGCCAATTCTTTTTTAT
CCCTTTTAGAAGTAGAATTTGCACACTTACTACAATTGAGGAGTGTCATCTCTATAACTTTTTCTCCGCCTTTGTCCCATTCTGCCCCTG
TACATGTTTCCTACCAAGCATGTTTCACATTTTCCTATTAGTGGAGGAGGGAGAACCATATTTATTTATAATGAAGACATCTAAGATCCC
TATGATGAATGCAGGAACTCTCTTGGTAGTTTGTAAATACACAAAGGGATGTGTCGAGGGATGGGAGCGATGCTTATCTCTCACAGTGTG
AGTGGTCTGTGTGAGGCTGTTCCTTCAGTTTCTTCTCCAGACTGTTCTTTGGTTGTCACTAAGTCAGAGGTCTGGTCCCTCATGTTTAGG
TGAAAGCCAGAGAATGACAGCTGTAGTCATATCTGAGCATAAGACCTTGATGTGTGATTCCTGATGACCGGTTTCATTTATTCATGTTAT
AAAGCAAAGCCCTGGTCCTTTTTAAACTACTAGTTTTAAAAACCTGTGTTAAATGAACAGTAATTGCCTGGTAGGTTTGGTGTGTGTGTA
GCATTGTGTGTCCATCTGTTATATGTAAAGGACAAGGCACCAGAATCAGGCTTTATTTCGATATTGAAGATGTTATTTAACATCTTTCTT
TTTTCCTTACTCCCTTAGCCATCCCCTCCCCTTTTGTCCTATCATTCCCTAGAACAAGCCACCTGTCAATTGTGAAGGGTTGTGTTCTTT
ATGGCAGGTTCTATGCAGATTGTGCCAGAGCATGTGCGTGTTCTGTTGGCAAGCCACAGTGCTCCCTTGACTGAAGACATTTCCAGGTAG
ATTTCTCAGCCAGCTCTAAAACAGATTGCTTTTTCAGTGGCCTTACTCTTTGTGGGTTTTTTTTTTTTTCTCTGAACTTGATATAAAGAT
TTTATTTGTCCCTTGAAAAAGTAACAAATGTGCATAGATCAATTTGTACTACTTTGGTCATTGGATATTTCTGATCCTTATTGCATTGTA
CCTAAAGGAGAGTAACTAATGGTAACCTTTTTAATAGAGTATGTGAAAGGTAGTGGCTGATGAATCCTTAACGTTCATAGGGTCTTTTTG
CTGTTACGGTTGTATATAGAGGTCTGAAGGATTTTTAAAATGATTTGCACTTTTTCACTGCATGCTTACAATTCCCAAAGGCAAAATCTG
TACTGAGGTAGATCATTTGAAAGGGCTAGATTATAAAATTAAGCCTTAGAGTATGGAAAGTTCTTATAACAATAATAGTACACACTTCAG
AGTAAGACAAATGCAAAGCATCTTAAGGAGTGAAAATAGAGTGTAAATCTTGCCTTTGGCACTACAAGGTGTGTGTGTGTGTGTGTGTGT
GTGTGTGTGTCTTTAGTAGGAAATGGAAGAACACTGTTTTATTTTTTAAAGTGTTTAATGTTTCTGTCCTTTCTGTGAATTATTGAATTT
AAGAGCCCTGCTAAATAATGAAAAAACACTTTACTAAAATTTATCAAATTATACTGGGTTCGGATTGTGAAAACATTGGCCACCTAGTAG
CAGTGGTGAGGAGTGGGAGGGCCCAGCAAGCATTTATCAGAAATAGAATCACAATAGGAGGAGAATTTGACTGTCTGATATTATGATTTG
ATTACAATACTGAATGGGAAAAGTATCTAATATTTTGTAACAAAAAGACCTTCATATTATCTGTTTTGACCAAAATATGTAGCTATTTCC
CTTACACAGATTGGACCGCACTTATCTCCCTTGTCCTGTATCCTTTAATTTCAGGTCTCAGGATGTTTAGAAAGCTAAAACCCCCTACCC
CTTTCTGGCTGAAAACTTGCCTTATTTGGTATCTTACACATTAATGTTACTAGCATCAGGAGCTTACTGTTTTATTATGATTCATCTTCA
GTAATTTTTAGAAGCAAGAAGAAAGCCATTGTGTCCTCTACAATTAACAAAACTTATCTCTGATATACAAAGGGATATAAATATATACAC
TTAAATAGAGAAAAAGAGGTTGATTGAATTGTGCCTTTGAGTGAACCCAGTTTTTAAATACCGCTGTGTTTGTTTCGCCATGGCTTCAGG
GATGCTACATGGCTCTTGCACCTTTTACTCCTCTGCTTTATGAAGTTTGAGTTGTATTTGTGCATCTTAAAGTAGGTTGAGGCTTGAGGC
TGGGCTTTCGGGTTTTTTTGTTTTTTGTTTTGTTTTGTTTTGTTTTGTTTTCTTGTACTTAAACCTGCTTGCTTCCTACCACAGATTCTT
TATTTTCCCAAACACTACAAAAAAACTTTTAAAACTTTGCCATTTCATCTGTTTACACTCTTTGCCACTGATTAGCAGTATTTAAATCTT
GCAAGAATATTTTGTGCTTTCTTTAGAAACACAAGAGTATAGATTTTTCTCACTGAAAAGTGAGAGTTACGCATTGCAGCCATGAAGGGA
TGCTAGGATCAATTATGGCAGTACCTTTTTTCCCCTCCTGTTCTTGAGCCAGTTGTCTCTTTTGTTTTGGGTCCCACTTAGGATTAATGG
ATGTAAGGTATTTTCCTGTGCCTTTATTTTGTGTCATTCTATTGGAAGGAGGTGTAACGGCAGAATAGCATCGTGTTGGGGGTTTTCCTT
CAAACACTGCAAGTGATATTGCCACCATGTGAACCTCAAATATGCAATCCAGTTGTGTTGGTTTCTCGGTGACTTGGAGTGTTCATCTCT
TCATGAATTGTGAGCACTGACCATGTTCTTCAGTTCTTAATTATGGTGAGTTGACAAATACCAACTACTGCTTTTCTTTAGGTGGCTATA
AATTTCTTACTGTCAGGAGGAAATGACATTATATTCTGTTCCACTGAACGTCAGAGATCAGCAGGCACTGTACTGGGTAGAGAAGTGCCT
ATACTTCTCTACCTAAGAGGGCAGGAGGGAAACCCTACAGCTCCTTGTGAGCCTATATATTAGTATATCGGCCTGGAGAGGACAAGGGAA
TAAGACCACTCATAGTGAGGCTGGCCAAGCTGCACTGGTCGGACCAGGCAGTGGCTGACCTAAGGAAGACAACTTGCTTTGCTTAAAAGT
AGATTTTTTAAGCAATGCTTAACACAGGCAGCATTCACCTTTGTTCAGGCCATCGACATGTATTGTTAAAATTACTGCATATCCCCCTCA
GATATCAAGTATACACTGTTCATGTTGGGGTTGTGTGTGTGTATGTGTGTATGTACGCACGCATGTGTCCCAAATCTTGTTTTAATTTTT
TTTTTCTGAATGTGATCATGTTTTGGATGATACCTGAGCAGGGTTGCCTTTTTTTTATTTATTACCATTATATATTATATTATATTATAT
TATATATTTTTTGCTTTCTTATAACTTTGGAGGAAAGTCAAATCTTGGTATTATTAAAATTGTTTTAAAAAGGAGTAAATTTTCCAGTTG
ATAAATGAAAATCACTGGCCTATGTTTAATAAGTTTTTCTTTAATTACTGTGGAATAACGTGCCAGCTATCATCAACACAATGATTTTGT
ACATAGGGTAGGGAAGCAGTGATGCTCTCAATGGGAAGATGTGCAACACAAATTAAGGGGAACTCCATGTATTTTACCTACTTCAGCAAT
GGAACTGCAACTTGGGGCTTTGTGAATAAAATTTAGCTGCCTTGTATAGTCGTTTGAAAGAATATGTGATCTGTGAGAGAATTATAGTTT
TTTTTTAGAAGAAAAATCTGCAAAAGATCTTTCCAAAGACAATGTGCCACAGATCTTTTGTTCTCTGTAATGAGGATTAATTGCTGTTTA
AACAAAAATGTAATTGTTCATCTTTAAATTCTTTCCTTTTCATAAGAGGATCAAGCTGTAAAAAAACAAAAAAATTAATAAAAATTTCGA

>In-frame_KMT2A_ENST00000354520_chr11_118353211_+_AFF1_ENST00000544085_chr4_88012943_+_6962nt
ATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGGGGCGCCGGGGCCTAGGGGGCGCC
CCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGGCGCCCCCCTCCCCCCCGGCTGTG
GCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAGCAGCCTCCTCGTCGTCCGCCTCG
TCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCGACGCGGCGCTGCAGGTCTCGGCC
GCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCGGAGAGGATGAGCAATTCTTAGGT
TTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTCGAAAACCTCGTGGGAGACCTAGA
AGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAGAGACCAAATCTGGAGATAAGATC
AAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAATCAAAATAACACATGGAAAGGAC
ATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTACGTTTCAGCAAGCCACAAAGATT
AAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAGGAAGGAAGGGGGTACAAATTGTA
CGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTGAACTGGAAAAGCCCCAGAAAGTC
CGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTCGAAGGATTAAGCCAGTTAGGATT
ATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGGCTCAAAAGAAAATTGAAAAAGAA
GCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTGTTGTCAGTGCTATCTCCTCGCGG
ATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGATTAGAGTCTACACCGAATAGTAGA
TTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGTCTTCAGACTCCTCTCGATCTAGT
AGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGCGGAGCGATACCCCTGAAGTTCAT
CCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAGTGTCGGAGAGAAGTTTTGGATCT
AGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTCCACCTCTGCTGACTCCACCGCCA
CCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAGCATCACCATTTTTGCCTGCTTCC
ACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAAAGCATTCTAGGTCAGAGCCACAA
TACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGACCCCCTCCACTAACTCCCGAGGAC
GTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCCATTCTGGAACAAGGTTTGATATG
CACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTGAGTCTGTAACCTTGCCTAGTAAT
CGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTCCTATTCGATCTGAACCAAGATCT
CCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCCCGTCTTCTGTCTCTTCCTCGTTA
AGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCCTGACTCAGTCTGGGGAATCTGCA
GAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTACTCCTCTCTTCCCTTGGTTTACC
CCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAGATGCTGACAAGAGCGTGGAGAAG
GACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAAGGAAAAAGGGATCAGAAATTCAG
AGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCACTTCATCTTCTGCCAAAAAAGCA
ACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATACAACAGCTGTCAAAACCAAAATA
CTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCCTGGAGAAGGAGAAAACCCTCTGC
CTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGGCAGACAAGCTTCCAATGACTGAC
AAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTCTTAAACAAACCGACCAGCCCAAA
GCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCAGAAGAGCAGCTGTTGCCCTTGGC
CGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAAAGATTTTGTCTTCCATGGGGAAT
GATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTAAACCTGTCACTAGAAACAAGGCA
CCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGT
ACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAAAATGTCAGAATCTACAATGGATG
CCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCAGTGAAAAGAAAGACAGCAAAGAG
AGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTGCCCCAAAGAAAAGCAGTAGTGAG
CCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAATCCAAACAGGCCACCACTCCAGCT
TCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAGGACCGCCAAGAAAAGAAGTTCCC
AAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCAAACAGAAAAAAGTGGCTCCCCGC
CCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGACTCTCAGCATGTCAGTTCTGTAACCCAAAACCAAAAACAATATGATACATCT
TCAAAAACTCACTCAAATTCTCAGCAAGGAACGTCATCCATGCTCGAAGACGACCTTCAGCTCAGTGACAGTGAGGACAGTGACAGTGAA
CAAACCCCAGAGAAGCCTCCCTCCTCATCTGCACCTCCAAGTGCTCCACAGTCCCTTCCAGAACCAGTGGCATCAGCACATTCCAGCAGT
GCAGAGTCAGAAAGCACCAGTGACTCAGACAGTTCCTCAGACTCAGAGAGCGAGAGCAGTTCAAGTGACAGCGAAGAAAATGAGCCCCTA
GAAACCCCAGCTCCGGAGCCTGAGCCTCCAACAACAAACAAATGGCAGCTGGACAACTGGCTGACCAAAGTCAGCCAGCCAGCTGCGCCA
CCAGAGGGCCCCAGGAGCACAGAGCCCCCACGGCGGCACCCAGAGAGTAAGGGCAGCAGCGACAGTGCCACGAGTCAGGAGCATTCTGAA
TCCAAAGATCCTCCCCCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCACCCGAAGCCCCCCACCCCGGAAAGAGGAGCTGTCAGAAGTCT
CCGGCACAGCAGGAGCCCCCACAAAGGCAAACCGTTGGAACCAAACAACCCAAAAAACCTGTCAAGGCCTCTGCCCGGGCAGGTTCACGG
ACCAGCCTGCAGGGGGAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCCCGAGACCAGACTTCCAAAGACAAGCCCAAGGTGAAGACGAAA
GGACGGCCCCGGGCCGCAGCAAGCAACGAACCCAAGCCAGCAGTGCCCCCCTCCAGTGAGAAGAAGAAGCACAAGAGCTCCCTCCCTGCC
CCCTCTAAGGCTCTCTCAGGCCCAGAACCCGCGAAGGACAATGTGGAGGACAGGACCCCTGAGCACTTTGCTCTTGTTCCCCTGACTGAG
AGCCAGGGCCCACCCCACAGTGGCAGCGGCAGCAGGACTAGTGGCTGCCGCCAAGCCGTGGTGGTCCAGGAGGACAGCCGCAAAGACAGA
CTCCCATTGCCTTTGAGAGACACCAAGCTGCTCTCACCGCTCAGGGACACTCCTCCCCCACAAAGCTTGATGGTGAAGATCACCCTAGAC
CTGCTCTCTCGGATACCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGGAAAGCAGAAGATAAACAGCCGCCCGCAGGGAAGAAGCACAGC
TCTGAGAAGAGGAGCTCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGAAAGGGTGAAGCAGAAAGAGACTGTGATAACAAGAAAATCAGA
CTGGAGAAGGAAATCAAATCACAGTCATCTTCATCTTCATCCTCCCACAAAGAATCTTCTAAAACAAAGCCCTCCAGGCCCTCCTCACAG
TCCTCAAAGAAGGAAATGCTCCCCCCGCCACCCGTGTCCTCGTCCTCCCAGAAGCCAGCCAAGCCTGCACTTAAGAGGTCAAGGCGGGAA
GCAGACACCTGTGGCCAGGACCCTCCCAAAAGTGCCAGCAGTACCAAGAGCAACCACAAAGACTCTTCCATTCCCAAGCAGAGAAGAGTA
GAGGGGAAGGGCTCCAGAAGCTCCTCGGAGCACAAGGGTTCTTCCGGAGATACTGCAAATCCTTTTCCAGTGCCTTCTTTGCCAAATGGT
AACTCTAAACCAGGGAAGCCTCAAGTGAAGTTTGACAAACAACAAGCAGACCTTCACATGAGGGAGGCAAAAAAGATGAAGCAGAAAGCA
GAGTTAATGACGGACAGGGTTGGAAAGGCTTTTAAGTACCTGGAAGCCGTCTTGTCCTTCATTGAGTGCGGAATTGCCACAGAGTCTGAA
AGCCAGTCATCCAAGTCAGCTTACTCTGTCTACTCAGAAACTGTAGATCTCATTAAATTCATAATGTCATTAAAATCCTTCTCAGATGCC
ACAGCGCCAACACAAGAGAAAATATTTGCTGTTTTATGCATGCGTTGCCAGTCCATTTTGAACATGGCGATGTTTCGTTGTAAAAAAGAC
ATAGCAATAAAGTATTCTCGTACTCTTAATAAACACTTCGAGAGTTCTTCCAAAGTCGCCCAGGCACCTTCTCCATGCATTGCAAGAAGC
ACAGGCACACCATCCCCTCTTTCCCCAATGCCTTCTCCTGCCAGCTCCGTAGGGTCCCAGTCAAGTGCTGGCAGTGTGGGGAGCAGTGGG
GTGGCTGCCACTATCAGCACCCCAGTCACCATCCAGAATATGACATCTTCCTATGTCACCATCACATCCCATGTTCTTACCGCCTTTGAC
CTTTGGGAACAGGCCGAGGCCCTCACGAGGAAGAATAAAGAATTCTTTGCTCGGCTCAGCACAAATGTGTGCACCTTGGCCCTCAACAGC
AGTTTGGTGGACCTGGTGCACTATACACGACAGGGTTTTCAGCAGCTACAAGAATTAACCAAAACACCTTAATGGAGCCCCAGGTTGATT
CAATGCCTTGGGAACTATTTTTGCACATTGGAAGCCTCAAAAACAGTCCAGACATTTGTTTCATCAGGACACCAAACTCTAAAAAAGAAG
CACCACGAGATGGCCAGGACATTTGTCCACTTAAACTCTCAACAACAGTGTGATCATTGGTTGGACACTGTGGTTATGCAGAAGCAGAGA
TGAGGAGGCTGGCCCCAGAGATGATCTTGCCCTTCCTAACTAAAGGACAGAAGTGCAATTTAGCTTAAATGGGTGTATGAATGGTCTAGA
AACATTTCTATTTTTTTTTTAAACCAGCAGGATACAAGTTGCAAATGAAATGAGGAGAAACAGTTTCAACTCTGAAAGTGAATTTCACGT

>In-frame_KMT2A_ENST00000534358_chr11_118355690_+_AFF1_ENST00000395146_chr4_88005270_+_12306nt
CTGCTTCACTTCACGGGGCGAACATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGG
GGCGCCGGGGCCTAGGGGGCGCCCCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGG
CGCCCCCCTCCCCCCCGGCTGTGGCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAG
CAGCCTCCTCGTCGTCCGCCTCGTCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCG
ACGCGGCGCTGCAGGTCTCGGCCGCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCG
GAGAGGATGAGCAATTCTTAGGTTTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTC
GAAAACCTCGTGGGAGACCTAGAAGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAG
AGACCAAATCTGGAGATAAGATCAAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAA
TCAAAATAACACATGGAAAGGACATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTA
CGTTTCAGCAAGCCACAAAGATTAAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAG
GAAGGAAGGGGGTACAAATTGTACGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTG
AACTGGAAAAGCCCCAGAAAGTCCGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTC
GAAGGATTAAGCCAGTTAGGATTATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGG
CTCAAAAGAAAATTGAAAAAGAAGCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTG
TTGTCAGTGCTATCTCCTCGCGGATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGAT
TAGAGTCTACACCGAATAGTAGATTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGT
CTTCAGACTCCTCTCGATCTAGTAGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGC
GGAGCGATACCCCTGAAGTTCATCCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAG
TGTCGGAGAGAAGTTTTGGATCTAGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTC
CACCTCTGCTGACTCCACCGCCACCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAG
CATCACCATTTTTGCCTGCTTCCACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAA
AGCATTCTAGGTCAGAGCCACAATACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGAC
CCCCTCCACTAACTCCCGAGGACGTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCC
ATTCTGGAACAAGGTTTGATATGCACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTG
AGTCTGTAACCTTGCCTAGTAATCGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTC
CTATTCGATCTGAACCAAGATCTCCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCC
CGTCTTCTGTCTCTTCCTCGTTAAGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCC
TGACTCAGTCTGGGGAATCTGCAGAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTA
CTCCTCTCTTCCCTTGGTTTACCCCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAG
ATGCTGACAAGAGCGTGGAGAAGGACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAA
GGAAAAAGGGATCAGAAATTCAGAGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCA
CTTCATCTTCTGCCAAAAAAGCAACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATA
CAACAGCTGTCAAAACCAAAATACTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCC
TGGAGAAGGAGAAAACCCTCTGCCTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGG
CAGACAAGCTTCCAATGACTGACAAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTC
TTAAACAAACCGACCAGCCCAAAGCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCA
GAAGAGCAGCTGTTGCCCTTGGCCGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAA
AGATTTTGTCTTCCATGGGGAATGATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTA
AACCTGTCACTAGAAACAAGGCACCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGG
TGCCTGAGGACTGTGGTGTTTGTACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAA
AATGTCAGAATCTACAATGGATGCCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCA
GTGAAAAGAAAGACAGCAAAGAGAGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTG
CCCCAAAGAAAAGCAGTAGTGAGCCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAAT
CCAAACAGGCCACCACTCCAGCTTCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAG
GACCGCCAAGAAAAGAAGTTCCCAAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCA
AACAGAAAAAAGTGGCTCCCCGCCCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGA
ATGCAGGCACTTTGAACATCCTCAGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAG
TGGACTTTAAGGAGGATTGTGAAGCAGAAAATGTGTGGGAGATGGGAGGCTTAGGAATCTTGACTTCTGTTCCTATAACACCCAGGGTGG
TTTGCTTTCTCTGTGCCAGTAGTGGGCATGTAGAGCAGACCTACTCCAATGAAGTCCATTGTGTTGAAGAGATTCTGAAGGAAATGACCC
ATTCATGGCCGCCTCCTTTGACAGCAATACATACGCCTAGTACAGCTGAGCCATCCAAGTTTCCTTTCCCTACAAAGGACTCTCAGCATG
TCAGTTCTGTAACCCAAAACCAAAAACAATATGATACATCTTCAAAAACTCACTCAAATTCTCAGCAAGGAACGTCATCCATGCTCGAAG
ACGACCTTCAGCTCAGTGACAGTGAGGACAGTGACAGTGAACAAACCCCAGAGAAGCCTCCCTCCTCATCTGCACCTCCAAGTGCTCCAC
AGTCCCTTCCAGAACCAGTGGCATCAGCACATTCCAGCAGTGCAGAGTCAGAAAGCACCAGTGACTCAGACAGTTCCTCAGACTCAGAGA
GCGAGAGCAGTTCAAGTGACAGCGAAGAAAATGAGCCCCTAGAAACCCCAGCTCCGGAGCCTGAGCCTCCAACAACAAACAAATGGCAGC
TGGACAACTGGCTGACCAAAGTCAGCCAGCCAGCTGCGCCACCAGAGGGCCCCAGGAGCACAGAGCCCCCACGGCGGCACCCAGAGAGTA
AGGGCAGCAGCGACAGTGCCACGAGTCAGGAGCATTCTGAATCCAAAGATCCTCCCCCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCAC
CCGAAGCCCCCCACCCCGGAAAGAGGAGCTGTCAGAAGTCTCCGGCACAGCAGGAGCCCCCACAAAGGCAAACCGTTGGAACCAAACAAC
CCAAAAAACCTGTCAAGGCCTCTGCCCGGGCAGGTTCACGGACCAGCCTGCAGGGGGAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCCC
GAGACCAGACTTCCAAAGACAAGCCCAAGGTGAAGACGAAAGGACGGCCCCGGGCCGCAGCAAGCAACGAACCCAAGCCAGCAGTGCCCC
CCTCCAGTGAGAAGAAGAAGCACAAGAGCTCCCTCCCTGCCCCCTCTAAGGCTCTCTCAGGCCCAGAACCCGCGAAGGACAATGTGGAGG
ACAGGACCCCTGAGCACTTTGCTCTTGTTCCCCTGACTGAGAGCCAGGGCCCACCCCACAGTGGCAGCGGCAGCAGGACTAGTGGCTGCC
GCCAAGCCGTGGTGGTCCAGGAGGACAGCCGCAAAGACAGACTCCCATTGCCTTTGAGAGACACCAAGCTGCTCTCACCGCTCAGGGACA
CTCCTCCCCCACAAAGCTTGATGGTGAAGATCACCCTAGACCTGCTCTCTCGGATACCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGGA
AAGCAGAAGATAAACAGCCGCCCGCAGGGAAGAAGCACAGCTCTGAGAAGAGGAGCTCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGAA
AGGGTGAAGCAGAAAGAGACTGTGATAACAAGAAAATCAGACTGGAGAAGGAAATCAAATCACAGTCATCTTCATCTTCATCCTCCCACA
AAGAATCTTCTAAAACAAAGCCCTCCAGGCCCTCCTCACAGTCCTCAAAGAAGGAAATGCTCCCCCCGCCACCCGTGTCCTCGTCCTCCC
AGAAGCCAGCCAAGCCTGCACTTAAGAGGTCAAGGCGGGAAGCAGACACCTGTGGCCAGGACCCTCCCAAAAGTGCCAGCAGTACCAAGA
