FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 19056

FusionGeneSummary for KLHL7_DNAH11

check button Fusion gene summary
Fusion gene informationFusion gene name: KLHL7_DNAH11
Fusion gene ID: 19056
HgeneTgene
Gene symbol

KLHL7

DNAH11

Gene ID

55975

8701

Gene namekelch like family member 7dynein axonemal heavy chain 11
SynonymsCISS3|KLHL6|SBBI26CILD7|DNAHBL|DNAHC11|DNHBL|DPL11
Cytomap

7p15.3

7p15.3

Type of geneprotein-codingprotein-coding
Descriptionkelch-like protein 7kelch-like 6kelch-like 7kelch/BTBdynein heavy chain 11, axonemalaxonemal beta dynein heavy chain 11axonemal dynein heavy chain 11ciliary dynein heavy chain 11dynein, axonemal, heavy polypeptide 11dynein, ciliary, heavy chain 11
Modification date2018052220180523
UniProtAcc

Q8IXQ5

Q96DT5

Ensembl transtripts involved in fusion geneENST00000322231, ENST00000339077, 
ENST00000539124, ENST00000542558, 
ENST00000409689, ENST00000545443, 
ENST00000479288, ENST00000322275, 
ENST00000410047, ENST00000545771, 
ENST00000409508, ENST00000328843, 
ENST00000465593, 
Fusion gene scores* DoF score5 X 5 X 3=754 X 4 X 4=64
# samples 54
** MAII scorelog2(5/75*10)=-0.584962500721156
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(4/64*10)=-0.678071905112638
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: KLHL7 [Title/Abstract] AND DNAH11 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneKLHL7

GO:0016567

protein ubiquitination

21828050


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLUADTCGA-55-8089-01AKLHL7chr7

23145765

+DNAH11chr7

21584624

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
5UTR-3CDSENST00000322231ENST00000409508KLHL7chr7

23145765

+DNAH11chr7

21584624

+
5UTR-3CDSENST00000322231ENST00000328843KLHL7chr7

23145765

+DNAH11chr7

21584624

+
5UTR-intronENST00000322231ENST00000465593KLHL7chr7

23145765

+DNAH11chr7

21584624

+
In-frameENST00000339077ENST00000409508KLHL7chr7

23145765

+DNAH11chr7

21584624

+
In-frameENST00000339077ENST00000328843KLHL7chr7

23145765

+DNAH11chr7

21584624

+
5CDS-intronENST00000339077ENST00000465593KLHL7chr7

23145765

+DNAH11chr7

21584624

+
5UTR-3CDSENST00000539124ENST00000409508KLHL7chr7

23145765

+DNAH11chr7

21584624

+
5UTR-3CDSENST00000539124ENST00000328843KLHL7chr7

23145765

+DNAH11chr7

21584624

+
5UTR-intronENST00000539124ENST00000465593KLHL7chr7

23145765

+DNAH11chr7

21584624

+
5UTR-3CDSENST00000542558ENST00000409508KLHL7chr7

23145765

+DNAH11chr7

21584624

+
5UTR-3CDSENST00000542558ENST00000328843KLHL7chr7

23145765

+DNAH11chr7

21584624

+
5UTR-intronENST00000542558ENST00000465593KLHL7chr7

23145765

+DNAH11chr7

21584624

+
intron-3CDSENST00000409689ENST00000409508KLHL7chr7

23145765

+DNAH11chr7

21584624

+
intron-3CDSENST00000409689ENST00000328843KLHL7chr7

23145765

+DNAH11chr7

21584624

+
intron-intronENST00000409689ENST00000465593KLHL7chr7

23145765

+DNAH11chr7

21584624

+
intron-3CDSENST00000545443ENST00000409508KLHL7chr7

23145765

+DNAH11chr7

21584624

+
intron-3CDSENST00000545443ENST00000328843KLHL7chr7

23145765

+DNAH11chr7

21584624

+
intron-intronENST00000545443ENST00000465593KLHL7chr7

23145765

+DNAH11chr7

21584624

+
3UTR-3CDSENST00000479288ENST00000409508KLHL7chr7

23145765

+DNAH11chr7

21584624

+
3UTR-3CDSENST00000479288ENST00000328843KLHL7chr7

23145765

+DNAH11chr7

21584624

+
3UTR-intronENST00000479288ENST00000465593KLHL7chr7

23145765

+DNAH11chr7

21584624

+
In-frameENST00000322275ENST00000409508KLHL7chr7

23145765

+DNAH11chr7

21584624

+
In-frameENST00000322275ENST00000328843KLHL7chr7

23145765

+DNAH11chr7

21584624

+
5CDS-intronENST00000322275ENST00000465593KLHL7chr7

23145765

+DNAH11chr7

21584624

+
intron-3CDSENST00000410047ENST00000409508KLHL7chr7

23145765

+DNAH11chr7

21584624

+
intron-3CDSENST00000410047ENST00000328843KLHL7chr7

23145765

+DNAH11chr7

21584624

+
intron-intronENST00000410047ENST00000465593KLHL7chr7

23145765

+DNAH11chr7

21584624

+
intron-3CDSENST00000545771ENST00000409508KLHL7chr7

23145765

+DNAH11chr7

21584624

+
intron-3CDSENST00000545771ENST00000328843KLHL7chr7

23145765

+DNAH11chr7

21584624

+
intron-intronENST00000545771ENST00000465593KLHL7chr7

23145765

+DNAH11chr7

21584624

+

Top

FusionProtFeatures for KLHL7_DNAH11


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
KLHL7

Q8IXQ5

DNAH11

Q96DT5

Substrate-specific adapter of a BCR (BTB-CUL3-RBX1) E3ubiquitin ligase complex. The BCR(KLHL7) complex acts by mediatingubiquitination and subsequent degradation of substrate proteins.Probably mediates 'Lys-48'-linked ubiquitination.{ECO:0000269|PubMed:21828050}. Force generating protein of respiratory cilia. Producesforce towards the minus ends of microtubules. Dynein has ATPaseactivity; the force-producing power stroke is thought to occur onrelease of ADP.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for KLHL7_DNAH11


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_KLHL7_ENST00000339077_chr7_23145765_+_DNAH11_ENST00000409508_chr7_21584624_+_4440aa
MAASGVEKSSKKKTEKKLAAREEAKLLAGFMGVMNNMRKQIPRDANHKLVFISKKITESIGVNDFSQVVLFGELPALSLGHVSAFLDEIL
VPVLSNKNNHKSWSCFTSQDMETHIEVMKKKMTIFRGKMSRRTLLPIPTVAGKMDLDQNCSENKPPSNERIILHAIESVVIEWSHQIQEI
IERDSVQRLLNGLHLSPQAELDFWMMRRENLSCITDQLQAPVVLKMVKILTTKQSSTFPTLKDIFLAVENALLEAQDVELYLRPLRRHIQ
CLQETEFPQTRILIAPLFHTICLIWSHSKFTNTPARVIVLLQEFCNLFINQATAYLSPEDLLRGEIEESLEKVQVAVNILKTFKNSFFNT
RKKLASYFMGRKLRPWDFQSHLVFCRFDKFLDRLIKIEDIFATTLEFEKLERLEFGGTKGAILNGQVHEMSEELMELCKLFKQSTTDPSD
CTNMEFESDTVAFKSKTLEFDRRLGTIICEAFFNCNGLEAAFKLLTIFGNFLEKPVVMEIFSLHYSTLVHMFNTELDVCKQLTNEHMKQI
ECGHVVLNKNMPFTSGNMKWAQQVLQRLQMFWSNFASLRTLFLGNPDHALVTQKTVEMTTLLDQFESRITNEWKSNVDEICEFNLNQPLV
KFSAINGLLCVNFDPKLVAVLREVKTLLMLKKQDIPDSALAIFKKRNTILKYIGNLDLLVQGTNKLKQTLLEVEYPLIEDELRAIDEQLT
AATTWLTWQDDCWGYIERVRAATSELEHRVERTQKNVKVIQQTMRGWARCVLPPRREHRREAAFTLEDKGDLFTKKYKLIQGDGCKIHNL
VEENRKLFKANPSLDTWKITVEFIDDIVVEGFFQAIMHDLDFFLKNTEKQLKPAPFFQAQMILLPPEIVFKPSLDREAGDGFTDLVEEML
CNSFRMSAQMNRIATHLEIKNTQNDMDNMLGLAEVRQEIMNRVVNVINKVLDFRNTLETHTYLWVDDRAEFMKHFLLTGHAVSSDEMDAH
ANEEIPEQPPTLEQFKEQIDITEALTVQMSKFEDFRVFDSWFKVDMKPFKVSLLTIIKKWSWMFQEHLLRFVIDSLNELQEFIKETDSGL
QRELNEGDHDGLVDIMVHLLAVRSRQRATDELFEPLKETITLLESTGQKMPEQVTIQLEELPERWETTKKIAATVRHEVSPLHNAEVTLI
RKKCILFDAKQAEFRERFRHTAPLGFNAENPYTALDKANEELEALEEEMLQMQESTRLFEVALPEYKQMKQCRKEIKLLKGLWDVIITVR
RSIDNWTKTQWRQIHVEQMDVELRRFAKEIWSLNKEVRVWDAYTGLEGTVKDMTASLRAITELQSPALRDRHWHQLMKAIGVKFLINEAT
TLADLLALRLHRVEDDVRRIVDKAVKELGTEKVITEISQTWATMKFSYEVHTRTGIPLLKSDEQLFETLEHNQVQLQTLLQSKTVETFIE
QVLSWQNKLNIADLVIFTWMEVQRTWSHLESIFVCSEDIRIQLVKDARRFDGVDAEFKELMFKTAKVENVLEATCRPNLTEKLKDLQSRL
SLCEKALAEYLETKRIAFPRFTFVSSADLLDILSKGAQPKQVTCHLAKLFDSIADLQFEDNQDVSAHRAVGMYSKEKETVPFQAECECVG
HVETWLLQLEQTMQETVRHSITEAIVAYEEKPRELWIFDFPAQVALTSSQIWWTTDVGIAFSRLEEGYETALKDFHKKQISQLNTLITLL
LGELPPGDRQKIMTICTIDVHARDVVAKLISQKVVSPQAFTWLSQLRHRWEDTQKHCFVNICDAQFQYFTEYLGNSPRLVITPLTDRCTI
TLTQSLHLTMSGAPAGPAGTGKTETTKDLGRALGMMVTVFNCSEQMDYKSIGNITKGLVQTGAWGCFDEFNRISVEVLSVVAVQVKMIHD
AIRNRKKRFVFLGEAITLKPSVGIFITMNPGTAGRTELPENLKALFRPCAMVAPDIELICEILLVAEGFVDARALARKFITLYTLCKELL
SKQDHYDWGLRAIKSVLVVAGSLKRGDKNRPEDQVLMRALRDFNMPKIVTDDIPVFLGLVGDLFPALDVPRRRKLHFEQMVRQSTLELRL
QPEESFILKVVQLEELLAVRHSVFVVGNAGTGKSKILRTLNRTTVNMKQKPVWNDLNPKAVTTDELFGFIHHATREWKDGKIVYSTFIGL
FSSILREQANLKHDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIALTPFMRLLFEIHHLRSATPATVSRAGILTVNPQDLGWN
PTVASWIDRRRHQSEKANLTILFDKTVPACLDKLRTSFKTITSIPESSLVQTLCVLLECLLTPENVPSDSPKEVTEVTFVFACIWAFGGT
LLQDQISDTQADFSRWWQKEMKAVKFPSQGTIFDTTVDHKTKKLLPWADKIAQFTMDPDVPLQTVLVHTTETARLRTFMELLLEKGKPLM
LVGNAGVGKTVFVGDTLASLSEDYIVSRVPFNYYTTSTALQKILEKPLEKKAGHNTGPGGNKKLITFIDDMNMPEVDLTGTVQPHTLIRQ
HIDTGHWTDRQKVMLKEIHNCQTVACMNPMVGSFTINPRLQRHFTVFAFNFPSLDALNTITGQIFSFHFQQQAFAPSILRSGPTLIQATI
AFHQTMMCNFLPTAIKFHYIFNLRDLSNVFQGILFASPECLKGPLDLIHLWLHESARVTGDKLIDKKDCDLFQRRMLETATKTFEGIDSH
MLLQQPLITCHFADRGKDPHYMPVKDWEVLKTILTETLDNYNELNAAMHLVLFEDAMQHVCRISRILRTPQGCALLVGVGGSGKQSLSRL
AAYLRGLEVFQITLTEGTGIQELRVDLANLYIRTGAKNMPTVFLLTDAQVLDESFLVLINDLLASGEIPDLFSDEDVDKIISGIHNEVHA
LGMVDSRENCWKFFMARVRLQLKIILCFSPVGRTLRVRARKFPAIVNCTAIDWFHAWPQEALVSVSRRFIEETKGIEPVHKDSISLFMAH
VHTTVNEMSTRTYQNERRHNTTTPKSFLEQISLFKNLLKKKQNEVSEKKERLVNGIQKLKTTASQVGDLKARLASQEAELQLRNHDAEAL
ITKIGLQTEKVSREKTIADAEERKVTAIQTEVFQKQRECEADLLKAEPALVAATAALNTLNRVNLSELKAFPNPPIAVTNVTAAVMVLLA
PRGRVPKDRSWKAAKVFMGKVDDFLQALINTDKEHIPENCLKVVNEHTLKDPEFNPNLIRTKSFAAAGLCAWVINIIKFTEVYCDVEPKR
QALAQANLELAAATEKLEAIRKKLVDLDRNLSRLTASFEKATAEKVRCQEEVNQTNKTIKLANRLVKELEAKKIRWGQSIKSFEAQEKTL
CGDVLLTAAFVSYVGPFTRQTRQELVHCKWVPFLQQKVSIPLTEGLDLISMLTDDATIAAWNNEGLPSDRMSTENAAILTHCERWPLVID
PQQQGIKWIKNKTGMDLKVTHLGQKGFLNAIETALAFGDVILIENLEETIDPVLDPLLGRNTIKKGKTIRIGDKECEFNKNFRLILHTKL
ANPHTKPELQAQTTLLNFTVTEDGLEAQLLAEVVSIERPDLEKLKLVLTKHQNDFKIELKTLEDDLLLRLSAAEGSFLDDTKLVERLEAT
KTTVAEIEHKVIEAKENERKINEARECYRPVAARASLLTFVINDLQKINPLYQFSLKAFNVLFHRAIEQADKVEDMQGRISILMESITHA
VFLYTSQALFEKDKLTFLSQMAFQILLRKKEIDPLELDFLLRFTVEHTHLSPVDFLTSQSWSAIKAIAVMEEFRGIDRDVEGSAKQWRKW
VESECPEKEKLPQEWKKKSLIQKLILLRAMRPDRMTTALRNFVEEKLGAKTVERTRLDLVKAFEESSPATPIFFILSPGVDALKDLEILG
KRLGFTIDSGKFHNVSLGQGQETVAEVALEKASKGGHWVILQNVHLVAKWLGTLEKLLERFSQGSHRDYRVFMSAESAPTPDEHIIPQGL
LENSIKITNEPPTGMLANLHAALYNFDQDTLEICSKEQEFKSILFSLCYFHACVAGRLRFGPQGWSRSTPFNPGDLTICASVLYNYLEAN
SKVPWEDLRTLFGEIMTGGHITDDWDRKLCRVTLEEFMNPSLTEDELMLAPGFAAPPYLDTAGYHQYIEEMLPPESPALTGLHPNAEIEF
LTVTSNTLFRTLLEMQPRNALSGDELGQSTEEKVKNVLDDILEKLPEEFNMAEIMQKNSNRSPTVLVCFQECERMNILIREIRISLEQLD
LSLKGELALSPAVEAQQFALSTDTVPDTWSKLATPSTTGLAQWFNDLLLRCRELDTWTQDLTLPAVVWLSGFFNPQSFLTAIMQTMARKN
EWPLDKTRLTADVTKKTKEDTGHPPREGAYLHGLFMEGARWDTQAGTIVEARLKELACPMPVIFAKATPVDRQETKQTYECPVTRTKLRG

>In-frame_KLHL7_ENST00000339077_chr7_23145765_+_DNAH11_ENST00000328843_chr7_21584624_+_4447aa
MAASGVEKSSKKKTEKKLAAREEAKLLAGFMGVMNNMRKQIPRDANHKLVFISKKITESIGVNDFSQVVLFGELPALSLGHVSAFLDEIL
VPVLSNKNNHKSWSCFTSQDMETHIEVMKKKMTIFRGKMSRRTLLPIPTVAGKMDLDQNCSENKPPSNERIILHAIESVVIEWSHQIQEI
IERDSVQRLLNGLHLSPQAELDFWMMRRENLSCITDQLQAPVVLKMVKILTTKQSSTFPTLKDIFLAVENALLEAQDVELYLRPLRRHIQ
CLQETEFPQTRILIAPLFHTICLIWSHSKFTNTPARVIVLLQEFCNLFINQATAYLSPEDLLRGEIEESLEKVQVAVNILKTFKNSFFNT
RKKLASYFMGRKLRPWDFQSHLVFCRFDKFLDRLIKIEDIFATTLEFEKLERLEFGGTKGAILNGQVHEMSEELMELCKLFKQSTTDPSD
CTNMEFESDTVAFKSKTLEFDRRLGTIICEAFFNCNGLEAAFKLLTIFGNFLEKPVVMEIFSLHYSTLVHMFNTELDVCKQLTNEHMKQI
ECGHVVLNKNMPFTSGNMKWAQQVLQRLQMFWSNFASLRTLFLGNPDHALVTQKTVEMTTLLDQFESRITNEWKSNVDEICEFNLNQPLV
KFSAINGLLCVNFDPKLVAVLREVKTLLMLKKQDIPDSALAIFKKRNTILKYIGNLDLLVQGTNKLKQTLLEVEYPLIEDELRAIDEQLT
AATTWLTWQDDCWGYIERVRAATSELEHRVERTQKNVKVIQQTMRGWARCVLPPRREHRREAAFTLEDKGDLFTKKYKLIQGDGCKIHNL
VEENRKLFKANPSLDTWKITVEFIDDIVVEGFFQAIMHDLDFFLKNTEKQLKPAPFFQAQMILLPPEIVFKPSLDREAGDGFTDLVEEML
CNSFRMSAQMNRIATHLEIKNTQNDMDNMLGLAEVRQEIMNRVVNVINKVLDFRNTLETHTYLWVDDRAEFMKHFLLTGHAVSSDEMDAH
ANEEIPEQPPTLEQFKEQIDITEALTVQMSKFEDFRVFDSWFKVDMKPFKVSLLTIIKKWSWMFQEHLLRFVIDSLNELQEFIKETDSGL
QRELNEGDHDGLVDIMVHLLAVRSRQRATDELFEPLKETITLLESTGQKMPEQVTIQLEELPERWETTKKIAATVRHEVSPLHNAEVTLI
RKKCILFDAKQAEFRERFRHTAPLGFNAENPYTALDKANEELEALEEEMLQMQESTRLFEVALPEYKQMKQCRKEIKLLKGLWDVIITVR
RSIDNWTKTQWRQIHVEQMDVELRRFAKASSITEIWSLNKEVRVWDAYTGLEGTVKDMTASLRAITELQSPALRDRHWHQLMKAIGVKFL
INEATTLADLLALRLHRVEDDVRRIVDKAVKELGTEKVITEISQTWATMKFSYEVHTRTGIPLLKSDEQLFETLEHNQVQLQTLLQSKTV
ETFIEQVLSWQNKLNIADLVIFTWMEVQRTWSHLESIFVCSEDIRIQLVKDARRFDGVDAEFKELMFKTAKVENVLEATCRPNLTEKLKD
LQSRLSLCEKALAEYLETKRIAFPRFTFVSSADLLDILSKGAQPKQVTCHLAKLFDSIADLQFEDNQDVSAHRAVGMYSKEKETVPFQAE
CECVGHVETWLLQLEQTMQETVRHSITEAIVAYEEKPRELWIFDFPAQVALTSSQIWWTTDVGIAFSRLEEGYETALKDFHKKQISQLNT
LITLLLGELPPGDRQKIMTICTIDVHARDVVAKLISQKQVVVSPQAFTWLSQLRHRWEDTQKHCFVNICDAQFQYFTEYLGNSPRLVITP
LTDRCTITLTQSLHLTMSGAPAGPAGTGKTETTKDLGRALGMMVTVFNCSEQMDYKSIGNITKGLVQTGAWGCFDEFNRISVEVLSVVAV
QVKMIHDAIRNRKKRFVFLGEAITLKPSVGIFITMNPGTAGRTELPENLKALFRPCAMVAPDIELICEILLVAEGFVDARALARKFITLY
TLCKELLSKQDHYDWGLRAIKSVLVVAGSLKRGDKNRPEDQVLMRALRDFNMPKIVTDDIPVFLGLVGDLFPALDVPRRRKLHFEQMVRQ
STLELRLQPEESFILKVVQLEELLAVRHSVFVVGNAGTGKSKILRTLNRTTVNMKQKPVWNDLNPKAVTTDELFGFIHHATREWKDGKIV
YSTFIGLFSSILREQANLKHDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIALTPFMRLLFEIHHLRSATPATVSRAGILTVN
PQDLGWNPTVASWIDRRRHQSEKANLTILFDKTVPACLDKLRTSFKTITSIPESSLVQTLCVLLECLLTPENVPSDSPKEVTEVTFVFAC
IWAFGGTLLQDQISDTQADFSRWWQKEMKAVKFPSQGTIFDTTVDHKTKKLLPWADKIAQFTMDPDVPLQTVLVHTTETARLRTFMELLL
EKGKPLMLVGNAGVGKTVFVGDTLASLSEDYIVSRVPFNYYTTSTALQKILEKPLEKKAGHNTGPGGNKKLITFIDDMNMPEVDLTGTVQ
PHTLIRQHIDTGHWTDRQKVMLKEIHNCQTVACMNPMVGSFTINPRLQRHFTVFAFNFPSLDALNTITGQIFSFHFQQQAFAPSILRSGP
TLIQATIAFHQTMMCNFLPTAIKFHYIFNLRDLSNVFQGILFASPECLKGPLDLIHLWLHESARVTGDKLIDKKDCDLFQRRMLETATKT
FEGIDSHMLLQQPLITCHFADRGKDPHYMPVKDWEVLKTILTETLDNYNELNAAMHLVLFEDAMQHVCRISRILRTPQGCALLVGVGGSG
KQSLSRLAAYLRGLEVFQITLTEGTGIQELRVDLANLYIRTGAKNMPTVFLLTDAQVLDESFLVLINDLLASGEIPDLFSDEDVDKIISG
IHNEVHALGMVDSRENCWKFFMARVRLQLKIILCFSPVGRTLRVRARKFPAIVNCTAIDWFHAWPQEALVSVSRRFIEETKGIEPVHKDS
ISLFMAHVHTTVNEMSTRTYQNERRHNTTTPKSFLEQISLFKNLLKKKQNEVSEKKERLVNGIQKLKTTASQVGDLKARLASQEAELQLR
NHDAEALITKIGLQTEKVSREKTIADAEERKVTAIQTEVFQKQRECEADLLKAEPALVAATAALNTLNRVNLSELKAFPNPPIAVTNVTA
AVMVLLAPRGRVPKDRSWKAAKVFMGKVDDFLQALINTDKEHIPENCLKVVNEHTLKDPEFNPNLIRTKSFAAAGLCAWVINIIKFTEVY
CDVEPKRQALAQANLELAAATEKLEAIRKKLVDLDRNLSRLTASFEKATAEKVRCQEEVNQTNKTIKLANRLVKELEAKKIRWGQSIKSF
EAQEKTLCGDVLLTAAFVSYVGPFTRQTRQELVHCKWVPFLQQKVSIPLTEGLDLISMLTDDATIAAWNNEGLPSDRMSTENAAILTHCE
RWPLVIDPQQQGIKWIKNKTGMDLKVTHLGQKGFLNAIETALAFGDVILIENLEETIDPVLDPLLGRNTIKKGKTIRIGDKECEFNKNFR
LILHTKLANPHTKPELQAQTTLLNFTVTEDGLEAQLLAEVVSIERPDLEKLKLVLTKHQNDFKIELKTLEDDLLLRLSAAEGSFLDDTKL
VERLEATKTTVAEIEHKVIEAKENERKINEARECYRPVAARASLLTFVINDLQKINPLYQFSLKAFNVLFHRAIEQADKVEDMQGRISIL
MESITHAVFLYTSQALFEKDKLTFLSQMAFQILLRKKEIDPLELDFLLRFTVEHTHLSPVDFLTSQSWSAIKAIAVMEEFRGIDRDVEGS
AKQWRKWVESECPEKEKLPQEWKKKSLIQKLILLRAMRPDRMTTALRNFVEEKLGAKTVERTRLDLVKAFEESSPATPIFFILSPGVDAL
KDLEILGKRLGFTIDSGKFHNVSLGQGQETVAEVALEKASKGGHWVILQNVHLVAKWLGTLEKLLERFSQGSHRDYRVFMSAESAPTPDE
HIIPQGLLENSIKITNEPPTGMLANLHAALYNFDQDTLEICSKEQEFKSILFSLCYFHACVAGRLRFGPQGWSRSTPFNPGDLTICASVL
YNYLEANSKVPWEDLRTLFGEIMTGGHITDDWDRKLCRVTLEEFMNPSLTEDELMLAPGFAAPPYLDTAGYHQYIEEMLPPESPALTGLH
PNAEIEFLTVTSNTLFRTLLEMQPRNALSGDELGQSTEEKVKNVLDDILEKLPEEFNMAEIMQKNSNRSPTVLVCFQECERMNILIREIR
ISLEQLDLSLKGELALSPAVEAQQFALSTDTVPDTWSKLATPSTTGLAQWFNDLLLRCRELDTWTQDLTLPAVVWLSGFFNPQSFLTAIM
QTMARKNEWPLDKTRLTADVTKKTKEDTGHPPREGAYLHGLFMEGARWDTQAGTIVEARLKELACPMPVIFAKATPVDRQETKQTYECPV

>In-frame_KLHL7_ENST00000322275_chr7_23145765_+_DNAH11_ENST00000409508_chr7_21584624_+_4440aa
MAASGVEKSSKKKTEKKLAAREEAKLLAGFMGVMNNMRKQIPRDANHKLVFISKKITESIGVNDFSQVVLFGELPALSLGHVSAFLDEIL
VPVLSNKNNHKSWSCFTSQDMETHIEVMKKKMTIFRGKMSRRTLLPIPTVAGKMDLDQNCSENKPPSNERIILHAIESVVIEWSHQIQEI
IERDSVQRLLNGLHLSPQAELDFWMMRRENLSCITDQLQAPVVLKMVKILTTKQSSTFPTLKDIFLAVENALLEAQDVELYLRPLRRHIQ
CLQETEFPQTRILIAPLFHTICLIWSHSKFTNTPARVIVLLQEFCNLFINQATAYLSPEDLLRGEIEESLEKVQVAVNILKTFKNSFFNT
RKKLASYFMGRKLRPWDFQSHLVFCRFDKFLDRLIKIEDIFATTLEFEKLERLEFGGTKGAILNGQVHEMSEELMELCKLFKQSTTDPSD
CTNMEFESDTVAFKSKTLEFDRRLGTIICEAFFNCNGLEAAFKLLTIFGNFLEKPVVMEIFSLHYSTLVHMFNTELDVCKQLTNEHMKQI
ECGHVVLNKNMPFTSGNMKWAQQVLQRLQMFWSNFASLRTLFLGNPDHALVTQKTVEMTTLLDQFESRITNEWKSNVDEICEFNLNQPLV
KFSAINGLLCVNFDPKLVAVLREVKTLLMLKKQDIPDSALAIFKKRNTILKYIGNLDLLVQGTNKLKQTLLEVEYPLIEDELRAIDEQLT
AATTWLTWQDDCWGYIERVRAATSELEHRVERTQKNVKVIQQTMRGWARCVLPPRREHRREAAFTLEDKGDLFTKKYKLIQGDGCKIHNL
VEENRKLFKANPSLDTWKITVEFIDDIVVEGFFQAIMHDLDFFLKNTEKQLKPAPFFQAQMILLPPEIVFKPSLDREAGDGFTDLVEEML
CNSFRMSAQMNRIATHLEIKNTQNDMDNMLGLAEVRQEIMNRVVNVINKVLDFRNTLETHTYLWVDDRAEFMKHFLLTGHAVSSDEMDAH
ANEEIPEQPPTLEQFKEQIDITEALTVQMSKFEDFRVFDSWFKVDMKPFKVSLLTIIKKWSWMFQEHLLRFVIDSLNELQEFIKETDSGL
QRELNEGDHDGLVDIMVHLLAVRSRQRATDELFEPLKETITLLESTGQKMPEQVTIQLEELPERWETTKKIAATVRHEVSPLHNAEVTLI
RKKCILFDAKQAEFRERFRHTAPLGFNAENPYTALDKANEELEALEEEMLQMQESTRLFEVALPEYKQMKQCRKEIKLLKGLWDVIITVR
RSIDNWTKTQWRQIHVEQMDVELRRFAKEIWSLNKEVRVWDAYTGLEGTVKDMTASLRAITELQSPALRDRHWHQLMKAIGVKFLINEAT
TLADLLALRLHRVEDDVRRIVDKAVKELGTEKVITEISQTWATMKFSYEVHTRTGIPLLKSDEQLFETLEHNQVQLQTLLQSKTVETFIE
QVLSWQNKLNIADLVIFTWMEVQRTWSHLESIFVCSEDIRIQLVKDARRFDGVDAEFKELMFKTAKVENVLEATCRPNLTEKLKDLQSRL
SLCEKALAEYLETKRIAFPRFTFVSSADLLDILSKGAQPKQVTCHLAKLFDSIADLQFEDNQDVSAHRAVGMYSKEKETVPFQAECECVG
HVETWLLQLEQTMQETVRHSITEAIVAYEEKPRELWIFDFPAQVALTSSQIWWTTDVGIAFSRLEEGYETALKDFHKKQISQLNTLITLL
LGELPPGDRQKIMTICTIDVHARDVVAKLISQKVVSPQAFTWLSQLRHRWEDTQKHCFVNICDAQFQYFTEYLGNSPRLVITPLTDRCTI
TLTQSLHLTMSGAPAGPAGTGKTETTKDLGRALGMMVTVFNCSEQMDYKSIGNITKGLVQTGAWGCFDEFNRISVEVLSVVAVQVKMIHD
AIRNRKKRFVFLGEAITLKPSVGIFITMNPGTAGRTELPENLKALFRPCAMVAPDIELICEILLVAEGFVDARALARKFITLYTLCKELL
SKQDHYDWGLRAIKSVLVVAGSLKRGDKNRPEDQVLMRALRDFNMPKIVTDDIPVFLGLVGDLFPALDVPRRRKLHFEQMVRQSTLELRL
QPEESFILKVVQLEELLAVRHSVFVVGNAGTGKSKILRTLNRTTVNMKQKPVWNDLNPKAVTTDELFGFIHHATREWKDGKIVYSTFIGL
FSSILREQANLKHDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIALTPFMRLLFEIHHLRSATPATVSRAGILTVNPQDLGWN
PTVASWIDRRRHQSEKANLTILFDKTVPACLDKLRTSFKTITSIPESSLVQTLCVLLECLLTPENVPSDSPKEVTEVTFVFACIWAFGGT
LLQDQISDTQADFSRWWQKEMKAVKFPSQGTIFDTTVDHKTKKLLPWADKIAQFTMDPDVPLQTVLVHTTETARLRTFMELLLEKGKPLM
LVGNAGVGKTVFVGDTLASLSEDYIVSRVPFNYYTTSTALQKILEKPLEKKAGHNTGPGGNKKLITFIDDMNMPEVDLTGTVQPHTLIRQ
HIDTGHWTDRQKVMLKEIHNCQTVACMNPMVGSFTINPRLQRHFTVFAFNFPSLDALNTITGQIFSFHFQQQAFAPSILRSGPTLIQATI
AFHQTMMCNFLPTAIKFHYIFNLRDLSNVFQGILFASPECLKGPLDLIHLWLHESARVTGDKLIDKKDCDLFQRRMLETATKTFEGIDSH
MLLQQPLITCHFADRGKDPHYMPVKDWEVLKTILTETLDNYNELNAAMHLVLFEDAMQHVCRISRILRTPQGCALLVGVGGSGKQSLSRL
AAYLRGLEVFQITLTEGTGIQELRVDLANLYIRTGAKNMPTVFLLTDAQVLDESFLVLINDLLASGEIPDLFSDEDVDKIISGIHNEVHA
LGMVDSRENCWKFFMARVRLQLKIILCFSPVGRTLRVRARKFPAIVNCTAIDWFHAWPQEALVSVSRRFIEETKGIEPVHKDSISLFMAH
VHTTVNEMSTRTYQNERRHNTTTPKSFLEQISLFKNLLKKKQNEVSEKKERLVNGIQKLKTTASQVGDLKARLASQEAELQLRNHDAEAL
ITKIGLQTEKVSREKTIADAEERKVTAIQTEVFQKQRECEADLLKAEPALVAATAALNTLNRVNLSELKAFPNPPIAVTNVTAAVMVLLA
PRGRVPKDRSWKAAKVFMGKVDDFLQALINTDKEHIPENCLKVVNEHTLKDPEFNPNLIRTKSFAAAGLCAWVINIIKFTEVYCDVEPKR
QALAQANLELAAATEKLEAIRKKLVDLDRNLSRLTASFEKATAEKVRCQEEVNQTNKTIKLANRLVKELEAKKIRWGQSIKSFEAQEKTL
CGDVLLTAAFVSYVGPFTRQTRQELVHCKWVPFLQQKVSIPLTEGLDLISMLTDDATIAAWNNEGLPSDRMSTENAAILTHCERWPLVID
PQQQGIKWIKNKTGMDLKVTHLGQKGFLNAIETALAFGDVILIENLEETIDPVLDPLLGRNTIKKGKTIRIGDKECEFNKNFRLILHTKL
ANPHTKPELQAQTTLLNFTVTEDGLEAQLLAEVVSIERPDLEKLKLVLTKHQNDFKIELKTLEDDLLLRLSAAEGSFLDDTKLVERLEAT
KTTVAEIEHKVIEAKENERKINEARECYRPVAARASLLTFVINDLQKINPLYQFSLKAFNVLFHRAIEQADKVEDMQGRISILMESITHA
VFLYTSQALFEKDKLTFLSQMAFQILLRKKEIDPLELDFLLRFTVEHTHLSPVDFLTSQSWSAIKAIAVMEEFRGIDRDVEGSAKQWRKW
VESECPEKEKLPQEWKKKSLIQKLILLRAMRPDRMTTALRNFVEEKLGAKTVERTRLDLVKAFEESSPATPIFFILSPGVDALKDLEILG
KRLGFTIDSGKFHNVSLGQGQETVAEVALEKASKGGHWVILQNVHLVAKWLGTLEKLLERFSQGSHRDYRVFMSAESAPTPDEHIIPQGL
LENSIKITNEPPTGMLANLHAALYNFDQDTLEICSKEQEFKSILFSLCYFHACVAGRLRFGPQGWSRSTPFNPGDLTICASVLYNYLEAN
SKVPWEDLRTLFGEIMTGGHITDDWDRKLCRVTLEEFMNPSLTEDELMLAPGFAAPPYLDTAGYHQYIEEMLPPESPALTGLHPNAEIEF
LTVTSNTLFRTLLEMQPRNALSGDELGQSTEEKVKNVLDDILEKLPEEFNMAEIMQKNSNRSPTVLVCFQECERMNILIREIRISLEQLD
LSLKGELALSPAVEAQQFALSTDTVPDTWSKLATPSTTGLAQWFNDLLLRCRELDTWTQDLTLPAVVWLSGFFNPQSFLTAIMQTMARKN
EWPLDKTRLTADVTKKTKEDTGHPPREGAYLHGLFMEGARWDTQAGTIVEARLKELACPMPVIFAKATPVDRQETKQTYECPVTRTKLRG