GCAACCACAAAGACTCTTCCATTCCCAAGCAGAGAAGAGTAGAGGGGAAGGGCTCCAGAAGCTCCTCGGAGCACAAGGGTTCTTCCGGAG
ATACTGCAAATCCTTTTCCAGTGCCTTCTTTGCCAAATGGTAACTCTAAACCAGGGAAGCCTCAAGTGAAGTTTGACAAACAACAAGCAG
ACCTTCACATGAGGGAGGCAAAAAAGATGAAGCAGAAAGCAGAGTTAATGACGGACAGGGTTGGAAAGGCTTTTAAGTACCTGGAAGCCG
TCTTGTCCTTCATTGAGTGCGGAATTGCCACAGAGTCTGAAAGCCAGTCATCCAAGTCAGCTTACTCTGTCTACTCAGAAACTGTAGATC
TCATTAAATTCATAATGTCATTAAAATCCTTCTCAGATGCCACAGCGCCAACACAAGAGAAAATATTTGCTGTTTTATGCATGCGTTGCC
AGTCCATTTTGAACATGGCGATGTTTCGTTGTAAAAAAGACATAGCAATAAAGTATTCTCGTACTCTTAATAAACACTTCGAGAGTTCTT
CCAAAGTCGCCCAGGCACCTTCTCCATGCATTGCAAGAAGCACAGGCACACCATCCCCTCTTTCCCCAATGCCTTCTCCTGCCAGCTCCG
TAGGGTCCCAGTCAAGTGCTGGCAGTGTGGGGAGCAGTGGGGTGGCTGCCACTATCAGCACCCCAGTCACCATCCAGAATATGACATCTT
CCTATGTCACCATCACATCCCATGTTCTTACCGCCTTTGACCTTTGGGAACAGGCCGAGGCCCTCACGAGGAAGAATAAAGAATTCTTTG
CTCGGCTCAGCACAAATGTGTGCACCTTGGCCCTCAACAGCAGTTTGGTGGACCTGGTGCACTATACACGACAGGGTTTTCAGCAGCTAC
AAGAATTAACCAAAACACCTTAATGGAGCCCCAGGTTGATTCAATGCCTTGGGAACTATTTTTGCACATTGGAAGCCTCAAAAACAGTCC
AGACATTTGTTTCATCAGGACACCAAACTCTAAAAAAGAAGCACCACGAGATGGCCAGGACATTTGTCCACTTAAACTCTCAACAACAGT
GTGATCATTGGTTGGACACTGTGGTTATGCAGAAGCAGAGATGAGGAGGCTGGCCCCAGAGATGATCTTGCCCTTCCTAACTAAAGGACA
GAAGTGCAATTTAGCTTAAATGGGTGTATGAATGGTCTAGAAACATTTCTATTTTTTTTTTAAACCAGCAGGATACAAGTTGCAAATGAA
ATGAGGAGAAACAGTTTCAACTCTGAAAGTGAATTTCACGTCATCTCAGTAGCCACGCTAGTCCATTCCCAGAAGGAAATTTTTTTTTTT
AACAATGACTTTTGGTAAAGGGTTTTGTGGATGATTTTTTTTCTTTTGAGTTTTGGGAGAAATATTTGTTTAGTAACTTCTAATGGCCAT
CTGTAAACCATAAGTAATGAAGGACTCCACTGTGCCCCACTTTCTGCCAATGAACAGTGGCTTGATAATACCAAGTATTGTTGTAATTTA
TAAAATTGAAGGCAACCCCCGCTCCTGCCGCCCCCAATCTCCCCATTGCCTAGAGCGCTGCACATTGACCCCAGCTCTGACTTCTCATTA
CTGTGCTGAAAGTCAGCCCACGTCGGAGCGGTGAGGAGGAGCCACAGCACATGGGGTGCCACCTCGAGGTCTGCACAGGAGGACTTGGCG
CTGCCATTTCCTACCCCTGCCATTTCCCACCCCTGCTTCAGCGAAAGGGACTCTCTAACAGGGCAGTCACTGTTGACTCTATTCTGAATT
TCCTCCCTTGGGGAAGAAGGGAACCAACATTTATACCTGACCAGATGGCTAAAGTGCTTTTAAAGTTTTGTTTAAGTAGAGCTGGAATTT
GAGGTGCTGATCTGTGGTCTACAGTTATGTGGTAACTCATGTTGTCCAGCCAACTCAGAGTTTCGTCAGTGAACAAGAAACATGAAATCT
GCTTCTTAGAGAGGCTATATTTTTCTGCTACAAATATTTTATATTTATAGCAAAACTAGACTTTCAGAGTCCTTGATTGTCTAGGGGAAG
TTAACTCCCTGAGAGGATGTAGAGATTTGGGGTGGTTGATTAGACTTTTGAAAAACTCATCACCACATGCCTTCACTCCAGAGTGTTCTC
AGCTAGATTTGATTTGGTTGAGGAGGAACTGTGGCCCTCCGTAAGTTATTGCCATAGTGTATGCATTAAACCAAGTCCATTTTGAATGAC
CTAAAATGAAGTAACACAATCAGAAATCCCATGTGCCCATAAGCACAGATTTTTCTTTTTCATTGAAACTTTAAAGGTTATTATTGGAAA
CATTACTTTGAGTGCAGTGTTTTTAAAAGCCAATTCTTTTTTATCCCTTTTAGAAGTAGAATTTGCACACTTACTACAATTGAGGAGTGT
CATCTCTATAACTTTTTCTCCGCCTTTGTCCCATTCTGCCCCTGTACATGTTTCCTACCAAGCATGTTTCACATTTTCCTATTAGTGGAG
GAGGGAGAACCATATTTATTTATAATGAAGACATCTAAGATCCCTATGATGAATGCAGGAACTCTCTTGGTAGTTTGTAAATACACAAAG
GGATGTGTCGAGGGATGGGAGCGATGCTTATCTCTCACAGTGTGAGTGGTCTGTGTGAGGCTGTTCCTTCAGTTTCTTCTCCAGACTGTT
CTTTGGTTGTCACTAAGTCAGAGGTCTGGTCCCTCATGTTTAGGTGAAAGCCAGAGAATGACAGCTGTAGTCATATCTGAGCATAAGACC
TTGATGTGTGATTCCTGATGACCGGTTTCATTTATTCATGTTATAAAGCAAAGCCCTGGTCCTTTTTAAACTACTAGTTTTAAAAACCTG
TGTTAAATGAACAGTAATTGCCTGGTAGGTTTGGTGTGTGTGTAGCATTGTGTGTCCATCTGTTATATGTAAAGGACAAGGCACCAGAAT
CAGGCTTTATTTCGATATTGAAGATGTTATTTAACATCTTTCTTTTTTCCTTACTCCCTTAGCCATCCCCTCCCCTTTTGTCCTATCATT
CCCTAGAACAAGCCACCTGTCAATTGTGAAGGGTTGTGTTCTTTATGGCAGGTTCTATGCAGATTGTGCCAGAGCATGTGCGTGTTCTGT
TGGCAAGCCACAGTGCTCCCTTGACTGAAGACATTTCCAGGTAGATTTCTCAGCCAGCTCTAAAACAGATTGCTTTTTCAGTGGCCTTAC
TCTTTGTGGGTTTTTTTTTTTTTCTCTGAACTTGATATAAAGATTTTATTTGTCCCTTGAAAAAGTAACAAATGTGCATAGATCAATTTG
TACTACTTTGGTCATTGGATATTTCTGATCCTTATTGCATTGTACCTAAAGGAGAGTAACTAATGGTAACCTTTTTAATAGAGTATGTGA
AAGGTAGTGGCTGATGAATCCTTAACGTTCATAGGGTCTTTTTGCTGTTACGGTTGTATATAGAGGTCTGAAGGATTTTTAAAATGATTT
GCACTTTTTCACTGCATGCTTACAATTCCCAAAGGCAAAATCTGTACTGAGGTAGATCATTTGAAAGGGCTAGATTATAAAATTAAGCCT
TAGAGTATGGAAAGTTCTTATAACAATAATAGTACACACTTCAGAGTAAGACAAATGCAAAGCATCTTAAGGAGTGAAAATAGAGTGTAA
ATCTTGCCTTTGGCACTACAAGGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTCTTTAGTAGGAAATGGAAGAACACTGTTTTATTTTT
TAAAGTGTTTAATGTTTCTGTCCTTTCTGTGAATTATTGAATTTAAGAGCCCTGCTAAATAATGAAAAAACACTTTACTAAAATTTATCA
AATTATACTGGGTTCGGATTGTGAAAACATTGGCCACCTAGTAGCAGTGGTGAGGAGTGGGAGGGCCCAGCAAGCATTTATCAGAAATAG
AATCACAATAGGAGGAGAATTTGACTGTCTGATATTATGATTTGATTACAATACTGAATGGGAAAAGTATCTAATATTTTGTAACAAAAA
GACCTTCATATTATCTGTTTTGACCAAAATATGTAGCTATTTCCCTTACACAGATTGGACCGCACTTATCTCCCTTGTCCTGTATCCTTT