>In-frame_KLHL7_ENST00000322275_chr7_23145765_+_DNAH11_ENST00000328843_chr7_21584624_+_4447aa
MAASGVEKSSKKKTEKKLAAREEAKLLAGFMGVMNNMRKQIPRDANHKLVFISKKITESIGVNDFSQVVLFGELPALSLGHVSAFLDEIL
VPVLSNKNNHKSWSCFTSQDMETHIEVMKKKMTIFRGKMSRRTLLPIPTVAGKMDLDQNCSENKPPSNERIILHAIESVVIEWSHQIQEI
IERDSVQRLLNGLHLSPQAELDFWMMRRENLSCITDQLQAPVVLKMVKILTTKQSSTFPTLKDIFLAVENALLEAQDVELYLRPLRRHIQ
CLQETEFPQTRILIAPLFHTICLIWSHSKFTNTPARVIVLLQEFCNLFINQATAYLSPEDLLRGEIEESLEKVQVAVNILKTFKNSFFNT
RKKLASYFMGRKLRPWDFQSHLVFCRFDKFLDRLIKIEDIFATTLEFEKLERLEFGGTKGAILNGQVHEMSEELMELCKLFKQSTTDPSD
CTNMEFESDTVAFKSKTLEFDRRLGTIICEAFFNCNGLEAAFKLLTIFGNFLEKPVVMEIFSLHYSTLVHMFNTELDVCKQLTNEHMKQI
ECGHVVLNKNMPFTSGNMKWAQQVLQRLQMFWSNFASLRTLFLGNPDHALVTQKTVEMTTLLDQFESRITNEWKSNVDEICEFNLNQPLV
KFSAINGLLCVNFDPKLVAVLREVKTLLMLKKQDIPDSALAIFKKRNTILKYIGNLDLLVQGTNKLKQTLLEVEYPLIEDELRAIDEQLT
AATTWLTWQDDCWGYIERVRAATSELEHRVERTQKNVKVIQQTMRGWARCVLPPRREHRREAAFTLEDKGDLFTKKYKLIQGDGCKIHNL
VEENRKLFKANPSLDTWKITVEFIDDIVVEGFFQAIMHDLDFFLKNTEKQLKPAPFFQAQMILLPPEIVFKPSLDREAGDGFTDLVEEML
CNSFRMSAQMNRIATHLEIKNTQNDMDNMLGLAEVRQEIMNRVVNVINKVLDFRNTLETHTYLWVDDRAEFMKHFLLTGHAVSSDEMDAH
ANEEIPEQPPTLEQFKEQIDITEALTVQMSKFEDFRVFDSWFKVDMKPFKVSLLTIIKKWSWMFQEHLLRFVIDSLNELQEFIKETDSGL
QRELNEGDHDGLVDIMVHLLAVRSRQRATDELFEPLKETITLLESTGQKMPEQVTIQLEELPERWETTKKIAATVRHEVSPLHNAEVTLI
RKKCILFDAKQAEFRERFRHTAPLGFNAENPYTALDKANEELEALEEEMLQMQESTRLFEVALPEYKQMKQCRKEIKLLKGLWDVIITVR
RSIDNWTKTQWRQIHVEQMDVELRRFAKASSITEIWSLNKEVRVWDAYTGLEGTVKDMTASLRAITELQSPALRDRHWHQLMKAIGVKFL
INEATTLADLLALRLHRVEDDVRRIVDKAVKELGTEKVITEISQTWATMKFSYEVHTRTGIPLLKSDEQLFETLEHNQVQLQTLLQSKTV
ETFIEQVLSWQNKLNIADLVIFTWMEVQRTWSHLESIFVCSEDIRIQLVKDARRFDGVDAEFKELMFKTAKVENVLEATCRPNLTEKLKD
LQSRLSLCEKALAEYLETKRIAFPRFTFVSSADLLDILSKGAQPKQVTCHLAKLFDSIADLQFEDNQDVSAHRAVGMYSKEKETVPFQAE
CECVGHVETWLLQLEQTMQETVRHSITEAIVAYEEKPRELWIFDFPAQVALTSSQIWWTTDVGIAFSRLEEGYETALKDFHKKQISQLNT
LITLLLGELPPGDRQKIMTICTIDVHARDVVAKLISQKQVVVSPQAFTWLSQLRHRWEDTQKHCFVNICDAQFQYFTEYLGNSPRLVITP
LTDRCTITLTQSLHLTMSGAPAGPAGTGKTETTKDLGRALGMMVTVFNCSEQMDYKSIGNITKGLVQTGAWGCFDEFNRISVEVLSVVAV
QVKMIHDAIRNRKKRFVFLGEAITLKPSVGIFITMNPGTAGRTELPENLKALFRPCAMVAPDIELICEILLVAEGFVDARALARKFITLY
TLCKELLSKQDHYDWGLRAIKSVLVVAGSLKRGDKNRPEDQVLMRALRDFNMPKIVTDDIPVFLGLVGDLFPALDVPRRRKLHFEQMVRQ
STLELRLQPEESFILKVVQLEELLAVRHSVFVVGNAGTGKSKILRTLNRTTVNMKQKPVWNDLNPKAVTTDELFGFIHHATREWKDGKIV
YSTFIGLFSSILREQANLKHDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIALTPFMRLLFEIHHLRSATPATVSRAGILTVN
PQDLGWNPTVASWIDRRRHQSEKANLTILFDKTVPACLDKLRTSFKTITSIPESSLVQTLCVLLECLLTPENVPSDSPKEVTEVTFVFAC
IWAFGGTLLQDQISDTQADFSRWWQKEMKAVKFPSQGTIFDTTVDHKTKKLLPWADKIAQFTMDPDVPLQTVLVHTTETARLRTFMELLL
EKGKPLMLVGNAGVGKTVFVGDTLASLSEDYIVSRVPFNYYTTSTALQKILEKPLEKKAGHNTGPGGNKKLITFIDDMNMPEVDLTGTVQ
PHTLIRQHIDTGHWTDRQKVMLKEIHNCQTVACMNPMVGSFTINPRLQRHFTVFAFNFPSLDALNTITGQIFSFHFQQQAFAPSILRSGP
TLIQATIAFHQTMMCNFLPTAIKFHYIFNLRDLSNVFQGILFASPECLKGPLDLIHLWLHESARVTGDKLIDKKDCDLFQRRMLETATKT
FEGIDSHMLLQQPLITCHFADRGKDPHYMPVKDWEVLKTILTETLDNYNELNAAMHLVLFEDAMQHVCRISRILRTPQGCALLVGVGGSG
KQSLSRLAAYLRGLEVFQITLTEGTGIQELRVDLANLYIRTGAKNMPTVFLLTDAQVLDESFLVLINDLLASGEIPDLFSDEDVDKIISG
IHNEVHALGMVDSRENCWKFFMARVRLQLKIILCFSPVGRTLRVRARKFPAIVNCTAIDWFHAWPQEALVSVSRRFIEETKGIEPVHKDS
ISLFMAHVHTTVNEMSTRTYQNERRHNTTTPKSFLEQISLFKNLLKKKQNEVSEKKERLVNGIQKLKTTASQVGDLKARLASQEAELQLR
NHDAEALITKIGLQTEKVSREKTIADAEERKVTAIQTEVFQKQRECEADLLKAEPALVAATAALNTLNRVNLSELKAFPNPPIAVTNVTA
AVMVLLAPRGRVPKDRSWKAAKVFMGKVDDFLQALINTDKEHIPENCLKVVNEHTLKDPEFNPNLIRTKSFAAAGLCAWVINIIKFTEVY
CDVEPKRQALAQANLELAAATEKLEAIRKKLVDLDRNLSRLTASFEKATAEKVRCQEEVNQTNKTIKLANRLVKELEAKKIRWGQSIKSF
EAQEKTLCGDVLLTAAFVSYVGPFTRQTRQELVHCKWVPFLQQKVSIPLTEGLDLISMLTDDATIAAWNNEGLPSDRMSTENAAILTHCE
RWPLVIDPQQQGIKWIKNKTGMDLKVTHLGQKGFLNAIETALAFGDVILIENLEETIDPVLDPLLGRNTIKKGKTIRIGDKECEFNKNFR
LILHTKLANPHTKPELQAQTTLLNFTVTEDGLEAQLLAEVVSIERPDLEKLKLVLTKHQNDFKIELKTLEDDLLLRLSAAEGSFLDDTKL
VERLEATKTTVAEIEHKVIEAKENERKINEARECYRPVAARASLLTFVINDLQKINPLYQFSLKAFNVLFHRAIEQADKVEDMQGRISIL
MESITHAVFLYTSQALFEKDKLTFLSQMAFQILLRKKEIDPLELDFLLRFTVEHTHLSPVDFLTSQSWSAIKAIAVMEEFRGIDRDVEGS
AKQWRKWVESECPEKEKLPQEWKKKSLIQKLILLRAMRPDRMTTALRNFVEEKLGAKTVERTRLDLVKAFEESSPATPIFFILSPGVDAL
KDLEILGKRLGFTIDSGKFHNVSLGQGQETVAEVALEKASKGGHWVILQNVHLVAKWLGTLEKLLERFSQGSHRDYRVFMSAESAPTPDE
HIIPQGLLENSIKITNEPPTGMLANLHAALYNFDQDTLEICSKEQEFKSILFSLCYFHACVAGRLRFGPQGWSRSTPFNPGDLTICASVL
YNYLEANSKVPWEDLRTLFGEIMTGGHITDDWDRKLCRVTLEEFMNPSLTEDELMLAPGFAAPPYLDTAGYHQYIEEMLPPESPALTGLH
PNAEIEFLTVTSNTLFRTLLEMQPRNALSGDELGQSTEEKVKNVLDDILEKLPEEFNMAEIMQKNSNRSPTVLVCFQECERMNILIREIR
ISLEQLDLSLKGELALSPAVEAQQFALSTDTVPDTWSKLATPSTTGLAQWFNDLLLRCRELDTWTQDLTLPAVVWLSGFFNPQSFLTAIM
QTMARKNEWPLDKTRLTADVTKKTKEDTGHPPREGAYLHGLFMEGARWDTQAGTIVEARLKELACPMPVIFAKATPVDRQETKQTYECPV


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_KLHL7_ENST00000339077_chr7_23145765_+_DNAH11_ENST00000409508_chr7_21584624_+_13320nt
ATGGCAGCCTCTGGGGTGGAGAAGAGCAGCAAGAAGAAGACCGAGAAGAAACTTGCTGCTCGGGAAGAAGCTAAATTGTTGGCGGGTTTC
ATGGGCGTCATGAATAACATGCGGAAACAGATTCCAAGAGATGCAAACCATAAACTTGTTTTTATTTCCAAGAAGATTACTGAAAGCATT
GGAGTAAATGACTTTTCTCAAGTGGTTTTATTTGGAGAGTTACCTGCGTTGTCTCTTGGACATGTATCTGCTTTCCTTGATGAGATTTTA
GTGCCAGTTCTTTCTAATAAGAACAACCATAAGTCCTGGTCCTGTTTTACTTCACAAGATATGGAATATCACATAGAAGTCATGAAAAAG
AAGATGTATATTTTTAGGGGCAAAATGTCTAGAAGAACTCTTCTACCAATTCCCACTGTTGCAGGAAAGATGGATCTGGATCAGAATTGT
TCAGAGAACAAGCCACCGTCAAACGAAAGGATAATACTTCATGCAATTGAATCTGTGGTTATTGAATGGTCACATCAAATCCAAGAAATT
ATAGAAAGAGATTCAGTGCAGCGTTTGTTGAATGGTCTTCACTTGTCTCCTCAAGCAGAACTAGATTTCTGGATGATGAGGAGAGAAAAT
CTGTCATGCATTTATGATCAACTTCAGGCACCTGTTGTCCTCAAAATGGTTAAGATCCTGACAACTAAACAAAGCAGCTATTTTCCTACT
CTGAAGGACATTTTTCTGGCTGTGGAAAATGCTCTTCTCGAAGCCCAAGATGTGGAACTTTACCTGAGACCTCTGAGGAGACACATCCAG
TGTCTCCAGGAGACGGAATTCCCACAGACACGCATATTAATCGCTCCATTATTTCATACCATCTGTCTGATCTGGAGTCATTCCAAGTTT
TATAACACCCCAGCTCGGGTTATAGTTTTATTGCAAGAGTTTTGTAATCTCTTCATTAACCAGGCAACAGCTTACCTTTCACCTGAGGAC
CTTTTGAGGGGAGAAATAGAAGAGTCACTGGAAAAGGTGCAGGTGGCTGTTAACATCTTAAAGACTTTCAAAAACTCCTTTTTCAACTAT
AGAAAAAAATTGGCAAGCTACTTTATGGGAAGAAAGCTGAGACCATGGGATTTCCAGTCTCATCTGGTGTTTTGCAGATTTGACAAGTTT
CTTGATCGTTTAATAAAAATAGAGGATATATTTGCCACCACTTTGGAATTTGAAAAGCTGGAAAGACTGGAATTTGGTGGTACCAAAGGA
GCAATTTTAAATGGACAAGTCCACGAGATGAGTGAAGAACTTATGGAACTCTGTAAACTTTTTAAACAGAGCACTTATGACCCATCTGAT
TGCACTAACATGGAGTTTGAAAGTGATTATGTGGCATTTAAGTCCAAAACTCTGGAATTTGACAGAAGGCTTGGGACAATTATTTGTGAA
GCTTTCTTTAACTGCAATGGCTTAGAAGCTGCATTTAAGCTTTTGACCATATTTGGAAATTTTCTAGAGAAGCCAGTTGTCATGGAAATT
TTCAGCCTACATTACAGCACACTAGTGCATATGTTTAATACAGAGCTGGATGTGTGTAAGCAACTGTATAATGAACACATGAAACAGATT
GAATGTGGTCATGTAGTTCTTAACAAGAACATGCCATTTACCTCAGGAAATATGAAATGGGCCCAGCAGGTTCTCCAACGACTTCAAATG
TTTTGGTCAAACTTCGCATCTCTCCGTTATCTATTTTTGGGCAATCCTGATCACGCTTTAGTTTATCAAAAGTATGTTGAAATGACCACT
TTGCTTGATCAATTTGAAAGTCGTATCTATAATGAATGGAAAAGTAATGTGGATGAAATCTGTGAATTCAATTTGAATCAACCCTTGGTT
AAATTCAGTGCCATAAATGGTCTTCTCTGTGTCAATTTTGACCCAAAGCTAGTGGCTGTATTGAGAGAAGTGAAATATCTTTTGATGTTG
AAGAAACAAGACATACCAGATTCAGCTTTAGCCATCTTCAAGAAAAGGAACACTATTTTAAAGTACATTGGAAATCTTGACCTTCTTGTG
CAAGGGTATAATAAACTCAAACAGACGCTCCTGGAAGTTGAATACCCTCTGATTGAAGATGAGCTGAGGGCTATTGACGAGCAGCTGACA
GCAGCCACAACGTGGCTGACATGGCAGGATGACTGCTGGGGCTACATCGAGAGGGTGAGGGCAGCCACGTCCGAGTTGGAGCACAGAGTT
GAGCGCACACAGAAAAACGTGAAGGTGATCCAGCAGACCATGAGGGGCTGGGCCAGGTGCGTGCTACCTCCCAGGAGAGAGCACAGACGA
GAGGCAGCCTTCACCTTGGAGGACAAGGGTGATTTGTTTACAAAAAAATACAAGTTAATCCAAGGAGATGGCTGCAAGATCCACAACTTG
GTCGAGGAAAATAGGAAGCTCTTCAAAGCCAATCCCTCTCTGGATACCTGGAAAATTTATGTAGAATTCATTGACGACATTGTGGTGGAA
GGCTTTTTTCAGGCTATAATGCACGACTTAGACTTCTTTCTGAAGAATACAGAGAAACAATTGAAACCGGCACCGTTTTTTCAAGCACAA
ATGATCTTGTTGCCTCCTGAGATTGTGTTTAAACCTTCCCTAGACAGAGAGGCTGGGGATGGCTTCTATGATCTTGTAGAAGAAATGTTA
TGCAATAGTTTTAGAATGTCTGCCCAGATGAACCGAATAGCAACACACCTGGAAATTAAAAATTATCAGAATGATATGGATAACATGTTA
GGCCTGGCAGAGGTCAGGCAGGAGATCATGAACAGAGTGGTGAATGTCATCAACAAAGTCTTAGATTTCAGAAACACCCTGGAGACCCAC
ACTTACCTCTGGGTGGATGATCGAGCTGAGTTTATGAAGCATTTTCTCTTGTATGGCCATGCTGTGTCTTCCGATGAAATGGATGCTCAT
GCAAATGAAGAAATTCCCGAACAACCACCAACTCTTGAGCAATTCAAAGAACAGATTGACATTTATGAAGCTTTGTATGTTCAAATGAGC
AAATTTGAGGACTTTAGAGTGTTTGATAGTTGGTTCAAGGTGGACATGAAGCCTTTCAAAGTGAGCTTGTTAACCATAATTAAGAAATGG
AGCTGGATGTTTCAGGAGCATCTTTTGAGATTTGTCATTGACAGTCTGAATGAGCTACAAGAATTTATAAAGGAGACAGATTCCGGACTT
CAGAGAGAATTAAATGAAGGTGATCATGATGGTTTAGTTGACATCATGGTGCATCTTCTGGCTGTAAGAAGCCGACAGAGAGCTACTGAT
GAACTCTTTGAACCTCTAAAAGAAACGATCACCCTCTTGGAAAGCTATGGCCAGAAGATGCCTGAGCAGGTCTATATTCAGCTAGAGGAA
TTACCTGAAAGATGGGAAACTACCAAAAAGATCGCAGCAACTGTCAGACATGAAGTCTCACCTCTCCATAATGCGGAAGTCACTCTTATA
AGGAAAAAATGTATTTTGTTTGACGCAAAGCAGGCAGAGTTCAGAGAGAGATTCAGACACTATGCCCCTCTTGGATTTAATGCAGAAAAT
CCATACACAGCGCTTGATAAGGCAAATGAAGAGCTTGAGGCCTTAGAAGAAGAAATGTTGCAGATGCAAGAATCTACTCGTCTTTTTGAA
GTGGCTCTTCCAGAGTACAAACAAATGAAACAGTGTCGCAAAGAAATAAAATTGCTCAAGGGACTGTGGGATGTCATTATTTATGTTCGA
AGAAGCATTGATAATTGGACTAAAACCCAGTGGAGACAGATTCATGTGGAACAGATGGATGTAGAACTCAGAAGGTTTGCCAAGGAAATT
TGGTCACTCAACAAGGAAGTCCGCGTCTGGGATGCTTACACGGGCCTGGAAGGCACAGTTAAGGACATGACAGCCTCCCTGAGGGCCATC
ACAGAGTTACAGAGCCCTGCCCTCAGGGACAGGCATTGGCACCAGCTGATGAAAGCTATTGGGGTCAAGTTTTTAATAAATGAAGCCACA
ACTTTGGCAGATTTGTTAGCACTGCGGTTACACAGAGTGGAAGATGATGTCCGAAGGATTGTGGACAAGGCGGTGAAAGAGCTGGGGACT
GAGAAGGTTATTACTGAAATCAGTCAGACCTGGGCAACCATGAAGTTTTCTTACGAAGTTCACTATCGAACAGGCATTCCATTACTAAAG
TCTGATGAACAACTTTTTGAAACTCTAGAGCACAACCAAGTTCAGTTGCAGACTCTTCTTCAAAGCAAGTATGTAGAATATTTCATTGAG
CAAGTGTTAAGCTGGCAAAATAAATTAAACATAGCAGACTTGGTCATCTTCACTTGGATGGAAGTCCAGCGAACTTGGTCTCACCTGGAA
AGCATTTTTGTCTGTTCAGAAGATATTCGAATCCAGCTTGTGAAAGATGCTAGAAGATTTGATGGGGTGGATGCTGAATTTAAGGAGTTA
ATGTTCAAGACAGCCAAAGTAGAAAATGTGTTAGAAGCAACGTGCAGACCTAATCTCTATGAAAAACTTAAAGATTTACAGTCCAGGCTT
TCTCTTTGTGAAAAAGCTCTCGCTGAATACCTGGAAACCAAGCGCATAGCCTTTCCTCGCTTCTATTTCGTCTCTTCTGCTGATTTACTT
GACATTCTCTCAAAAGGAGCTCAGCCTAAACAGGTAACATGTCACCTTGCCAAACTTTTCGACAGCATTGCAGATCTGCAGTTTGAAGAC
AATCAGGATGTTTCTGCACACAGGGCAGTTGGAATGTACAGCAAAGAAAAGGAGTATGTCCCATTCCAAGCCGAGTGTGAATGTGTGGGC
CATGTGGAAACATGGCTTCTGCAACTTGAACAGACTATGCAAGAAACGGTGCGTCATTCTATAACAGAAGCCATAGTGGCCTACGAGGAA
AAACCTAGGGAACTGTGGATTTTTGATTTCCCAGCTCAGGTTGCACTAACCAGCTCACAAATATGGTGGACCACAGATGTAGGAATAGCC
TTCAGTAGACTGGAAGAAGGCTACGAAACAGCCCTGAAGGATTTCCATAAAAAACAGATTTCTCAGCTGAATACACTGATTACACTTTTG
CTGGGAGAACTTCCACCTGGAGACAGACAGAAGATCATGACAATTTGTACCATAGATGTCCATGCCAGAGACGTGGTGGCAAAACTTATT
TCTCAGAAGGTTGTCAGTCCCCAAGCTTTTACATGGCTGTCTCAACTTCGTCACCGATGGGAGGATACCCAGAAACACTGCTTTGTTAAT
ATTTGTGATGCCCAGTTCCAGTACTTCTATGAATACTTAGGAAACAGCCCTCGACTAGTGATCACTCCTCTAACTGACAGGTGTTATATT
ACCTTAACTCAATCACTTCATCTAACCATGAGTGGGGCTCCTGCTGGCCCAGCTGGTACCGGGAAAACAGAGACCACCAAAGACCTAGGA
CGTGCCCTTGGCATGATGGTCTATGTATTCAACTGTTCAGAGCAAATGGACTACAAATCCATAGGCAATATCTATAAGGGATTGGTGCAG
ACAGGAGCTTGGGGCTGCTTTGATGAGTTCAACCGAATCTCTGTGGAAGTTCTGTCAGTGGTGGCAGTACAAGTGAAAATGATTCATGAT
GCCATCAGAAACAGGAAGAAGAGATTTGTATTTCTTGGGGAAGCTATCACACTGAAGCCATCAGTTGGAATATTTATTACTATGAACCCG
GGTTATGCTGGTCGAACCGAATTACCGGAAAATCTCAAAGCTCTTTTCAGACCCTGTGCCATGGTGGCCCCTGACATTGAGCTAATCTGT
GAAATCTTGTTAGTTGCTGAAGGTTTTGTGGATGCGCGTGCATTAGCCCGAAAGTTCATTACGTTGTACACGCTTTGCAAGGAGCTTCTC
TCCAAGCAGGATCATTACGACTGGGGACTTCGTGCTATTAAGTCTGTCTTGGTTGTGGCTGGATCTCTGAAACGAGGAGATAAAAATAGA
CCCGAAGATCAGGTACTCATGAGAGCATTAAGGGATTTCAATATGCCCAAAATAGTGACTGACGACATCCCAGTGTTTCTGGGCCTGGTC
GGTGACCTGTTTCCAGCCCTGGATGTGCCCCGGAGGAGGAAGCTGCACTTTGAACAGATGGTCAGGCAGTCTACCCTGGAGCTCCGCCTG
CAGCCTGAAGAGAGCTTCATCCTCAAAGTTGTCCAGCTTGAGGAACTGTTGGCTGTGCGGCACTCGGTCTTTGTAGTTGGAAATGCAGGC
ACAGGAAAGAGTAAGATTTTGAGAACACTGAACCGAACATATGTTAACATGAAACAGAAGCCGGTTTGGAATGACTTAAACCCTAAAGCT
GTGACAACAGATGAACTCTTTGGTTTCATACATCATGCTACCCGAGAATGGAAAGATGGCAAGATTGTTTACTCTTATTTTATAGGTCTC
TTCTCATCCATTCTACGAGAACAAGCAAATCTTAAGCATGATGGACCAAAATGGATAGTCCTGGATGGCGATATTGACCCCATGTGGATT
GAATCACTGAATACTGTAATGGATGATAACAAGGTGCTGACCCTCGCCAGCAATGAGCGCATTGCACTCACTCCCTTCATGAGGCTTCTG
TTTGAGATACATCACTTAAGGAGCGCAACCCCGGCCACTGTTTCCAGAGCTGGTATTCTGTATGTGAACCCACAAGATCTGGGCTGGAAT
CCGTATGTGGCCAGTTGGATAGACAGAAGGCGGCATCAATCAGAAAAGGCCAATTTGACTATTCTTTTTGATAAATATGTCCCTGCATGC
TTGGATAAACTGAGAACAAGCTTTAAAACCATCACTTCAATTCCTGAGAGTAGCCTGGTGCAGACTCTATGTGTTCTTTTGGAGTGCTTG
CTGACTCCTGAAAATGTACCTTCTGACAGCCCAAAAGAAGTTTATGAAGTCTATTTTGTATTTGCTTGTATCTGGGCTTTTGGAGGCACC
CTGCTACAAGATCAGATTTCTGATTATCAAGCTGACTTCAGTCGGTGGTGGCAGAAAGAGATGAAAGCAGTGAAATTTCCGTCGCAGGGA
ACAATCTTTGATTATTATGTGGACCACAAAACTAAGAAATTATTGCCCTGGGCTGACAAAATTGCCCAGTTTACTATGGATCCAGATGTG
CCTCTGCAGACAGTTCTCGTTCACACAACAGAGACAGCTCGTCTTAGATATTTCATGGAGTTGTTGCTTGAGAAAGGAAAACCTCTAATG
CTAGTAGGAAATGCAGGAGTGGGAAAAACAGTCTTTGTAGGTGACACATTGGCAAGTCTCTCTGAGGATTACATAGTATCCCGTGTGCCT
TTCAACTACTACACGACATCCACAGCTCTGCAAAAAATTCTTGAGAAACCCCTAGAGAAAAAAGCTGGTCATAACTATGGTCCTGGAGGA
AATAAAAAATTGATTTATTTTATCGACGACATGAACATGCCTGAAGTGGACTTATATGGCACCGTTCAGCCTCACACCCTGATCCGGCAG
CATATTGATTATGGACATTGGTATGATAGACAGAAGGTGATGCTTAAAGAAATCCATAACTGCCAGTATGTCGCCTGCATGAATCCGATG
GTGGGCAGCTTCACCATCAATCCCAGGCTACAGAGACATTTCACAGTGTTTGCATTCAATTTTCCATCTTTGGATGCACTAAACACCATC
TATGGCCAAATCTTTAGCTTCCATTTCCAACAGCAAGCATTTGCTCCATCAATTCTCAGGAGTGGCCCCACTTTGATCCAGGCAACAATA
GCATTCCATCAGACAATGATGTGTAACTTTTTACCCACGGCTATTAAATTCCACTACATCTTTAATCTGAGAGATTTATCAAACGTCTTC
CAGGGGATTTTATTTGCTTCTCCTGAGTGTTTAAAAGGTCCACTTGATTTAATACATCTGTGGCTTCATGAATCTGCCCGTGTTTATGGA
GACAAACTGATAGACAAAAAAGATTGTGATTTGTTTCAGAGAAGAATGCTGGAAACTGCTTATAAATATTTTGAAGGTATAGATAGTCAC
ATGCTGCTTCAACAGCCCCTCATTTATTGCCACTTTGCTGATAGAGGGAAGGACCCACATTACATGCCAGTGAAGGACTGGGAAGTGCTG
AAGACGATTCTTACAGAAACGTTAGACAACTACAATGAACTAAATGCTGCCATGCACCTAGTTTTGTTTGAAGATGCCATGCAACATGTG
TGTCGCATCAGCCGGATCTTACGAACCCCTCAGGGCTGTGCTCTCTTGGTTGGAGTTGGGGGCAGTGGCAAGCAGAGCTTGTCCAGGCTG
GCAGCTTACCTTCGTGGCCTTGAGGTCTTTCAGATCACTCTGACCGAGGGCTATGGAATCCAGGAACTTCGGGTAGATCTTGCCAATTTG
TACATCCGAACTGGAGCCAAGAACATGCCCACTGTGTTCCTGCTGACAGATGCCCAGGTTCTAGATGAGAGCTTCCTCGTGCTGATTAAT
GACTTGCTGGCATCAGGAGAAATCCCAGATCTGTTCAGCGATGAAGATGTGGACAAGATAATTTCTGGAATTCATAATGAAGTTCATGCT
CTGGGCATGGTAGACTCCAGGGAAAACTGTTGGAAATTCTTTATGGCCAGGGTGCGACTACAGCTCAAAATCATTTTGTGTTTCTCTCCA
GTTGGTCGCACGCTGAGAGTTAGAGCTCGGAAGTTCCCAGCCATAGTTAACTGCACGGCTATTGACTGGTTTCATGCGTGGCCGCAGGAG
GCTCTGGTCTCCGTCAGCAGGAGGTTCATTGAGGAAACCAAGGGAATTGAGCCAGTGCACAAAGACTCTATTAGCCTTTTCATGGCACAT
GTTCACACCACTGTAAATGAAATGAGTACCAGATATTACCAGAATGAGAGAAGACACAACTATACCACCCCAAAGAGTTTTCTAGAACAA
ATATCACTGTTTAAGAACCTGTTGAAGAAGAAGCAAAATGAGGTATCCGAGAAAAAAGAACGCCTGGTGAACGGCATCCAAAAGCTAAAA
ACCACAGCCTCTCAGGTGGGAGATCTAAAAGCCAGACTTGCCTCTCAAGAAGCCGAGCTGCAACTGAGAAATCATGATGCCGAAGCTCTG
ATCACAAAGATCGGCCTTCAGACGGAGAAAGTGAGCCGGGAAAAGACCATCGCTGATGCTGAGGAGCGAAAGGTGACAGCCATTCAGACT
GAAGTGTTCCAGAAACAGAGAGAATGTGAAGCTGACTTACTCAAGGCTGAGCCTGCACTGGTGGCTGCTACAGCTGCACTCAATACACTC
AACAGGGTCAACCTCAGTGAGCTGAAAGCCTTTCCCAACCCTCCCATCGCAGTTACCAATGTTACTGCAGCCGTGATGGTCCTTCTGGCT
CCTCGGGGAAGAGTGCCCAAAGACCGAAGTTGGAAAGCAGCTAAAGTCTTCATGGGAAAGGTTGATGATTTTTTGCAAGCATTAATTAAC
TATGACAAAGAGCACATTCCAGAGAACTGTCTAAAAGTGGTGAATGAACACTATTTGAAAGACCCAGAGTTTAATCCAAACCTGATTCGA
ACCAAATCTTTTGCAGCAGCTGGCCTGTGTGCCTGGGTCATCAACATCATTAAATTCTATGAGGTCTACTGTGATGTGGAGCCAAAACGC
CAAGCATTAGCCCAAGCAAACTTAGAACTGGCTGCAGCTACTGAAAAACTAGAGGCTATCAGGAAAAAGCTTGTGGATCTGGATCGAAAT
CTGAGCAGACTCACGGCTTCATTTGAAAAAGCAACAGCTGAGAAAGTCCGGTGTCAAGAAGAGGTGAACCAAACCAACAAAACCATCAAA
TTAGCTAACAGACTTGTCAAGGAACTTGAGGCAAAGAAGATTCGCTGGGGTCAATCCATTAAGTCCTTTGAAGCTCAAGAGAAGACACTC
TGTGGAGATGTTCTTCTCACGGCGGCATTTGTGTCTTACGTCGGACCCTTCACAAGGCAGTATCGCCAGGAGCTGGTGCACTGCAAGTGG
GTTCCCTTTCTTCAACAGAAGGTTTCCATTCCACTAACCGAAGGCCTGGACTTGATATCCATGTTGACGGATGATGCTACAATTGCCGCC
TGGAATAACGAAGGACTGCCCAGTGACAGAATGTCCACCGAAAATGCCGCTATCCTAACACACTGTGAGCGCTGGCCTCTGGTGATAGAT
CCCCAGCAACAGGGAATTAAGTGGATCAAGAATAAGTATGGAATGGACCTGAAAGTCACACATTTGGGCCAGAAAGGGTTTTTGAATGCC
ATTGAAACTGCTTTGGCCTTTGGTGATGTCATCTTAATTGAAAATCTCGAGGAAACGATAGATCCAGTCCTGGATCCACTACTTGGCAGG
AACACAATTAAAAAAGGAAAGTATATCAGGATTGGAGATAAAGAATGTGAATTTAACAAGAACTTTCGCCTTATCCTTCACACAAAATTG
GCAAATCCTCACTATAAGCCGGAATTACAAGCTCAGACAACTCTCCTCAATTTCACAGTCACAGAAGATGGTCTAGAAGCCCAGCTGCTG
GCAGAGGTTGTCAGTATTGAAAGGCCAGATTTGGAGAAACTTAAGTTGGTATTGACAAAGCACCAAAATGATTTTAAAATTGAGCTCAAG
TATCTGGAAGACGATCTCCTTTTGCGCCTTTCTGCGGCAGAGGGAAGCTTTCTGGATGACACCAAACTGGTAGAGAGATTGGAGGCAACA
AAGACCACCGTGGCAGAGATAGAGCACAAGGTGATTGAAGCCAAAGAAAATGAAAGAAAAATCAACGAGGCCCGAGAATGTTACAGACCA
GTGGCAGCAAGAGCATCTCTTCTTTATTTTGTTATTAATGACCTCCAAAAAATCAACCCCCTCTACCAATTCTCTTTGAAGGCTTTTAAC
GTGCTGTTCCACAGAGCGATCGAGCAGGCTGACAAGGTGGAAGACATGCAGGGACGCATCTCTATCCTGATGGAGAGCATCACCCATGCT
GTCTTCCTCTACACCAGCCAGGCGCTGTTTGAGAAGGACAAGCTCACCTTCCTGTCCCAGATGGCTTTTCAGATTTTGTTGAGAAAGAAA
GAGATAGACCCTCTTGAATTGGATTTCCTGCTTCGATTCACAGTTGAACACACTCATCTGAGTCCCGTTGACTTCCTAACTTCTCAGTCA
TGGAGTGCTATCAAGGCAATTGCCGTCATGGAAGAATTTCGAGGCATAGACCGAGATGTGGAAGGATCTGCCAAGCAGTGGAGGAAGTGG
GTAGAATCCGAGTGTCCAGAAAAAGAAAAATTACCTCAAGAATGGAAGAAGAAAAGTTTAATACAGAAGCTGATTCTTCTGAGAGCAATG
CGCCCTGACAGAATGACGTATGCTCTCAGAAATTTTGTAGAGGAAAAACTGGGTGCGAAGTATGTGGAGAGGACCAGATTGGACTTAGTT
AAAGCATTCGAAGAAAGCAGCCCAGCCACCCCCATATTCTTCATCCTGTCTCCGGGGGTAGATGCCCTTAAAGACCTGGAGATTCTTGGC
AAAAGACTTGGCTTTACAATTGACTCTGGAAAATTCCACAATGTGTCTTTAGGACAAGGTCAGGAGACGGTGGCAGAAGTGGCCCTGGAG
AAAGCTTCCAAAGGAGGACACTGGGTCATCCTCCAAAATGTTCATTTGGTAGCCAAGTGGCTAGGAACCTTGGAGAAGCTCCTTGAAAGA
TTCAGCCAAGGAAGCCACAGAGATTACAGGGTTTTCATGAGTGCTGAGTCTGCACCTACACCAGATGAGCATATCATCCCTCAAGGACTC
CTGGAAAATTCCATTAAGATCACTAATGAACCCCCAACAGGGATGCTGGCCAATTTGCATGCCGCCCTGTACAACTTTGATCAGGATACA
CTTGAAATATGCTCCAAGGAGCAGGAGTTTAAAAGCATCCTTTTTTCTCTCTGCTACTTCCACGCCTGTGTTGCTGGGAGACTGAGGTTT
GGCCCCCAGGGCTGGAGCCGAAGCTATCCTTTTAATCCTGGAGACCTCACCATTTGTGCCAGTGTCCTCTACAACTACTTAGAGGCAAAC
TCTAAAGTCCCATGGGAAGATCTCCGTTATCTCTTTGGTGAGATCATGTATGGAGGCCACATCACAGATGACTGGGATCGCAAACTGTGT
CGGGTGTATTTAGAAGAATTCATGAATCCATCTCTGACTGAAGATGAACTGATGCTGGCACCAGGTTTTGCTGCCCCACCCTACCTAGAT
TATGCAGGCTACCACCAGTACATAGAGGAGATGCTTCCTCCAGAAAGCCCGGCACTGTATGGCCTCCACCCAAATGCTGAAATAGAATTC
CTGACAGTGACATCCAACACTCTCTTCAGAACTTTGCTGGAGATGCAGCCCAGGAATGCACTCAGTGGTGATGAACTGGGGCAGTCTACA
GAAGAAAAGGTTAAGAATGTCTTGGATGACATTTTGGAGAAACTTCCAGAAGAGTTCAACATGGCAGAGATAATGCAAAAAAATTCAAAT
AGAAGCCCATATGTTCTTGTTTGCTTCCAAGAATGTGAGAGGATGAATATTCTCATTCGGGAAATACGTATATCACTTGAACAACTGGAC
CTTAGTTTGAAGGGGGAATTGGCATTATCTCCTGCTGTGGAAGCCCAGCAGTTTGCATTGAGTTATGACACGGTACCAGACACTTGGAGC
AAACTGGCTTATCCTTCTACTTATGGCCTAGCCCAGTGGTTCAATGACCTCCTCCTGCGATGCCGAGAACTCGATACTTGGACACAAGAC
CTTACCCTTCCGGCTGTCGTGTGGCTCTCCGGCTTCTTCAACCCTCAGTCCTTCTTAACTGCAATCATGCAGACGATGGCTCGAAAAAAT
GAGTGGCCCCTGGATAAAACGCGCTTGACTGCTGATGTTACCAAAAAAACAAAGGAAGATTATGGACACCCGCCAAGGGAAGGTGCATAC
CTCCACGGACTCTTCATGGAGGGCGCCCGCTGGGACACCCAAGCAGGAACCATTGTTGAAGCCCGTCTCAAGGAGCTGGCATGCCCTATG
CCGGTCATCTTTGCAAAAGCCACCCCCGTGGACAGACAAGAAACCAAACAGACCTACGAGTGCCCTGTGTATAGAACCAAACTGAGAGGC
CCCAGCTACATCTGGACCTTCAGGCTGAAGAGCGAAGAGAAGACTGCAAAATGGGTTCTGGCTGGAGTGGCTCTGCTTCTAGAAGCGTAA