AATTTCAGGTCTCAGGATGTTTAGAAAGCTAAAACCCCCTACCCCTTTCTGGCTGAAAACTTGCCTTATTTGGTATCTTACACATTAATG
TTACTAGCATCAGGAGCTTACTGTTTTATTATGATTCATCTTCAGTAATTTTTAGAAGCAAGAAGAAAGCCATTGTGTCCTCTACAATTA
ACAAAACTTATCTCTGATATACAAAGGGATATAAATATATACACTTAAATAGAGAAAAAGAGGTTGATTGAATTGTGCCTTTGAGTGAAC
CCAGTTTTTAAATACCGCTGTGTTTGTTTCGCCATGGCTTCAGGGATGCTACATGGCTCTTGCACCTTTTACTCCTCTGCTTTATGAAGT
TTGAGTTGTATTTGTGCATCTTAAAGTAGGTTGAGGCTTGAGGCTGGGCTTTCGGGTTTTTTTGTTTTTTGTTTTGTTTTGTTTTGTTTT
GTTTTCTTGTACTTAAACCTGCTTGCTTCCTACCACAGATTCTTTATTTTCCCAAACACTACAAAAAAACTTTTAAAACTTTGCCATTTC
ATCTGTTTACACTCTTTGCCACTGATTAGCAGTATTTAAATCTTGCAAGAATATTTTGTGCTTTCTTTAGAAACACAAGAGTATAGATTT
TTCTCACTGAAAAGTGAGAGTTACGCATTGCAGCCATGAAGGGATGCTAGGATCAATTATGGCAGTACCTTTTTTCCCCTCCTGTTCTTG
AGCCAGTTGTCTCTTTTGTTTTGGGTCCCACTTAGGATTAATGGATGTAAGGTATTTTCCTGTGCCTTTATTTTGTGTCATTCTATTGGA
AGGAGGTGTAACGGCAGAATAGCATCGTGTTGGGGGTTTTCCTTCAAACACTGCAAGTGATATTGCCACCATGTGAACCTCAAATATGCA
ATCCAGTTGTGTTGGTTTCTCGGTGACTTGGAGTGTTCATCTCTTCATGAATTGTGAGCACTGACCATGTTCTTCAGTTCTTAATTATGG
TGAGTTGACAAATACCAACTACTGCTTTTCTTTAGGTGGCTATAAATTTCTTACTGTCAGGAGGAAATGACATTATATTCTGTTCCACTG
AACGTCAGAGATCAGCAGGCACTGTACTGGGTAGAGAAGTGCCTATACTTCTCTACCTAAGAGGGCAGGAGGGAAACCCTACAGCTCCTT
GTGAGCCTATATATTAGTATATCGGCCTGGAGAGGACAAGGGAATAAGACCACTCATAGTGAGGCTGGCCAAGCTGCACTGGTCGGACCA
GGCAGTGGCTGACCTAAGGAAGACAACTTGCTTTGCTTAAAAGTAGATTTTTTAAGCAATGCTTAACACAGGCAGCATTCACCTTTGTTC
AGGCCATCGACATGTATTGTTAAAATTACTGCATATCCCCCTCAGATATCAAGTATACACTGTTCATGTTGGGGTTGTGTGTGTGTATGT
GTGTATGTACGCACGCATGTGTCCCAAATCTTGTTTTAATTTTTTTTTTCTGAATGTGATCATGTTTTGGATGATACCTGAGCAGGGTTG
CCTTTTTTTTATTTATTACCATTATATATTATATTATATTATATTATATATTTTTTGCTTTCTTATAACTTTGGAGGAAAGTCAAATCTT
GGTATTATTAAAATTGTTTTAAAAAGGAGTAAATTTTCCAGTTGATAAATGAAAATCACTGGCCTATGTTTAATAAGTTTTTCTTTAATT
ACTGTGGAATAACGTGCCAGCTATCATCAACACAATGATTTTGTACATAGGGTAGGGAAGCAGTGATGCTCTCAATGGGAAGATGTGCAA
CACAAATTAAGGGGAACTCCATGTATTTTACCTACTTCAGCAATGGAACTGCAACTTGGGGCTTTGTGAATAAAATTTAGCTGCCTTGTA
TAGTCGTTTGAAAGAATATGTGATCTGTGAGAGAATTATAGTTTTTTTTTAGAAGAAAAATCTGCAAAAGATCTTTCCAAAGACAATGTG
CCACAGATCTTTTGTTCTCTGTAATGAGGATTAATTGCTGTTTAAACAAAAATGTAATTGTTCATCTTTAAATTCTTTCCTTTTCATAAG

>In-frame_KMT2A_ENST00000534358_chr11_118355690_+_AFF1_ENST00000307808_chr4_88005270_+_12287nt
CTGCTTCACTTCACGGGGCGAACATGGCGCACAGCTGTCGGTGGCGCTTCCCCGCCCGACCCGGGACCACCGGGGGCGGCGGCGGCGGGG
GGCGCCGGGGCCTAGGGGGCGCCCCGCGGCAACGCGTCCCGGCCCTGCTGCTTCCCCCCGGGCCCCCGGTCGGCGGTGGCGGCCCCGGGG
CGCCCCCCTCCCCCCCGGCTGTGGCGGCCGCGGCGGCGGCGGCGGGAAGCAGCGGGGCTGGGGTTCCAGGGGGAGCGGCCGCCGCCTCAG
CAGCCTCCTCGTCGTCCGCCTCGTCTTCGTCTTCGTCATCGTCCTCAGCCTCTTCAGGGCCGGCCCTGCTCCGGGTGGGCCCGGGCTTCG
ACGCGGCGCTGCAGGTCTCGGCCGCCATCGGCACCAACCTGCGCCGGTTCCGGGCCGTGTTTGGGGAGAGCGGCGGGGGAGGCGGCAGCG
GAGAGGATGAGCAATTCTTAGGTTTTGGCTCAGATGAAGAAGTCAGAGTGCGAAGTCCCACAAGGTCTCCTTCAGTTAAAACTAGTCCTC
GAAAACCTCGTGGGAGACCTAGAAGTGGCTCTGACCGAAATTCAGCTATCCTCTCAGATCCATCTGTGTTTTCCCCTCTAAATAAATCAG
AGACCAAATCTGGAGATAAGATCAAGAAGAAAGATTCTAAAAGTATAGAAAAGAAGAGAGGAAGACCTCCCACCTTCCCTGGAGTAAAAA
TCAAAATAACACATGGAAAGGACATTTCAGAGTTACCAAAGGGAAACAAAGAAGATAGCCTGAAAAAAATTAAAAGGACACCTTCTGCTA
CGTTTCAGCAAGCCACAAAGATTAAAAAATTAAGAGCAGGTAAACTCTCTCCTCTCAAGTCTAAGTTTAAGACAGGGAAGCTTCAAATAG
GAAGGAAGGGGGTACAAATTGTACGACGGAGAGGAAGGCCTCCATCAACAGAAAGGATAAAGACCCCTTCGGGTCTCCTCATTAATTCTG
AACTGGAAAAGCCCCAGAAAGTCCGGAAAGACAAGGAAGGAACACCTCCACTTACAAAAGAAGATAAGACAGTTGTCAGACAAAGCCCTC
GAAGGATTAAGCCAGTTAGGATTATTCCTTCTTCAAAAAGGACAGATGCAACCATTGCTAAGCAACTCTTACAGAGGGCAAAAAAGGGGG
CTCAAAAGAAAATTGAAAAAGAAGCAGCTCAGCTGCAGGGAAGAAAGGTGAAGACACAGGTCAAAAATATTCGACAGTTCATCATGCCTG
TTGTCAGTGCTATCTCCTCGCGGATCATTAAGACCCCTCGGCGGTTTATAGAGGATGAGGATTATGACCCTCCAATTAAAATTGCCCGAT
TAGAGTCTACACCGAATAGTAGATTCAGTGCCCCGTCCTGTGGATCTTCTGAAAAATCAAGTGCAGCTTCTCAGCACTCCTCTCAAATGT
CTTCAGACTCCTCTCGATCTAGTAGCCCCAGTGTTGATACCTCCACAGACTCTCAGGCTTCTGAGGAGATTCAGGTACTTCCTGAGGAGC
GGAGCGATACCCCTGAAGTTCATCCTCCACTGCCCATTTCCCAGTCCCCAGAAAATGAGAGTAATGATAGGAGAAGCAGAAGGTATTCAG
TGTCGGAGAGAAGTTTTGGATCTAGAACGACGAAAAAATTATCAACTCTACAAAGTGCCCCCCAGCAGCAGACCTCCTCGTCTCCACCTC
CACCTCTGCTGACTCCACCGCCACCACTGCAGCCAGCCTCCAGTATCTCTGACCACACACCTTGGCTTATGCCTCCAACAATCCCCTTAG
CATCACCATTTTTGCCTGCTTCCACTGCTCCTATGCAAGGGAAGCGAAAATCTATTTTGCGAGAACCGACATTTAGGTGGACTTCTTTAA