>In-frame_KLHL7_ENST00000339077_chr7_23145765_+_DNAH11_ENST00000328843_chr7_21584624_+_13341nt
ATGGCAGCCTCTGGGGTGGAGAAGAGCAGCAAGAAGAAGACCGAGAAGAAACTTGCTGCTCGGGAAGAAGCTAAATTGTTGGCGGGTTTC
ATGGGCGTCATGAATAACATGCGGAAACAGATTCCAAGAGATGCAAACCATAAACTTGTTTTTATTTCCAAGAAGATTACTGAAAGCATT
GGAGTAAATGACTTTTCTCAAGTGGTTTTATTTGGAGAGTTACCTGCGTTGTCTCTTGGACATGTATCTGCTTTCCTTGATGAGATTTTA
GTGCCAGTTCTTTCTAATAAGAACAACCATAAGTCCTGGTCCTGTTTTACTTCACAAGATATGGAATATCACATAGAAGTCATGAAAAAG
AAGATGTATATTTTTAGGGGCAAAATGTCTAGAAGAACTCTTCTACCAATTCCCACTGTTGCAGGAAAGATGGATCTGGATCAGAATTGT
TCAGAGAACAAGCCACCGTCAAACGAAAGGATAATACTTCATGCAATTGAATCTGTGGTTATTGAATGGTCACATCAAATCCAAGAAATT
ATAGAAAGAGATTCAGTGCAGCGTTTGTTGAATGGTCTTCACTTGTCTCCTCAAGCAGAACTAGATTTCTGGATGATGAGGAGAGAAAAT
CTGTCATGCATTTATGATCAACTTCAGGCACCTGTTGTCCTCAAAATGGTTAAGATCCTGACAACTAAACAAAGCAGCTATTTTCCTACT
CTGAAGGACATTTTTCTGGCTGTGGAAAATGCTCTTCTCGAAGCCCAAGATGTGGAACTTTACCTGAGACCTCTGAGGAGACACATCCAG
TGTCTCCAGGAGACGGAATTCCCACAGACACGCATATTAATCGCTCCATTATTTCATACCATCTGTCTGATCTGGAGTCATTCCAAGTTT
TATAACACCCCAGCTCGGGTTATAGTTTTATTGCAAGAGTTTTGTAATCTCTTCATTAACCAGGCAACAGCTTACCTTTCACCTGAGGAC
CTTTTGAGGGGAGAAATAGAAGAGTCACTGGAAAAGGTGCAGGTGGCTGTTAACATCTTAAAGACTTTCAAAAACTCCTTTTTCAACTAT
AGAAAAAAATTGGCAAGCTACTTTATGGGAAGAAAGCTGAGACCATGGGATTTCCAGTCTCATCTGGTGTTTTGCAGATTTGACAAGTTT
CTTGATCGTTTAATAAAAATAGAGGATATATTTGCCACCACTTTGGAATTTGAAAAGCTGGAAAGACTGGAATTTGGTGGTACCAAAGGA
GCAATTTTAAATGGACAAGTCCACGAGATGAGTGAAGAACTTATGGAACTCTGTAAACTTTTTAAACAGAGCACTTATGACCCATCTGAT
TGCACTAACATGGAGTTTGAAAGTGATTATGTGGCATTTAAGTCCAAAACTCTGGAATTTGACAGAAGGCTTGGGACAATTATTTGTGAA
GCTTTCTTTAACTGCAATGGCTTAGAAGCTGCATTTAAGCTTTTGACCATATTTGGAAATTTTCTAGAGAAGCCAGTTGTCATGGAAATT
TTCAGCCTACATTACAGCACACTAGTGCATATGTTTAATACAGAGCTGGATGTGTGTAAGCAACTGTATAATGAACACATGAAACAGATT
GAATGTGGTCATGTAGTTCTTAACAAGAACATGCCATTTACCTCAGGAAATATGAAATGGGCCCAGCAGGTTCTCCAACGACTTCAAATG
TTTTGGTCAAACTTCGCATCTCTCCGTTATCTATTTTTGGGCAATCCTGATCACGCTTTAGTTTATCAAAAGTATGTTGAAATGACCACT
TTGCTTGATCAATTTGAAAGTCGTATCTATAATGAATGGAAAAGTAATGTGGATGAAATCTGTGAATTCAATTTGAATCAACCCTTGGTT
AAATTCAGTGCCATAAATGGTCTTCTCTGTGTCAATTTTGACCCAAAGCTAGTGGCTGTATTGAGAGAAGTGAAATATCTTTTGATGTTG
AAGAAACAAGACATACCAGATTCAGCTTTAGCCATCTTCAAGAAAAGGAACACTATTTTAAAGTACATTGGAAATCTTGACCTTCTTGTG
CAAGGGTATAATAAACTCAAACAGACGCTCCTGGAAGTTGAATACCCTCTGATTGAAGATGAGCTGAGGGCTATTGACGAGCAGCTGACA
GCAGCCACAACGTGGCTGACATGGCAGGATGACTGCTGGGGCTACATCGAGAGGGTGAGGGCAGCCACGTCCGAGTTGGAGCACAGAGTT
GAGCGCACACAGAAAAACGTGAAGGTGATCCAGCAGACCATGAGGGGCTGGGCCAGGTGCGTGCTACCTCCCAGGAGAGAGCACAGACGA
GAGGCAGCCTTCACCTTGGAGGACAAGGGTGATTTGTTTACAAAAAAATACAAGTTAATCCAAGGAGATGGCTGCAAGATCCACAACTTG
GTCGAGGAAAATAGGAAGCTCTTCAAAGCCAATCCCTCTCTGGATACCTGGAAAATTTATGTAGAATTCATTGACGACATTGTGGTGGAA
GGCTTTTTTCAGGCTATAATGCACGACTTAGACTTCTTTCTGAAGAATACAGAGAAACAATTGAAACCGGCACCGTTTTTTCAAGCACAA
ATGATCTTGTTGCCTCCTGAGATTGTGTTTAAACCTTCCCTAGACAGAGAGGCTGGGGATGGCTTCTATGATCTTGTAGAAGAAATGTTA
TGCAATAGTTTTAGAATGTCTGCCCAGATGAACCGAATAGCAACACACCTGGAAATTAAAAATTATCAGAATGATATGGATAACATGTTA
GGCCTGGCAGAGGTCAGGCAGGAGATCATGAACAGAGTGGTGAATGTCATCAACAAAGTCTTAGATTTCAGAAACACCCTGGAGACCCAC
ACTTACCTCTGGGTGGATGATCGAGCTGAGTTTATGAAGCATTTTCTCTTGTATGGCCATGCTGTGTCTTCCGATGAAATGGATGCTCAT
GCAAATGAAGAAATTCCCGAACAACCACCAACTCTTGAGCAATTCAAAGAACAGATTGACATTTATGAAGCTTTGTATGTTCAAATGAGC
AAATTTGAGGACTTTAGAGTGTTTGATAGTTGGTTCAAGGTGGACATGAAGCCTTTCAAAGTGAGCTTGTTAACCATAATTAAGAAATGG
AGCTGGATGTTTCAGGAGCATCTTTTGAGATTTGTCATTGACAGTCTGAATGAGCTACAAGAATTTATAAAGGAGACAGATTCCGGACTT
CAGAGAGAATTAAATGAAGGTGATCATGATGGTTTAGTTGACATCATGGTGCATCTTCTGGCTGTAAGAAGCCGACAGAGAGCTACTGAT
GAACTCTTTGAACCTCTAAAAGAAACGATCACCCTCTTGGAAAGCTATGGCCAGAAGATGCCTGAGCAGGTCTATATTCAGCTAGAGGAA
TTACCTGAAAGATGGGAAACTACCAAAAAGATCGCAGCAACTGTCAGACATGAAGTCTCACCTCTCCATAATGCGGAAGTCACTCTTATA
AGGAAAAAATGTATTTTGTTTGACGCAAAGCAGGCAGAGTTCAGAGAGAGATTCAGACACTATGCCCCTCTTGGATTTAATGCAGAAAAT
CCATACACAGCGCTTGATAAGGCAAATGAAGAGCTTGAGGCCTTAGAAGAAGAAATGTTGCAGATGCAAGAATCTACTCGTCTTTTTGAA
GTGGCTCTTCCAGAGTACAAACAAATGAAACAGTGTCGCAAAGAAATAAAATTGCTCAAGGGACTGTGGGATGTCATTATTTATGTTCGA
AGAAGCATTGATAATTGGACTAAAACCCAGTGGAGACAGATTCATGTGGAACAGATGGATGTAGAACTCAGAAGGTTTGCCAAGGCGAGT
TCCATAACTGAAATTTGGTCACTCAACAAGGAAGTCCGCGTCTGGGATGCTTACACGGGCCTGGAAGGCACAGTTAAGGACATGACAGCC
TCCCTGAGGGCCATCACAGAGTTACAGAGCCCTGCCCTCAGGGACAGGCATTGGCACCAGCTGATGAAAGCTATTGGGGTCAAGTTTTTA
ATAAATGAAGCCACAACTTTGGCAGATTTGTTAGCACTGCGGTTACACAGAGTGGAAGATGATGTCCGAAGGATTGTGGACAAGGCGGTG
AAAGAGCTGGGGACTGAGAAGGTTATTACTGAAATCAGTCAGACCTGGGCAACCATGAAGTTTTCTTACGAAGTTCACTATCGAACAGGC
ATTCCATTACTAAAGTCTGATGAACAACTTTTTGAAACTCTAGAGCACAACCAAGTTCAGTTGCAGACTCTTCTTCAAAGCAAGTATGTA
GAATATTTCATTGAGCAAGTGTTAAGCTGGCAAAATAAATTAAACATAGCAGACTTGGTCATCTTCACTTGGATGGAAGTCCAGCGAACT
TGGTCTCACCTGGAAAGCATTTTTGTCTGTTCAGAAGATATTCGAATCCAGCTTGTGAAAGATGCTAGAAGATTTGATGGGGTGGATGCT
GAATTTAAGGAGTTAATGTTCAAGACAGCCAAAGTAGAAAATGTGTTAGAAGCAACGTGCAGACCTAATCTCTATGAAAAACTTAAAGAT
TTACAGTCCAGGCTTTCTCTTTGTGAAAAAGCTCTCGCTGAATACCTGGAAACCAAGCGCATAGCCTTTCCTCGCTTCTATTTCGTCTCT
TCTGCTGATTTACTTGACATTCTCTCAAAAGGAGCTCAGCCTAAACAGGTAACATGTCACCTTGCCAAACTTTTCGACAGCATTGCAGAT
CTGCAGTTTGAAGACAATCAGGATGTTTCTGCACACAGGGCAGTTGGAATGTACAGCAAAGAAAAGGAGTATGTCCCATTCCAAGCCGAG
TGTGAATGTGTGGGCCATGTGGAAACATGGCTTCTGCAACTTGAACAGACTATGCAAGAAACGGTGCGTCATTCTATAACAGAAGCCATA
GTGGCCTACGAGGAAAAACCTAGGGAACTGTGGATTTTTGATTTCCCAGCTCAGGTTGCACTAACCAGCTCACAAATATGGTGGACCACA
GATGTAGGAATAGCCTTCAGTAGACTGGAAGAAGGCTACGAAACAGCCCTGAAGGATTTCCATAAAAAACAGATTTCTCAGCTGAATACA
CTGATTACACTTTTGCTGGGAGAACTTCCACCTGGAGACAGACAGAAGATCATGACAATTTGTACCATAGATGTCCATGCCAGAGACGTG
GTGGCAAAACTTATTTCTCAGAAGCAAGTTGTTGTCAGTCCCCAAGCTTTTACATGGCTGTCTCAACTTCGTCACCGATGGGAGGATACC
CAGAAACACTGCTTTGTTAATATTTGTGATGCCCAGTTCCAGTACTTCTATGAATACTTAGGAAACAGCCCTCGACTAGTGATCACTCCT
CTAACTGACAGGTGTTATATTACCTTAACTCAATCACTTCATCTAACCATGAGTGGGGCTCCTGCTGGCCCAGCTGGTACCGGGAAAACA
GAGACCACCAAAGACCTAGGACGTGCCCTTGGCATGATGGTCTATGTATTCAACTGTTCAGAGCAAATGGACTACAAATCCATAGGCAAT
ATCTATAAGGGATTGGTGCAGACAGGAGCTTGGGGCTGCTTTGATGAGTTCAACCGAATCTCTGTGGAAGTTCTGTCAGTGGTGGCAGTA
CAAGTGAAAATGATTCATGATGCCATCAGAAACAGGAAGAAGAGATTTGTATTTCTTGGGGAAGCTATCACACTGAAGCCATCAGTTGGA
ATATTTATTACTATGAACCCGGGTTATGCTGGTCGAACCGAATTACCGGAAAATCTCAAAGCTCTTTTCAGACCCTGTGCCATGGTGGCC
CCTGACATTGAGCTAATCTGTGAAATCTTGTTAGTTGCTGAAGGTTTTGTGGATGCGCGTGCATTAGCCCGAAAGTTCATTACGTTGTAC
ACGCTTTGCAAGGAGCTTCTCTCCAAGCAGGATCATTACGACTGGGGACTTCGTGCTATTAAGTCTGTCTTGGTTGTGGCTGGATCTCTG
AAACGAGGAGATAAAAATAGACCCGAAGATCAGGTACTCATGAGAGCATTAAGGGATTTCAATATGCCCAAAATAGTGACTGACGACATC
CCAGTGTTTCTGGGCCTGGTCGGTGACCTGTTTCCAGCCCTGGATGTGCCCCGGAGGAGGAAGCTGCACTTTGAACAGATGGTCAGGCAG
TCTACCCTGGAGCTCCGCCTGCAGCCTGAAGAGAGCTTCATCCTCAAAGTTGTCCAGCTTGAGGAACTGTTGGCTGTGCGGCACTCGGTC
TTTGTAGTTGGAAATGCAGGCACAGGAAAGAGTAAGATTTTGAGAACACTGAACCGAACATATGTTAACATGAAACAGAAGCCGGTTTGG
AATGACTTAAACCCTAAAGCTGTGACAACAGATGAACTCTTTGGTTTCATACATCATGCTACCCGAGAATGGAAAGATGGCAAGATTGTT
TACTCTTATTTTATAGGTCTCTTCTCATCCATTCTACGAGAACAAGCAAATCTTAAGCATGATGGACCAAAATGGATAGTCCTGGATGGC
GATATTGACCCCATGTGGATTGAATCACTGAATACTGTAATGGATGATAACAAGGTGCTGACCCTCGCCAGCAATGAGCGCATTGCACTC
ACTCCCTTCATGAGGCTTCTGTTTGAGATACATCACTTAAGGAGCGCAACCCCGGCCACTGTTTCCAGAGCTGGTATTCTGTATGTGAAC
CCACAAGATCTGGGCTGGAATCCGTATGTGGCCAGTTGGATAGACAGAAGGCGGCATCAATCAGAAAAGGCCAATTTGACTATTCTTTTT
GATAAATATGTCCCTGCATGCTTGGATAAACTGAGAACAAGCTTTAAAACCATCACTTCAATTCCTGAGAGTAGCCTGGTGCAGACTCTA
TGTGTTCTTTTGGAGTGCTTGCTGACTCCTGAAAATGTACCTTCTGACAGCCCAAAAGAAGTTTATGAAGTCTATTTTGTATTTGCTTGT
ATCTGGGCTTTTGGAGGCACCCTGCTACAAGATCAGATTTCTGATTATCAAGCTGACTTCAGTCGGTGGTGGCAGAAAGAGATGAAAGCA
GTGAAATTTCCGTCGCAGGGAACAATCTTTGATTATTATGTGGACCACAAAACTAAGAAATTATTGCCCTGGGCTGACAAAATTGCCCAG
TTTACTATGGATCCAGATGTGCCTCTGCAGACAGTTCTCGTTCACACAACAGAGACAGCTCGTCTTAGATATTTCATGGAGTTGTTGCTT
GAGAAAGGAAAACCTCTAATGCTAGTAGGAAATGCAGGAGTGGGAAAAACAGTCTTTGTAGGTGACACATTGGCAAGTCTCTCTGAGGAT
TACATAGTATCCCGTGTGCCTTTCAACTACTACACGACATCCACAGCTCTGCAAAAAATTCTTGAGAAACCCCTAGAGAAAAAAGCTGGT
CATAACTATGGTCCTGGAGGAAATAAAAAATTGATTTATTTTATCGACGACATGAACATGCCTGAAGTGGACTTATATGGCACCGTTCAG
CCTCACACCCTGATCCGGCAGCATATTGATTATGGACATTGGTATGATAGACAGAAGGTGATGCTTAAAGAAATCCATAACTGCCAGTAT
GTCGCCTGCATGAATCCGATGGTGGGCAGCTTCACCATCAATCCCAGGCTACAGAGACATTTCACAGTGTTTGCATTCAATTTTCCATCT
TTGGATGCACTAAACACCATCTATGGCCAAATCTTTAGCTTCCATTTCCAACAGCAAGCATTTGCTCCATCAATTCTCAGGAGTGGCCCC
ACTTTGATCCAGGCAACAATAGCATTCCATCAGACAATGATGTGTAACTTTTTACCCACGGCTATTAAATTCCACTACATCTTTAATCTG
AGAGATTTATCAAACGTCTTCCAGGGGATTTTATTTGCTTCTCCTGAGTGTTTAAAAGGTCCACTTGATTTAATACATCTGTGGCTTCAT
GAATCTGCCCGTGTTTATGGAGACAAACTGATAGACAAAAAAGATTGTGATTTGTTTCAGAGAAGAATGCTGGAAACTGCTTATAAATAT
TTTGAAGGTATAGATAGTCACATGCTGCTTCAACAGCCCCTCATTTATTGCCACTTTGCTGATAGAGGGAAGGACCCACATTACATGCCA
GTGAAGGACTGGGAAGTGCTGAAGACGATTCTTACAGAAACGTTAGACAACTACAATGAACTAAATGCTGCCATGCACCTAGTTTTGTTT
GAAGATGCCATGCAACATGTGTGTCGCATCAGCCGGATCTTACGAACCCCTCAGGGCTGTGCTCTCTTGGTTGGAGTTGGGGGCAGTGGC
AAGCAGAGCTTGTCCAGGCTGGCAGCTTACCTTCGTGGCCTTGAGGTCTTTCAGATCACTCTGACCGAGGGCTATGGAATCCAGGAACTT
CGGGTAGATCTTGCCAATTTGTACATCCGAACTGGAGCCAAGAACATGCCCACTGTGTTCCTGCTGACAGATGCCCAGGTTCTAGATGAG
AGCTTCCTCGTGCTGATTAATGACTTGCTGGCATCAGGAGAAATCCCAGATCTGTTCAGCGATGAAGATGTGGACAAGATAATTTCTGGA
ATTCATAATGAAGTTCATGCTCTGGGCATGGTAGACTCCAGGGAAAACTGTTGGAAATTCTTTATGGCCAGGGTGCGACTACAGCTCAAA
ATCATTTTGTGTTTCTCTCCAGTTGGTCGCACGCTGAGAGTTAGAGCTCGGAAGTTCCCAGCCATAGTTAACTGCACGGCTATTGACTGG
TTTCATGCGTGGCCGCAGGAGGCTCTGGTCTCCGTCAGCAGGAGGTTCATTGAGGAAACCAAGGGAATTGAGCCAGTGCACAAAGACTCT
ATTAGCCTTTTCATGGCACATGTTCACACCACTGTAAATGAAATGAGTACCAGATATTACCAGAATGAGAGAAGACACAACTATACCACC
CCAAAGAGTTTTCTAGAACAAATATCACTGTTTAAGAACCTGTTGAAGAAGAAGCAAAATGAGGTATCCGAGAAAAAAGAACGCCTGGTG
AACGGCATCCAAAAGCTAAAAACCACAGCCTCTCAGGTGGGAGATCTAAAAGCCAGACTTGCCTCTCAAGAAGCCGAGCTGCAACTGAGA
AATCATGATGCCGAAGCTCTGATCACAAAGATCGGCCTTCAGACGGAGAAAGTGAGCCGGGAAAAGACCATCGCTGATGCTGAGGAGCGA
AAGGTGACAGCCATTCAGACTGAAGTGTTCCAGAAACAGAGAGAATGTGAAGCTGACTTACTCAAGGCTGAGCCTGCACTGGTGGCTGCT
ACAGCTGCACTCAATACACTCAACAGGGTCAACCTCAGTGAGCTGAAAGCCTTTCCCAACCCTCCCATCGCAGTTACCAATGTTACTGCA
GCCGTGATGGTCCTTCTGGCTCCTCGGGGAAGAGTGCCCAAAGACCGAAGTTGGAAAGCAGCTAAAGTCTTCATGGGAAAGGTTGATGAT
TTTTTGCAAGCATTAATTAACTATGACAAAGAGCACATTCCAGAGAACTGTCTAAAAGTGGTGAATGAACACTATTTGAAAGACCCAGAG
TTTAATCCAAACCTGATTCGAACCAAATCTTTTGCAGCAGCTGGCCTGTGTGCCTGGGTCATCAACATCATTAAATTCTATGAGGTCTAC
TGTGATGTGGAGCCAAAACGCCAAGCATTAGCCCAAGCAAACTTAGAACTGGCTGCAGCTACTGAAAAACTAGAGGCTATCAGGAAAAAG
CTTGTGGATCTGGATCGAAATCTGAGCAGACTCACGGCTTCATTTGAAAAAGCAACAGCTGAGAAAGTCCGGTGTCAAGAAGAGGTGAAC
CAAACCAACAAAACCATCAAATTAGCTAACAGACTTGTCAAGGAACTTGAGGCAAAGAAGATTCGCTGGGGTCAATCCATTAAGTCCTTT
GAAGCTCAAGAGAAGACACTCTGTGGAGATGTTCTTCTCACGGCGGCATTTGTGTCTTACGTCGGACCCTTCACAAGGCAGTATCGCCAG
GAGCTGGTGCACTGCAAGTGGGTTCCCTTTCTTCAACAGAAGGTTTCCATTCCACTAACCGAAGGCCTGGACTTGATATCCATGTTGACG
GATGATGCTACAATTGCCGCCTGGAATAACGAAGGACTGCCCAGTGACAGAATGTCCACCGAAAATGCCGCTATCCTAACACACTGTGAG
CGCTGGCCTCTGGTGATAGATCCCCAGCAACAGGGAATTAAGTGGATCAAGAATAAGTATGGAATGGACCTGAAAGTCACACATTTGGGC
CAGAAAGGGTTTTTGAATGCCATTGAAACTGCTTTGGCCTTTGGTGATGTCATCTTAATTGAAAATCTCGAGGAAACGATAGATCCAGTC
CTGGATCCACTACTTGGCAGGAACACAATTAAAAAAGGAAAGTATATCAGGATTGGAGATAAAGAATGTGAATTTAACAAGAACTTTCGC
CTTATCCTTCACACAAAATTGGCAAATCCTCACTATAAGCCGGAATTACAAGCTCAGACAACTCTCCTCAATTTCACAGTCACAGAAGAT
GGTCTAGAAGCCCAGCTGCTGGCAGAGGTTGTCAGTATTGAAAGGCCAGATTTGGAGAAACTTAAGTTGGTATTGACAAAGCACCAAAAT
GATTTTAAAATTGAGCTCAAGTATCTGGAAGACGATCTCCTTTTGCGCCTTTCTGCGGCAGAGGGAAGCTTTCTGGATGACACCAAACTG
GTAGAGAGATTGGAGGCAACAAAGACCACCGTGGCAGAGATAGAGCACAAGGTGATTGAAGCCAAAGAAAATGAAAGAAAAATCAACGAG
GCCCGAGAATGTTACAGACCAGTGGCAGCAAGAGCATCTCTTCTTTATTTTGTTATTAATGACCTCCAAAAAATCAACCCCCTCTACCAA
TTCTCTTTGAAGGCTTTTAACGTGCTGTTCCACAGAGCGATCGAGCAGGCTGACAAGGTGGAAGACATGCAGGGACGCATCTCTATCCTG
ATGGAGAGCATCACCCATGCTGTCTTCCTCTACACCAGCCAGGCGCTGTTTGAGAAGGACAAGCTCACCTTCCTGTCCCAGATGGCTTTT
CAGATTTTGTTGAGAAAGAAAGAGATAGACCCTCTTGAATTGGATTTCCTGCTTCGATTCACAGTTGAACACACTCATCTGAGTCCCGTT
GACTTCCTAACTTCTCAGTCATGGAGTGCTATCAAGGCAATTGCCGTCATGGAAGAATTTCGAGGCATAGACCGAGATGTGGAAGGATCT
GCCAAGCAGTGGAGGAAGTGGGTAGAATCCGAGTGTCCAGAAAAAGAAAAATTACCTCAAGAATGGAAGAAGAAAAGTTTAATACAGAAG
CTGATTCTTCTGAGAGCAATGCGCCCTGACAGAATGACGTATGCTCTCAGAAATTTTGTAGAGGAAAAACTGGGTGCGAAGTATGTGGAG
AGGACCAGATTGGACTTAGTTAAAGCATTCGAAGAAAGCAGCCCAGCCACCCCCATATTCTTCATCCTGTCTCCGGGGGTAGATGCCCTT
AAAGACCTGGAGATTCTTGGCAAAAGACTTGGCTTTACAATTGACTCTGGAAAATTCCACAATGTGTCTTTAGGACAAGGTCAGGAGACG
GTGGCAGAAGTGGCCCTGGAGAAAGCTTCCAAAGGAGGACACTGGGTCATCCTCCAAAATGTTCATTTGGTAGCCAAGTGGCTAGGAACC
TTGGAGAAGCTCCTTGAAAGATTCAGCCAAGGAAGCCACAGAGATTACAGGGTTTTCATGAGTGCTGAGTCTGCACCTACACCAGATGAG
CATATCATCCCTCAAGGACTCCTGGAAAATTCCATTAAGATCACTAATGAACCCCCAACAGGGATGCTGGCCAATTTGCATGCCGCCCTG
TACAACTTTGATCAGGATACACTTGAAATATGCTCCAAGGAGCAGGAGTTTAAAAGCATCCTTTTTTCTCTCTGCTACTTCCACGCCTGT
GTTGCTGGGAGACTGAGGTTTGGCCCCCAGGGCTGGAGCCGAAGCTATCCTTTTAATCCTGGAGACCTCACCATTTGTGCCAGTGTCCTC
TACAACTACTTAGAGGCAAACTCTAAAGTCCCATGGGAAGATCTCCGTTATCTCTTTGGTGAGATCATGTATGGAGGCCACATCACAGAT
GACTGGGATCGCAAACTGTGTCGGGTGTATTTAGAAGAATTCATGAATCCATCTCTGACTGAAGATGAACTGATGCTGGCACCAGGTTTT
GCTGCCCCACCCTACCTAGATTATGCAGGCTACCACCAGTACATAGAGGAGATGCTTCCTCCAGAAAGCCCGGCACTGTATGGCCTCCAC
CCAAATGCTGAAATAGAATTCCTGACAGTGACATCCAACACTCTCTTCAGAACTTTGCTGGAGATGCAGCCCAGGAATGCACTCAGTGGT
GATGAACTGGGGCAGTCTACAGAAGAAAAGGTTAAGAATGTCTTGGATGACATTTTGGAGAAACTTCCAGAAGAGTTCAACATGGCAGAG
ATAATGCAAAAAAATTCAAATAGAAGCCCATATGTTCTTGTTTGCTTCCAAGAATGTGAGAGGATGAATATTCTCATTCGGGAAATACGT
ATATCACTTGAACAACTGGACCTTAGTTTGAAGGGGGAATTGGCATTATCTCCTGCTGTGGAAGCCCAGCAGTTTGCATTGAGTTATGAC
ACGGTACCAGACACTTGGAGCAAACTGGCTTATCCTTCTACTTATGGCCTAGCCCAGTGGTTCAATGACCTCCTCCTGCGATGCCGAGAA
CTCGATACTTGGACACAAGACCTTACCCTTCCGGCTGTCGTGTGGCTCTCCGGCTTCTTCAACCCTCAGTCCTTCTTAACTGCAATCATG
CAGACGATGGCTCGAAAAAATGAGTGGCCCCTGGATAAAACGCGCTTGACTGCTGATGTTACCAAAAAAACAAAGGAAGATTATGGACAC
CCGCCAAGGGAAGGTGCATACCTCCACGGACTCTTCATGGAGGGCGCCCGCTGGGACACCCAAGCAGGAACCATTGTTGAAGCCCGTCTC
AAGGAGCTGGCATGCCCTATGCCGGTCATCTTTGCAAAAGCCACCCCCGTGGACAGACAAGAAACCAAACAGACCTACGAGTGCCCTGTG
TATAGAACCAAACTGAGAGGCCCCAGCTACATCTGGACCTTCAGGCTGAAGAGCGAAGAGAAGACTGCAAAATGGGTTCTGGCTGGAGTG

>In-frame_KLHL7_ENST00000322275_chr7_23145765_+_DNAH11_ENST00000409508_chr7_21584624_+_13320nt
ATGGCAGCCTCTGGGGTGGAGAAGAGCAGCAAGAAGAAGACCGAGAAGAAACTTGCTGCTCGGGAAGAAGCTAAATTGTTGGCGGGTTTC
ATGGGCGTCATGAATAACATGCGGAAACAGATTCCAAGAGATGCAAACCATAAACTTGTTTTTATTTCCAAGAAGATTACTGAAAGCATT
GGAGTAAATGACTTTTCTCAAGTGGTTTTATTTGGAGAGTTACCTGCGTTGTCTCTTGGACATGTATCTGCTTTCCTTGATGAGATTTTA
GTGCCAGTTCTTTCTAATAAGAACAACCATAAGTCCTGGTCCTGTTTTACTTCACAAGATATGGAATATCACATAGAAGTCATGAAAAAG
AAGATGTATATTTTTAGGGGCAAAATGTCTAGAAGAACTCTTCTACCAATTCCCACTGTTGCAGGAAAGATGGATCTGGATCAGAATTGT
TCAGAGAACAAGCCACCGTCAAACGAAAGGATAATACTTCATGCAATTGAATCTGTGGTTATTGAATGGTCACATCAAATCCAAGAAATT
ATAGAAAGAGATTCAGTGCAGCGTTTGTTGAATGGTCTTCACTTGTCTCCTCAAGCAGAACTAGATTTCTGGATGATGAGGAGAGAAAAT
CTGTCATGCATTTATGATCAACTTCAGGCACCTGTTGTCCTCAAAATGGTTAAGATCCTGACAACTAAACAAAGCAGCTATTTTCCTACT
CTGAAGGACATTTTTCTGGCTGTGGAAAATGCTCTTCTCGAAGCCCAAGATGTGGAACTTTACCTGAGACCTCTGAGGAGACACATCCAG
TGTCTCCAGGAGACGGAATTCCCACAGACACGCATATTAATCGCTCCATTATTTCATACCATCTGTCTGATCTGGAGTCATTCCAAGTTT
TATAACACCCCAGCTCGGGTTATAGTTTTATTGCAAGAGTTTTGTAATCTCTTCATTAACCAGGCAACAGCTTACCTTTCACCTGAGGAC
CTTTTGAGGGGAGAAATAGAAGAGTCACTGGAAAAGGTGCAGGTGGCTGTTAACATCTTAAAGACTTTCAAAAACTCCTTTTTCAACTAT
AGAAAAAAATTGGCAAGCTACTTTATGGGAAGAAAGCTGAGACCATGGGATTTCCAGTCTCATCTGGTGTTTTGCAGATTTGACAAGTTT
CTTGATCGTTTAATAAAAATAGAGGATATATTTGCCACCACTTTGGAATTTGAAAAGCTGGAAAGACTGGAATTTGGTGGTACCAAAGGA
GCAATTTTAAATGGACAAGTCCACGAGATGAGTGAAGAACTTATGGAACTCTGTAAACTTTTTAAACAGAGCACTTATGACCCATCTGAT
TGCACTAACATGGAGTTTGAAAGTGATTATGTGGCATTTAAGTCCAAAACTCTGGAATTTGACAGAAGGCTTGGGACAATTATTTGTGAA
GCTTTCTTTAACTGCAATGGCTTAGAAGCTGCATTTAAGCTTTTGACCATATTTGGAAATTTTCTAGAGAAGCCAGTTGTCATGGAAATT
TTCAGCCTACATTACAGCACACTAGTGCATATGTTTAATACAGAGCTGGATGTGTGTAAGCAACTGTATAATGAACACATGAAACAGATT
GAATGTGGTCATGTAGTTCTTAACAAGAACATGCCATTTACCTCAGGAAATATGAAATGGGCCCAGCAGGTTCTCCAACGACTTCAAATG
TTTTGGTCAAACTTCGCATCTCTCCGTTATCTATTTTTGGGCAATCCTGATCACGCTTTAGTTTATCAAAAGTATGTTGAAATGACCACT
TTGCTTGATCAATTTGAAAGTCGTATCTATAATGAATGGAAAAGTAATGTGGATGAAATCTGTGAATTCAATTTGAATCAACCCTTGGTT
AAATTCAGTGCCATAAATGGTCTTCTCTGTGTCAATTTTGACCCAAAGCTAGTGGCTGTATTGAGAGAAGTGAAATATCTTTTGATGTTG
AAGAAACAAGACATACCAGATTCAGCTTTAGCCATCTTCAAGAAAAGGAACACTATTTTAAAGTACATTGGAAATCTTGACCTTCTTGTG
CAAGGGTATAATAAACTCAAACAGACGCTCCTGGAAGTTGAATACCCTCTGATTGAAGATGAGCTGAGGGCTATTGACGAGCAGCTGACA
GCAGCCACAACGTGGCTGACATGGCAGGATGACTGCTGGGGCTACATCGAGAGGGTGAGGGCAGCCACGTCCGAGTTGGAGCACAGAGTT
GAGCGCACACAGAAAAACGTGAAGGTGATCCAGCAGACCATGAGGGGCTGGGCCAGGTGCGTGCTACCTCCCAGGAGAGAGCACAGACGA
GAGGCAGCCTTCACCTTGGAGGACAAGGGTGATTTGTTTACAAAAAAATACAAGTTAATCCAAGGAGATGGCTGCAAGATCCACAACTTG
GTCGAGGAAAATAGGAAGCTCTTCAAAGCCAATCCCTCTCTGGATACCTGGAAAATTTATGTAGAATTCATTGACGACATTGTGGTGGAA
GGCTTTTTTCAGGCTATAATGCACGACTTAGACTTCTTTCTGAAGAATACAGAGAAACAATTGAAACCGGCACCGTTTTTTCAAGCACAA
ATGATCTTGTTGCCTCCTGAGATTGTGTTTAAACCTTCCCTAGACAGAGAGGCTGGGGATGGCTTCTATGATCTTGTAGAAGAAATGTTA
TGCAATAGTTTTAGAATGTCTGCCCAGATGAACCGAATAGCAACACACCTGGAAATTAAAAATTATCAGAATGATATGGATAACATGTTA
GGCCTGGCAGAGGTCAGGCAGGAGATCATGAACAGAGTGGTGAATGTCATCAACAAAGTCTTAGATTTCAGAAACACCCTGGAGACCCAC
ACTTACCTCTGGGTGGATGATCGAGCTGAGTTTATGAAGCATTTTCTCTTGTATGGCCATGCTGTGTCTTCCGATGAAATGGATGCTCAT
GCAAATGAAGAAATTCCCGAACAACCACCAACTCTTGAGCAATTCAAAGAACAGATTGACATTTATGAAGCTTTGTATGTTCAAATGAGC
AAATTTGAGGACTTTAGAGTGTTTGATAGTTGGTTCAAGGTGGACATGAAGCCTTTCAAAGTGAGCTTGTTAACCATAATTAAGAAATGG
AGCTGGATGTTTCAGGAGCATCTTTTGAGATTTGTCATTGACAGTCTGAATGAGCTACAAGAATTTATAAAGGAGACAGATTCCGGACTT
CAGAGAGAATTAAATGAAGGTGATCATGATGGTTTAGTTGACATCATGGTGCATCTTCTGGCTGTAAGAAGCCGACAGAGAGCTACTGAT
GAACTCTTTGAACCTCTAAAAGAAACGATCACCCTCTTGGAAAGCTATGGCCAGAAGATGCCTGAGCAGGTCTATATTCAGCTAGAGGAA
TTACCTGAAAGATGGGAAACTACCAAAAAGATCGCAGCAACTGTCAGACATGAAGTCTCACCTCTCCATAATGCGGAAGTCACTCTTATA
AGGAAAAAATGTATTTTGTTTGACGCAAAGCAGGCAGAGTTCAGAGAGAGATTCAGACACTATGCCCCTCTTGGATTTAATGCAGAAAAT
CCATACACAGCGCTTGATAAGGCAAATGAAGAGCTTGAGGCCTTAGAAGAAGAAATGTTGCAGATGCAAGAATCTACTCGTCTTTTTGAA
GTGGCTCTTCCAGAGTACAAACAAATGAAACAGTGTCGCAAAGAAATAAAATTGCTCAAGGGACTGTGGGATGTCATTATTTATGTTCGA
AGAAGCATTGATAATTGGACTAAAACCCAGTGGAGACAGATTCATGTGGAACAGATGGATGTAGAACTCAGAAGGTTTGCCAAGGAAATT
TGGTCACTCAACAAGGAAGTCCGCGTCTGGGATGCTTACACGGGCCTGGAAGGCACAGTTAAGGACATGACAGCCTCCCTGAGGGCCATC
ACAGAGTTACAGAGCCCTGCCCTCAGGGACAGGCATTGGCACCAGCTGATGAAAGCTATTGGGGTCAAGTTTTTAATAAATGAAGCCACA
ACTTTGGCAGATTTGTTAGCACTGCGGTTACACAGAGTGGAAGATGATGTCCGAAGGATTGTGGACAAGGCGGTGAAAGAGCTGGGGACT
GAGAAGGTTATTACTGAAATCAGTCAGACCTGGGCAACCATGAAGTTTTCTTACGAAGTTCACTATCGAACAGGCATTCCATTACTAAAG
TCTGATGAACAACTTTTTGAAACTCTAGAGCACAACCAAGTTCAGTTGCAGACTCTTCTTCAAAGCAAGTATGTAGAATATTTCATTGAG
CAAGTGTTAAGCTGGCAAAATAAATTAAACATAGCAGACTTGGTCATCTTCACTTGGATGGAAGTCCAGCGAACTTGGTCTCACCTGGAA
AGCATTTTTGTCTGTTCAGAAGATATTCGAATCCAGCTTGTGAAAGATGCTAGAAGATTTGATGGGGTGGATGCTGAATTTAAGGAGTTA
ATGTTCAAGACAGCCAAAGTAGAAAATGTGTTAGAAGCAACGTGCAGACCTAATCTCTATGAAAAACTTAAAGATTTACAGTCCAGGCTT
TCTCTTTGTGAAAAAGCTCTCGCTGAATACCTGGAAACCAAGCGCATAGCCTTTCCTCGCTTCTATTTCGTCTCTTCTGCTGATTTACTT
GACATTCTCTCAAAAGGAGCTCAGCCTAAACAGGTAACATGTCACCTTGCCAAACTTTTCGACAGCATTGCAGATCTGCAGTTTGAAGAC
AATCAGGATGTTTCTGCACACAGGGCAGTTGGAATGTACAGCAAAGAAAAGGAGTATGTCCCATTCCAAGCCGAGTGTGAATGTGTGGGC
CATGTGGAAACATGGCTTCTGCAACTTGAACAGACTATGCAAGAAACGGTGCGTCATTCTATAACAGAAGCCATAGTGGCCTACGAGGAA
AAACCTAGGGAACTGTGGATTTTTGATTTCCCAGCTCAGGTTGCACTAACCAGCTCACAAATATGGTGGACCACAGATGTAGGAATAGCC
TTCAGTAGACTGGAAGAAGGCTACGAAACAGCCCTGAAGGATTTCCATAAAAAACAGATTTCTCAGCTGAATACACTGATTACACTTTTG
CTGGGAGAACTTCCACCTGGAGACAGACAGAAGATCATGACAATTTGTACCATAGATGTCCATGCCAGAGACGTGGTGGCAAAACTTATT
TCTCAGAAGGTTGTCAGTCCCCAAGCTTTTACATGGCTGTCTCAACTTCGTCACCGATGGGAGGATACCCAGAAACACTGCTTTGTTAAT
ATTTGTGATGCCCAGTTCCAGTACTTCTATGAATACTTAGGAAACAGCCCTCGACTAGTGATCACTCCTCTAACTGACAGGTGTTATATT
ACCTTAACTCAATCACTTCATCTAACCATGAGTGGGGCTCCTGCTGGCCCAGCTGGTACCGGGAAAACAGAGACCACCAAAGACCTAGGA
CGTGCCCTTGGCATGATGGTCTATGTATTCAACTGTTCAGAGCAAATGGACTACAAATCCATAGGCAATATCTATAAGGGATTGGTGCAG
ACAGGAGCTTGGGGCTGCTTTGATGAGTTCAACCGAATCTCTGTGGAAGTTCTGTCAGTGGTGGCAGTACAAGTGAAAATGATTCATGAT
GCCATCAGAAACAGGAAGAAGAGATTTGTATTTCTTGGGGAAGCTATCACACTGAAGCCATCAGTTGGAATATTTATTACTATGAACCCG
GGTTATGCTGGTCGAACCGAATTACCGGAAAATCTCAAAGCTCTTTTCAGACCCTGTGCCATGGTGGCCCCTGACATTGAGCTAATCTGT
GAAATCTTGTTAGTTGCTGAAGGTTTTGTGGATGCGCGTGCATTAGCCCGAAAGTTCATTACGTTGTACACGCTTTGCAAGGAGCTTCTC
TCCAAGCAGGATCATTACGACTGGGGACTTCGTGCTATTAAGTCTGTCTTGGTTGTGGCTGGATCTCTGAAACGAGGAGATAAAAATAGA
CCCGAAGATCAGGTACTCATGAGAGCATTAAGGGATTTCAATATGCCCAAAATAGTGACTGACGACATCCCAGTGTTTCTGGGCCTGGTC
GGTGACCTGTTTCCAGCCCTGGATGTGCCCCGGAGGAGGAAGCTGCACTTTGAACAGATGGTCAGGCAGTCTACCCTGGAGCTCCGCCTG
CAGCCTGAAGAGAGCTTCATCCTCAAAGTTGTCCAGCTTGAGGAACTGTTGGCTGTGCGGCACTCGGTCTTTGTAGTTGGAAATGCAGGC
ACAGGAAAGAGTAAGATTTTGAGAACACTGAACCGAACATATGTTAACATGAAACAGAAGCCGGTTTGGAATGACTTAAACCCTAAAGCT
GTGACAACAGATGAACTCTTTGGTTTCATACATCATGCTACCCGAGAATGGAAAGATGGCAAGATTGTTTACTCTTATTTTATAGGTCTC
TTCTCATCCATTCTACGAGAACAAGCAAATCTTAAGCATGATGGACCAAAATGGATAGTCCTGGATGGCGATATTGACCCCATGTGGATT