AGCATTCTAGGTCAGAGCCACAATACTTTTCCTCAGCAAAGTATGCCAAAGAAGGTCTTATTCGCAAACCAATATTTGATAATTTCCGAC
CCCCTCCACTAACTCCCGAGGACGTTGGCTTTGCATCTGGTTTTTCTGCATCTGGTACCGCTGCTTCAGCCCGATTGTTTTCGCCACTCC
ATTCTGGAACAAGGTTTGATATGCACAAAAGGAGCCCTCTTCTGAGAGCTCCAAGATTTACTCCAAGTGAGGCTCACTCTAGAATATTTG
AGTCTGTAACCTTGCCTAGTAATCGAACTTCTGCTGGAACATCTTCTTCAGGAGTATCCAATAGAAAAAGGAAAAGAAAAGTGTTTAGTC
CTATTCGATCTGAACCAAGATCTCCTTCTCACTCCATGAGGACAAGAAGTGGAAGGCTTAGTAGTTCTGAGCTCTCACCTCTCACCCCCC
CGTCTTCTGTCTCTTCCTCGTTAAGCATTTCTGTTAGTCCTCTTGCCACTAGTGCCTTAAACCCAACTTTTACTTTTCCTTCTCATTCCC
TGACTCAGTCTGGGGAATCTGCAGAGAAAAATCAGAGACCAAGGAAGCAGACTAGTGCTCCGGCAGAGCCATTTTCATCAAGTAGTCCTA
CTCCTCTCTTCCCTTGGTTTACCCCAGGCTCTCAGACTGAAAGAGGGAGAAATAAAGACAAGGCCCCCGAGGAGCTGTCCAAAGATCGAG
ATGCTGACAAGAGCGTGGAGAAGGACAAGAGTAGAGAGAGAGACCGGGAGAGAGAAAAGGAGAATAAGCGGGAGTCAAGGAAAGAGAAAA
GGAAAAAGGGATCAGAAATTCAGAGTAGTTCTGCTTTGTATCCTGTGGGTAGGGTTTCCAAAGAGAAGGTTGTTGGTGAAGATGTTGCCA
CTTCATCTTCTGCCAAAAAAGCAACAGGGCGGAAGAAGTCTTCATCACATGATTCTGGGACTGATATTACTTCTGTGACTCTTGGGGATA
CAACAGCTGTCAAAACCAAAATACTTATAAAGAAAGGGAGAGGAAATCTGGAAAAAACCAACTTGGACCTCGGCCCAACTGCCCCATCCC
TGGAGAAGGAGAAAACCCTCTGCCTTTCCACTCCTTCATCTAGCACTGTTAAACATTCCACTTCCTCCATAGGCTCCATGTTGGCTCAGG
CAGACAAGCTTCCAATGACTGACAAGAGGGTTGCCAGCCTCCTAAAAAAGGCCAAAGCTCAGCTCTGCAAGATTGAGAAGAGTAAGAGTC
TTAAACAAACCGACCAGCCCAAAGCACAGGGTCAAGAAAGTGACTCATCAGAGACCTCTGTGCGAGGACCCCGGATTAAACATGTCTGCA
GAAGAGCAGCTGTTGCCCTTGGCCGAAAACGAGCTGTGTTTCCTGATGACATGCCCACCCTGAGTGCCTTACCATGGGAAGAACGAGAAA
AGATTTTGTCTTCCATGGGGAATGATGACAAGTCATCAATTGCTGGCTCAGAAGATGCTGAACCTCTTGCTCCACCCATCAAACCAATTA
AACCTGTCACTAGAAACAAGGCACCCCAGGAACCTCCAGTAAAGAAAGGACGTCGATCGAGGCGGTGTGGGCAGTGTCCCGGCTGCCAGG
TGCCTGAGGACTGTGGTGTTTGTACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAGTGCTGCAAGATGAGAA
AATGTCAGAATCTACAATGGATGCCTTCCAAAGCCTACCTGCAGAAGCAAGCTAAAGCTGTGAAAAAGAAAGAGAAAAAGTCTAAGACCA
GTGAAAAGAAAGACAGCAAAGAGAGCAGTGTTGTGAAGAACGTGGTGGACTCTAGTCAGAAACCTACCCCATCAGCAAGAGAGGATCCTG
CCCCAAAGAAAAGCAGTAGTGAGCCTCCTCCACGAAAGCCCGTCGAGGAAAAGAGTGAAGAAGGGAATGTCTCGGCCCCTGGGCCTGAAT
CCAAACAGGCCACCACTCCAGCTTCCAGGAAGTCAAGCAAGCAGGTCTCCCAGCCAGCACTGGTCATCCCGCCTCAGCCACCTACTACAG
GACCGCCAAGAAAAGAAGTTCCCAAAACCACTCCTAGTGAGCCCAAGAAAAAGCAGCCTCCACCACCAGAATCAGGTCCAGAGCAGAGCA
AACAGAAAAAAGTGGCTCCCCGCCCAAGTATCCCTGTAAAACAAAAACCAAAAGAAAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGA
ATGCAGGCACTTTGAACATCCTCAGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAG
TGGACTTTAAGGAGGATTGTGAAGCAGAAAATGTGTGGGAGATGGGAGGCTTAGGAATCTTGACTTCTGTTCCTATAACACCCAGGGTGG
TTTGCTTTCTCTGTGCCAGTAGTGGGCATGTAGAGCAGACCTACTCCAATGAAGTCCATTGTGTTGAAGAGATTCTGAAGGAAATGACCC
ATTCATGGCCGCCTCCTTTGACAGCAATACATACGCCTAGTACAGCTGAGCCATCCAAGTTTCCTTTCCCTACAAAGGACTCTCAGCATG
TCAGTTCTGTAACCCAAAACCAAAAACAATATGATACATCTTCAAAAACTCACTCAAATTCTCAGCAAGGAACGTCATCCATGCTCGAAG
ACGACCTTCAGCTCAGTGACAGTGAGGACAGTGACAGTGAACAAACCCCAGAGAAGCCTCCCTCCTCATCTGCACCTCCAAGTGCTCCAC
AGTCCCTTCCAGAACCAGTGGCATCAGCACATTCCAGCAGTGCAGAGTCAGAAAGCACCAGTGACTCAGACAGTTCCTCAGACTCAGAGA
GCGAGAGCAGTTCAAGTGACAGCGAAGAAAATGAGCCCCTAGAAACCCCAGCTCCGGAGCCTGAGCCTCCAACAACAAACAAATGGCAGC
TGGACAACTGGCTGACCAAAGTCAGCCAGCCAGCTGCGCCACCAGAGGGCCCCAGGAGCACAGAGCCCCCACGGCGGCACCCAGAGAGTA
AGGGCAGCAGCGACAGTGCCACGAGTCAGGAGCATTCTGAATCCAAAGATCCTCCCCCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCAC
CCGAAGCCCCCCACCCCGGAAAGAGGAGCTGTCAGAAGTCTCCGGCACAGCAGGAGCCCCCACAAAGGCAAACCGTTGGAACCAAACAAC
CCAAAAAACCTGTCAAGGCCTCTGCCCGGGCAGGTTCACGGACCAGCCTGCAGGGGGAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCCC
GAGACCAGACTTCCAAAGACAAGCCCAAGGTGAAGACGAAAGGACGGCCCCGGGCCGCAGCAAGCAACGAACCCAAGCCAGCAGTGCCCC
CCTCCAGTGAGAAGAAGAAGCACAAGAGCTCCCTCCCTGCCCCCTCTAAGGCTCTCTCAGGCCCAGAACCCGCGAAGGACAATGTGGAGG
ACAGGACCCCTGAGCACTTTGCTCTTGTTCCCCTGACTGAGAGCCAGGGCCCACCCCACAGTGGCAGCGGCAGCAGGACTAGTGGCTGCC
GCCAAGCCGTGGTGGTCCAGGAGGACAGCCGCAAAGACAGACTCCCATTGCCTTTGAGAGACACCAAGCTGCTCTCACCGCTCAGGGACA
CTCCTCCCCCACAAAGCTTGATGGTGAAGATCACCCTAGACCTGCTCTCTCGGATACCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGGA
AAGCAGAAGATAAACAGCCGCCCGCAGGGAAGAAGCACAGCTCTGAGAAGAGGAGCTCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGAA
AGGGTGAAGCAGAAAGAGACTGTGATAACAAGAAAATCAGACTGGAGAAGGAAATCAAATCACAGTCATCTTCATCTTCATCCTCCCACA