GAATCACTGAATACTGTAATGGATGATAACAAGGTGCTGACCCTCGCCAGCAATGAGCGCATTGCACTCACTCCCTTCATGAGGCTTCTG
TTTGAGATACATCACTTAAGGAGCGCAACCCCGGCCACTGTTTCCAGAGCTGGTATTCTGTATGTGAACCCACAAGATCTGGGCTGGAAT
CCGTATGTGGCCAGTTGGATAGACAGAAGGCGGCATCAATCAGAAAAGGCCAATTTGACTATTCTTTTTGATAAATATGTCCCTGCATGC
TTGGATAAACTGAGAACAAGCTTTAAAACCATCACTTCAATTCCTGAGAGTAGCCTGGTGCAGACTCTATGTGTTCTTTTGGAGTGCTTG
CTGACTCCTGAAAATGTACCTTCTGACAGCCCAAAAGAAGTTTATGAAGTCTATTTTGTATTTGCTTGTATCTGGGCTTTTGGAGGCACC
CTGCTACAAGATCAGATTTCTGATTATCAAGCTGACTTCAGTCGGTGGTGGCAGAAAGAGATGAAAGCAGTGAAATTTCCGTCGCAGGGA
ACAATCTTTGATTATTATGTGGACCACAAAACTAAGAAATTATTGCCCTGGGCTGACAAAATTGCCCAGTTTACTATGGATCCAGATGTG
CCTCTGCAGACAGTTCTCGTTCACACAACAGAGACAGCTCGTCTTAGATATTTCATGGAGTTGTTGCTTGAGAAAGGAAAACCTCTAATG
CTAGTAGGAAATGCAGGAGTGGGAAAAACAGTCTTTGTAGGTGACACATTGGCAAGTCTCTCTGAGGATTACATAGTATCCCGTGTGCCT
TTCAACTACTACACGACATCCACAGCTCTGCAAAAAATTCTTGAGAAACCCCTAGAGAAAAAAGCTGGTCATAACTATGGTCCTGGAGGA
AATAAAAAATTGATTTATTTTATCGACGACATGAACATGCCTGAAGTGGACTTATATGGCACCGTTCAGCCTCACACCCTGATCCGGCAG
CATATTGATTATGGACATTGGTATGATAGACAGAAGGTGATGCTTAAAGAAATCCATAACTGCCAGTATGTCGCCTGCATGAATCCGATG
GTGGGCAGCTTCACCATCAATCCCAGGCTACAGAGACATTTCACAGTGTTTGCATTCAATTTTCCATCTTTGGATGCACTAAACACCATC
TATGGCCAAATCTTTAGCTTCCATTTCCAACAGCAAGCATTTGCTCCATCAATTCTCAGGAGTGGCCCCACTTTGATCCAGGCAACAATA
GCATTCCATCAGACAATGATGTGTAACTTTTTACCCACGGCTATTAAATTCCACTACATCTTTAATCTGAGAGATTTATCAAACGTCTTC
CAGGGGATTTTATTTGCTTCTCCTGAGTGTTTAAAAGGTCCACTTGATTTAATACATCTGTGGCTTCATGAATCTGCCCGTGTTTATGGA
GACAAACTGATAGACAAAAAAGATTGTGATTTGTTTCAGAGAAGAATGCTGGAAACTGCTTATAAATATTTTGAAGGTATAGATAGTCAC
ATGCTGCTTCAACAGCCCCTCATTTATTGCCACTTTGCTGATAGAGGGAAGGACCCACATTACATGCCAGTGAAGGACTGGGAAGTGCTG
AAGACGATTCTTACAGAAACGTTAGACAACTACAATGAACTAAATGCTGCCATGCACCTAGTTTTGTTTGAAGATGCCATGCAACATGTG
TGTCGCATCAGCCGGATCTTACGAACCCCTCAGGGCTGTGCTCTCTTGGTTGGAGTTGGGGGCAGTGGCAAGCAGAGCTTGTCCAGGCTG
GCAGCTTACCTTCGTGGCCTTGAGGTCTTTCAGATCACTCTGACCGAGGGCTATGGAATCCAGGAACTTCGGGTAGATCTTGCCAATTTG
TACATCCGAACTGGAGCCAAGAACATGCCCACTGTGTTCCTGCTGACAGATGCCCAGGTTCTAGATGAGAGCTTCCTCGTGCTGATTAAT
GACTTGCTGGCATCAGGAGAAATCCCAGATCTGTTCAGCGATGAAGATGTGGACAAGATAATTTCTGGAATTCATAATGAAGTTCATGCT
CTGGGCATGGTAGACTCCAGGGAAAACTGTTGGAAATTCTTTATGGCCAGGGTGCGACTACAGCTCAAAATCATTTTGTGTTTCTCTCCA
GTTGGTCGCACGCTGAGAGTTAGAGCTCGGAAGTTCCCAGCCATAGTTAACTGCACGGCTATTGACTGGTTTCATGCGTGGCCGCAGGAG
GCTCTGGTCTCCGTCAGCAGGAGGTTCATTGAGGAAACCAAGGGAATTGAGCCAGTGCACAAAGACTCTATTAGCCTTTTCATGGCACAT
GTTCACACCACTGTAAATGAAATGAGTACCAGATATTACCAGAATGAGAGAAGACACAACTATACCACCCCAAAGAGTTTTCTAGAACAA
ATATCACTGTTTAAGAACCTGTTGAAGAAGAAGCAAAATGAGGTATCCGAGAAAAAAGAACGCCTGGTGAACGGCATCCAAAAGCTAAAA
ACCACAGCCTCTCAGGTGGGAGATCTAAAAGCCAGACTTGCCTCTCAAGAAGCCGAGCTGCAACTGAGAAATCATGATGCCGAAGCTCTG
ATCACAAAGATCGGCCTTCAGACGGAGAAAGTGAGCCGGGAAAAGACCATCGCTGATGCTGAGGAGCGAAAGGTGACAGCCATTCAGACT
GAAGTGTTCCAGAAACAGAGAGAATGTGAAGCTGACTTACTCAAGGCTGAGCCTGCACTGGTGGCTGCTACAGCTGCACTCAATACACTC
AACAGGGTCAACCTCAGTGAGCTGAAAGCCTTTCCCAACCCTCCCATCGCAGTTACCAATGTTACTGCAGCCGTGATGGTCCTTCTGGCT
CCTCGGGGAAGAGTGCCCAAAGACCGAAGTTGGAAAGCAGCTAAAGTCTTCATGGGAAAGGTTGATGATTTTTTGCAAGCATTAATTAAC
TATGACAAAGAGCACATTCCAGAGAACTGTCTAAAAGTGGTGAATGAACACTATTTGAAAGACCCAGAGTTTAATCCAAACCTGATTCGA
ACCAAATCTTTTGCAGCAGCTGGCCTGTGTGCCTGGGTCATCAACATCATTAAATTCTATGAGGTCTACTGTGATGTGGAGCCAAAACGC
CAAGCATTAGCCCAAGCAAACTTAGAACTGGCTGCAGCTACTGAAAAACTAGAGGCTATCAGGAAAAAGCTTGTGGATCTGGATCGAAAT
CTGAGCAGACTCACGGCTTCATTTGAAAAAGCAACAGCTGAGAAAGTCCGGTGTCAAGAAGAGGTGAACCAAACCAACAAAACCATCAAA
TTAGCTAACAGACTTGTCAAGGAACTTGAGGCAAAGAAGATTCGCTGGGGTCAATCCATTAAGTCCTTTGAAGCTCAAGAGAAGACACTC
TGTGGAGATGTTCTTCTCACGGCGGCATTTGTGTCTTACGTCGGACCCTTCACAAGGCAGTATCGCCAGGAGCTGGTGCACTGCAAGTGG
GTTCCCTTTCTTCAACAGAAGGTTTCCATTCCACTAACCGAAGGCCTGGACTTGATATCCATGTTGACGGATGATGCTACAATTGCCGCC
TGGAATAACGAAGGACTGCCCAGTGACAGAATGTCCACCGAAAATGCCGCTATCCTAACACACTGTGAGCGCTGGCCTCTGGTGATAGAT
CCCCAGCAACAGGGAATTAAGTGGATCAAGAATAAGTATGGAATGGACCTGAAAGTCACACATTTGGGCCAGAAAGGGTTTTTGAATGCC
ATTGAAACTGCTTTGGCCTTTGGTGATGTCATCTTAATTGAAAATCTCGAGGAAACGATAGATCCAGTCCTGGATCCACTACTTGGCAGG
AACACAATTAAAAAAGGAAAGTATATCAGGATTGGAGATAAAGAATGTGAATTTAACAAGAACTTTCGCCTTATCCTTCACACAAAATTG
GCAAATCCTCACTATAAGCCGGAATTACAAGCTCAGACAACTCTCCTCAATTTCACAGTCACAGAAGATGGTCTAGAAGCCCAGCTGCTG
GCAGAGGTTGTCAGTATTGAAAGGCCAGATTTGGAGAAACTTAAGTTGGTATTGACAAAGCACCAAAATGATTTTAAAATTGAGCTCAAG
TATCTGGAAGACGATCTCCTTTTGCGCCTTTCTGCGGCAGAGGGAAGCTTTCTGGATGACACCAAACTGGTAGAGAGATTGGAGGCAACA
AAGACCACCGTGGCAGAGATAGAGCACAAGGTGATTGAAGCCAAAGAAAATGAAAGAAAAATCAACGAGGCCCGAGAATGTTACAGACCA
GTGGCAGCAAGAGCATCTCTTCTTTATTTTGTTATTAATGACCTCCAAAAAATCAACCCCCTCTACCAATTCTCTTTGAAGGCTTTTAAC
GTGCTGTTCCACAGAGCGATCGAGCAGGCTGACAAGGTGGAAGACATGCAGGGACGCATCTCTATCCTGATGGAGAGCATCACCCATGCT
GTCTTCCTCTACACCAGCCAGGCGCTGTTTGAGAAGGACAAGCTCACCTTCCTGTCCCAGATGGCTTTTCAGATTTTGTTGAGAAAGAAA
GAGATAGACCCTCTTGAATTGGATTTCCTGCTTCGATTCACAGTTGAACACACTCATCTGAGTCCCGTTGACTTCCTAACTTCTCAGTCA
TGGAGTGCTATCAAGGCAATTGCCGTCATGGAAGAATTTCGAGGCATAGACCGAGATGTGGAAGGATCTGCCAAGCAGTGGAGGAAGTGG
GTAGAATCCGAGTGTCCAGAAAAAGAAAAATTACCTCAAGAATGGAAGAAGAAAAGTTTAATACAGAAGCTGATTCTTCTGAGAGCAATG
CGCCCTGACAGAATGACGTATGCTCTCAGAAATTTTGTAGAGGAAAAACTGGGTGCGAAGTATGTGGAGAGGACCAGATTGGACTTAGTT
AAAGCATTCGAAGAAAGCAGCCCAGCCACCCCCATATTCTTCATCCTGTCTCCGGGGGTAGATGCCCTTAAAGACCTGGAGATTCTTGGC
AAAAGACTTGGCTTTACAATTGACTCTGGAAAATTCCACAATGTGTCTTTAGGACAAGGTCAGGAGACGGTGGCAGAAGTGGCCCTGGAG
AAAGCTTCCAAAGGAGGACACTGGGTCATCCTCCAAAATGTTCATTTGGTAGCCAAGTGGCTAGGAACCTTGGAGAAGCTCCTTGAAAGA
TTCAGCCAAGGAAGCCACAGAGATTACAGGGTTTTCATGAGTGCTGAGTCTGCACCTACACCAGATGAGCATATCATCCCTCAAGGACTC
CTGGAAAATTCCATTAAGATCACTAATGAACCCCCAACAGGGATGCTGGCCAATTTGCATGCCGCCCTGTACAACTTTGATCAGGATACA
CTTGAAATATGCTCCAAGGAGCAGGAGTTTAAAAGCATCCTTTTTTCTCTCTGCTACTTCCACGCCTGTGTTGCTGGGAGACTGAGGTTT
GGCCCCCAGGGCTGGAGCCGAAGCTATCCTTTTAATCCTGGAGACCTCACCATTTGTGCCAGTGTCCTCTACAACTACTTAGAGGCAAAC
TCTAAAGTCCCATGGGAAGATCTCCGTTATCTCTTTGGTGAGATCATGTATGGAGGCCACATCACAGATGACTGGGATCGCAAACTGTGT
CGGGTGTATTTAGAAGAATTCATGAATCCATCTCTGACTGAAGATGAACTGATGCTGGCACCAGGTTTTGCTGCCCCACCCTACCTAGAT
TATGCAGGCTACCACCAGTACATAGAGGAGATGCTTCCTCCAGAAAGCCCGGCACTGTATGGCCTCCACCCAAATGCTGAAATAGAATTC
CTGACAGTGACATCCAACACTCTCTTCAGAACTTTGCTGGAGATGCAGCCCAGGAATGCACTCAGTGGTGATGAACTGGGGCAGTCTACA
GAAGAAAAGGTTAAGAATGTCTTGGATGACATTTTGGAGAAACTTCCAGAAGAGTTCAACATGGCAGAGATAATGCAAAAAAATTCAAAT
AGAAGCCCATATGTTCTTGTTTGCTTCCAAGAATGTGAGAGGATGAATATTCTCATTCGGGAAATACGTATATCACTTGAACAACTGGAC
CTTAGTTTGAAGGGGGAATTGGCATTATCTCCTGCTGTGGAAGCCCAGCAGTTTGCATTGAGTTATGACACGGTACCAGACACTTGGAGC
AAACTGGCTTATCCTTCTACTTATGGCCTAGCCCAGTGGTTCAATGACCTCCTCCTGCGATGCCGAGAACTCGATACTTGGACACAAGAC
CTTACCCTTCCGGCTGTCGTGTGGCTCTCCGGCTTCTTCAACCCTCAGTCCTTCTTAACTGCAATCATGCAGACGATGGCTCGAAAAAAT
GAGTGGCCCCTGGATAAAACGCGCTTGACTGCTGATGTTACCAAAAAAACAAAGGAAGATTATGGACACCCGCCAAGGGAAGGTGCATAC
CTCCACGGACTCTTCATGGAGGGCGCCCGCTGGGACACCCAAGCAGGAACCATTGTTGAAGCCCGTCTCAAGGAGCTGGCATGCCCTATG
CCGGTCATCTTTGCAAAAGCCACCCCCGTGGACAGACAAGAAACCAAACAGACCTACGAGTGCCCTGTGTATAGAACCAAACTGAGAGGC
CCCAGCTACATCTGGACCTTCAGGCTGAAGAGCGAAGAGAAGACTGCAAAATGGGTTCTGGCTGGAGTGGCTCTGCTTCTAGAAGCGTAA