AAGAATCTTCTAAAACAAAGCCCTCCAGGCCCTCCTCACAGTCCTCAAAGAAGGAAATGCTCCCCCCGCCACCCGTGTCCTCGTCCTCCC
AGAAGCCAGCCAAGCCTGCACTTAAGAGGTCAAGGCGGGAAGCAGACACCTGTGGCCAGGACCCTCCCAAAAGTGCCAGCAGTACCAAGA
GCAACCACAAAGACTCTTCCATTCCCAAGCAGAGAAGAGTAGAGGGGAAGGGCTCCAGAAGCTCCTCGGAGCACAAGGGTTCTTCCGGAG
ATACTGCAAATCCTTTTCCAGTGCCTTCTTTGCCAAATGGTAACTCTAAACCAGGGAAGCCTCAAGTGAAGTTTGACAAACAACAAGCAG
ACCTTCACATGAGGGAGGCAAAAAAGATGAAGCAGAAAGCAGAGTTAATGACGGACAGGGTTGGAAAGGCTTTTAAGTACCTGGAAGCCG
TCTTGTCCTTCATTGAGTGCGGAATTGCCACAGAGTCTGAAAGCCAGTCATCCAAGTCAGCTTACTCTGTCTACTCAGAAACTGTAGATC
TCATTAAATTCATAATGTCATTAAAATCCTTCTCAGATGCCACAGCGCCAACACAAGAGAAAATATTTGCTGTTTTATGCATGCGTTGCC
AGTCCATTTTGAACATGGCGATGTTTCGTTGTAAAAAAGACATAGCAATAAAGTATTCTCGTACTCTTAATAAACACTTCGAGAGTTCTT
CCAAAGTCGCCCAGGCACCTTCTCCATGCATTGCAAGCACAGGCACACCATCCCCTCTTTCCCCAATGCCTTCTCCTGCCAGCTCCGTAG
GGTCCCAGTCAAGTGCTGGCAGTGTGGGGAGCAGTGGGGTGGCTGCCACTATCAGCACCCCAGTCACCATCCAGAATATGACATCTTCCT
ATGTCACCATCACATCCCATGTTCTTACCGCCTTTGACCTTTGGGAACAGGCCGAGGCCCTCACGAGGAAGAATAAAGAATTCTTTGCTC
GGCTCAGCACAAATGTGTGCACCTTGGCCCTCAACAGCAGTTTGGTGGACCTGGTGCACTATACACGACAGGGTTTTCAGCAGCTACAAG
AATTAACCAAAACACCTTAATGGAGCCCCAGGTTGATTCAATGCCTTGGGAACTATTTTTGCACATTGGAAGCCTCAAAAACAGTCCAGA
CATTTGTTTCATCAGGACACCAAACTCTAAAAAAGAAGCACCACGAGATGGCCAGGACATTTGTCCACTTAAACTCTCAACAACAGTGTG
ATCATTGGTTGGACACTGTGGTTATGCAGAAGCAGAGATGAGGAGGCTGGCCCCAGAGATGATCTTGCCCTTCCTAACTAAAGGACAGAA
GTGCAATTTAGCTTAAATGGGTGTATGAATGGTCTAGAAACATTTCTATTTTTTTTTTAAACCAGCAGGATACAAGTTGCAAATGAAATG
AGGAGAAACAGTTTCAACTCTGAAAGTGAATTTCACGTCATCTCAGTAGCCACGCTAGTCCATTCCCAGAAGGAAATTTTTTTTTTTAAC
AATGACTTTTGGTAAAGGGTTTTGTGGATGATTTTTTTTCTTTTGAGTTTTGGGAGAAATATTTGTTTAGTAACTTCTAATGGCCATCTG
TAAACCATAAGTAATGAAGGACTCCACTGTGCCCCACTTTCTGCCAATGAACAGTGGCTTGATAATACCAAGTATTGTTGTAATTTATAA
AATTGAAGGCAACCCCCGCTCCTGCCGCCCCCAATCTCCCCATTGCCTAGAGCGCTGCACATTGACCCCAGCTCTGACTTCTCATTACTG
TGCTGAAAGTCAGCCCACGTCGGAGCGGTGAGGAGGAGCCACAGCACATGGGGTGCCACCTCGAGGTCTGCACAGGAGGACTTGGCGCTG
CCATTTCCTACCCCTGCCATTTCCCACCCCTGCTTCAGCGAAAGGGACTCTCTAACAGGGCAGTCACTGTTGACTCTATTCTGAATTTCC
TCCCTTGGGGAAGAAGGGAACCAACATTTATACCTGACCAGATGGCTAAAGTGCTTTTAAAGTTTTGTTTAAGTAGAGCTGGAATTTGAG
GTGCTGATCTGTGGTCTACAGTTATGTGGTAACTCATGTTGTCCAGCCAACTCAGAGTTTCGTCAGTGAACAAGAAACATGAAATCTGCT
TCTTAGAGAGGCTATATTTTTCTGCTACAAATATTTTATATTTATAGCAAAACTAGACTTTCAGAGTCCTTGATTGTCTAGGGGAAGTTA
ACTCCCTGAGAGGATGTAGAGATTTGGGGTGGTTGATTAGACTTTTGAAAAACTCATCACCACATGCCTTCACTCCAGAGTGTTCTCAGC
TAGATTTGATTTGGTTGAGGAGGAACTGTGGCCCTCCGTAAGTTATTGCCATAGTGTATGCATTAAACCAAGTCCATTTTGAATGACCTA
AAATGAAGTAACACAATCAGAAATCCCATGTGCCCATAAGCACAGATTTTTCTTTTTCATTGAAACTTTAAAGGTTATTATTGGAAACAT
TACTTTGAGTGCAGTGTTTTTAAAAGCCAATTCTTTTTTATCCCTTTTAGAAGTAGAATTTGCACACTTACTACAATTGAGGAGTGTCAT
CTCTATAACTTTTTCTCCGCCTTTGTCCCATTCTGCCCCTGTACATGTTTCCTACCAAGCATGTTTCACATTTTCCTATTAGTGGAGGAG
GGAGAACCATATTTATTTATAATGAAGACATCTAAGATCCCTATGATGAATGCAGGAACTCTCTTGGTAGTTTGTAAATACACAAAGGGA
TGTGTCGAGGGATGGGAGCGATGCTTATCTCTCACAGTGTGAGTGGTCTGTGTGAGGCTGTTCCTTCAGTTTCTTCTCCAGACTGTTCTT
TGGTTGTCACTAAGTCAGAGGTCTGGTCCCTCATGTTTAGGTGAAAGCCAGAGAATGACAGCTGTAGTCATATCTGAGCATAAGACCTTG
ATGTGTGATTCCTGATGACCGGTTTCATTTATTCATGTTATAAAGCAAAGCCCTGGTCCTTTTTAAACTACTAGTTTTAAAAACCTGTGT
TAAATGAACAGTAATTGCCTGGTAGGTTTGGTGTGTGTGTAGCATTGTGTGTCCATCTGTTATATGTAAAGGACAAGGCACCAGAATCAG
GCTTTATTTCGATATTGAAGATGTTATTTAACATCTTTCTTTTTTCCTTACTCCCTTAGCCATCCCCTCCCCTTTTGTCCTATCATTCCC
TAGAACAAGCCACCTGTCAATTGTGAAGGGTTGTGTTCTTTATGGCAGGTTCTATGCAGATTGTGCCAGAGCATGTGCGTGTTCTGTTGG
CAAGCCACAGTGCTCCCTTGACTGAAGACATTTCCAGGTAGATTTCTCAGCCAGCTCTAAAACAGATTGCTTTTTCAGTGGCCTTACTCT
TTGTGGGTTTTTTTTTTTTTCTCTGAACTTGATATAAAGATTTTATTTGTCCCTTGAAAAAGTAACAAATGTGCATAGATCAATTTGTAC
TACTTTGGTCATTGGATATTTCTGATCCTTATTGCATTGTACCTAAAGGAGAGTAACTAATGGTAACCTTTTTAATAGAGTATGTGAAAG
GTAGTGGCTGATGAATCCTTAACGTTCATAGGGTCTTTTTGCTGTTACGGTTGTATATAGAGGTCTGAAGGATTTTTAAAATGATTTGCA
CTTTTTCACTGCATGCTTACAATTCCCAAAGGCAAAATCTGTACTGAGGTAGATCATTTGAAAGGGCTAGATTATAAAATTAAGCCTTAG
AGTATGGAAAGTTCTTATAACAATAATAGTACACACTTCAGAGTAAGACAAATGCAAAGCATCTTAAGGAGTGAAAATAGAGTGTAAATC
TTGCCTTTGGCACTACAAGGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTCTTTAGTAGGAAATGGAAGAACACTGTTTTATTTTTTAA
AGTGTTTAATGTTTCTGTCCTTTCTGTGAATTATTGAATTTAAGAGCCCTGCTAAATAATGAAAAAACACTTTACTAAAATTTATCAAAT
TATACTGGGTTCGGATTGTGAAAACA