>In-frame_KLHL7_ENST00000322275_chr7_23145765_+_DNAH11_ENST00000328843_chr7_21584624_+_13341nt
ATGGCAGCCTCTGGGGTGGAGAAGAGCAGCAAGAAGAAGACCGAGAAGAAACTTGCTGCTCGGGAAGAAGCTAAATTGTTGGCGGGTTTC
ATGGGCGTCATGAATAACATGCGGAAACAGATTCCAAGAGATGCAAACCATAAACTTGTTTTTATTTCCAAGAAGATTACTGAAAGCATT
GGAGTAAATGACTTTTCTCAAGTGGTTTTATTTGGAGAGTTACCTGCGTTGTCTCTTGGACATGTATCTGCTTTCCTTGATGAGATTTTA
GTGCCAGTTCTTTCTAATAAGAACAACCATAAGTCCTGGTCCTGTTTTACTTCACAAGATATGGAATATCACATAGAAGTCATGAAAAAG
AAGATGTATATTTTTAGGGGCAAAATGTCTAGAAGAACTCTTCTACCAATTCCCACTGTTGCAGGAAAGATGGATCTGGATCAGAATTGT
TCAGAGAACAAGCCACCGTCAAACGAAAGGATAATACTTCATGCAATTGAATCTGTGGTTATTGAATGGTCACATCAAATCCAAGAAATT
ATAGAAAGAGATTCAGTGCAGCGTTTGTTGAATGGTCTTCACTTGTCTCCTCAAGCAGAACTAGATTTCTGGATGATGAGGAGAGAAAAT
CTGTCATGCATTTATGATCAACTTCAGGCACCTGTTGTCCTCAAAATGGTTAAGATCCTGACAACTAAACAAAGCAGCTATTTTCCTACT
CTGAAGGACATTTTTCTGGCTGTGGAAAATGCTCTTCTCGAAGCCCAAGATGTGGAACTTTACCTGAGACCTCTGAGGAGACACATCCAG
TGTCTCCAGGAGACGGAATTCCCACAGACACGCATATTAATCGCTCCATTATTTCATACCATCTGTCTGATCTGGAGTCATTCCAAGTTT
TATAACACCCCAGCTCGGGTTATAGTTTTATTGCAAGAGTTTTGTAATCTCTTCATTAACCAGGCAACAGCTTACCTTTCACCTGAGGAC
CTTTTGAGGGGAGAAATAGAAGAGTCACTGGAAAAGGTGCAGGTGGCTGTTAACATCTTAAAGACTTTCAAAAACTCCTTTTTCAACTAT
AGAAAAAAATTGGCAAGCTACTTTATGGGAAGAAAGCTGAGACCATGGGATTTCCAGTCTCATCTGGTGTTTTGCAGATTTGACAAGTTT
CTTGATCGTTTAATAAAAATAGAGGATATATTTGCCACCACTTTGGAATTTGAAAAGCTGGAAAGACTGGAATTTGGTGGTACCAAAGGA
GCAATTTTAAATGGACAAGTCCACGAGATGAGTGAAGAACTTATGGAACTCTGTAAACTTTTTAAACAGAGCACTTATGACCCATCTGAT
TGCACTAACATGGAGTTTGAAAGTGATTATGTGGCATTTAAGTCCAAAACTCTGGAATTTGACAGAAGGCTTGGGACAATTATTTGTGAA
GCTTTCTTTAACTGCAATGGCTTAGAAGCTGCATTTAAGCTTTTGACCATATTTGGAAATTTTCTAGAGAAGCCAGTTGTCATGGAAATT
TTCAGCCTACATTACAGCACACTAGTGCATATGTTTAATACAGAGCTGGATGTGTGTAAGCAACTGTATAATGAACACATGAAACAGATT
GAATGTGGTCATGTAGTTCTTAACAAGAACATGCCATTTACCTCAGGAAATATGAAATGGGCCCAGCAGGTTCTCCAACGACTTCAAATG
TTTTGGTCAAACTTCGCATCTCTCCGTTATCTATTTTTGGGCAATCCTGATCACGCTTTAGTTTATCAAAAGTATGTTGAAATGACCACT
TTGCTTGATCAATTTGAAAGTCGTATCTATAATGAATGGAAAAGTAATGTGGATGAAATCTGTGAATTCAATTTGAATCAACCCTTGGTT
AAATTCAGTGCCATAAATGGTCTTCTCTGTGTCAATTTTGACCCAAAGCTAGTGGCTGTATTGAGAGAAGTGAAATATCTTTTGATGTTG
AAGAAACAAGACATACCAGATTCAGCTTTAGCCATCTTCAAGAAAAGGAACACTATTTTAAAGTACATTGGAAATCTTGACCTTCTTGTG
CAAGGGTATAATAAACTCAAACAGACGCTCCTGGAAGTTGAATACCCTCTGATTGAAGATGAGCTGAGGGCTATTGACGAGCAGCTGACA
GCAGCCACAACGTGGCTGACATGGCAGGATGACTGCTGGGGCTACATCGAGAGGGTGAGGGCAGCCACGTCCGAGTTGGAGCACAGAGTT
GAGCGCACACAGAAAAACGTGAAGGTGATCCAGCAGACCATGAGGGGCTGGGCCAGGTGCGTGCTACCTCCCAGGAGAGAGCACAGACGA
GAGGCAGCCTTCACCTTGGAGGACAAGGGTGATTTGTTTACAAAAAAATACAAGTTAATCCAAGGAGATGGCTGCAAGATCCACAACTTG
GTCGAGGAAAATAGGAAGCTCTTCAAAGCCAATCCCTCTCTGGATACCTGGAAAATTTATGTAGAATTCATTGACGACATTGTGGTGGAA
GGCTTTTTTCAGGCTATAATGCACGACTTAGACTTCTTTCTGAAGAATACAGAGAAACAATTGAAACCGGCACCGTTTTTTCAAGCACAA
ATGATCTTGTTGCCTCCTGAGATTGTGTTTAAACCTTCCCTAGACAGAGAGGCTGGGGATGGCTTCTATGATCTTGTAGAAGAAATGTTA
TGCAATAGTTTTAGAATGTCTGCCCAGATGAACCGAATAGCAACACACCTGGAAATTAAAAATTATCAGAATGATATGGATAACATGTTA
GGCCTGGCAGAGGTCAGGCAGGAGATCATGAACAGAGTGGTGAATGTCATCAACAAAGTCTTAGATTTCAGAAACACCCTGGAGACCCAC
ACTTACCTCTGGGTGGATGATCGAGCTGAGTTTATGAAGCATTTTCTCTTGTATGGCCATGCTGTGTCTTCCGATGAAATGGATGCTCAT
GCAAATGAAGAAATTCCCGAACAACCACCAACTCTTGAGCAATTCAAAGAACAGATTGACATTTATGAAGCTTTGTATGTTCAAATGAGC
AAATTTGAGGACTTTAGAGTGTTTGATAGTTGGTTCAAGGTGGACATGAAGCCTTTCAAAGTGAGCTTGTTAACCATAATTAAGAAATGG
AGCTGGATGTTTCAGGAGCATCTTTTGAGATTTGTCATTGACAGTCTGAATGAGCTACAAGAATTTATAAAGGAGACAGATTCCGGACTT
CAGAGAGAATTAAATGAAGGTGATCATGATGGTTTAGTTGACATCATGGTGCATCTTCTGGCTGTAAGAAGCCGACAGAGAGCTACTGAT
GAACTCTTTGAACCTCTAAAAGAAACGATCACCCTCTTGGAAAGCTATGGCCAGAAGATGCCTGAGCAGGTCTATATTCAGCTAGAGGAA
TTACCTGAAAGATGGGAAACTACCAAAAAGATCGCAGCAACTGTCAGACATGAAGTCTCACCTCTCCATAATGCGGAAGTCACTCTTATA
AGGAAAAAATGTATTTTGTTTGACGCAAAGCAGGCAGAGTTCAGAGAGAGATTCAGACACTATGCCCCTCTTGGATTTAATGCAGAAAAT
CCATACACAGCGCTTGATAAGGCAAATGAAGAGCTTGAGGCCTTAGAAGAAGAAATGTTGCAGATGCAAGAATCTACTCGTCTTTTTGAA
GTGGCTCTTCCAGAGTACAAACAAATGAAACAGTGTCGCAAAGAAATAAAATTGCTCAAGGGACTGTGGGATGTCATTATTTATGTTCGA
AGAAGCATTGATAATTGGACTAAAACCCAGTGGAGACAGATTCATGTGGAACAGATGGATGTAGAACTCAGAAGGTTTGCCAAGGCGAGT
TCCATAACTGAAATTTGGTCACTCAACAAGGAAGTCCGCGTCTGGGATGCTTACACGGGCCTGGAAGGCACAGTTAAGGACATGACAGCC
TCCCTGAGGGCCATCACAGAGTTACAGAGCCCTGCCCTCAGGGACAGGCATTGGCACCAGCTGATGAAAGCTATTGGGGTCAAGTTTTTA
ATAAATGAAGCCACAACTTTGGCAGATTTGTTAGCACTGCGGTTACACAGAGTGGAAGATGATGTCCGAAGGATTGTGGACAAGGCGGTG
AAAGAGCTGGGGACTGAGAAGGTTATTACTGAAATCAGTCAGACCTGGGCAACCATGAAGTTTTCTTACGAAGTTCACTATCGAACAGGC
ATTCCATTACTAAAGTCTGATGAACAACTTTTTGAAACTCTAGAGCACAACCAAGTTCAGTTGCAGACTCTTCTTCAAAGCAAGTATGTA
GAATATTTCATTGAGCAAGTGTTAAGCTGGCAAAATAAATTAAACATAGCAGACTTGGTCATCTTCACTTGGATGGAAGTCCAGCGAACT
TGGTCTCACCTGGAAAGCATTTTTGTCTGTTCAGAAGATATTCGAATCCAGCTTGTGAAAGATGCTAGAAGATTTGATGGGGTGGATGCT
GAATTTAAGGAGTTAATGTTCAAGACAGCCAAAGTAGAAAATGTGTTAGAAGCAACGTGCAGACCTAATCTCTATGAAAAACTTAAAGAT
TTACAGTCCAGGCTTTCTCTTTGTGAAAAAGCTCTCGCTGAATACCTGGAAACCAAGCGCATAGCCTTTCCTCGCTTCTATTTCGTCTCT
TCTGCTGATTTACTTGACATTCTCTCAAAAGGAGCTCAGCCTAAACAGGTAACATGTCACCTTGCCAAACTTTTCGACAGCATTGCAGAT
CTGCAGTTTGAAGACAATCAGGATGTTTCTGCACACAGGGCAGTTGGAATGTACAGCAAAGAAAAGGAGTATGTCCCATTCCAAGCCGAG
TGTGAATGTGTGGGCCATGTGGAAACATGGCTTCTGCAACTTGAACAGACTATGCAAGAAACGGTGCGTCATTCTATAACAGAAGCCATA
GTGGCCTACGAGGAAAAACCTAGGGAACTGTGGATTTTTGATTTCCCAGCTCAGGTTGCACTAACCAGCTCACAAATATGGTGGACCACA
GATGTAGGAATAGCCTTCAGTAGACTGGAAGAAGGCTACGAAACAGCCCTGAAGGATTTCCATAAAAAACAGATTTCTCAGCTGAATACA
CTGATTACACTTTTGCTGGGAGAACTTCCACCTGGAGACAGACAGAAGATCATGACAATTTGTACCATAGATGTCCATGCCAGAGACGTG
GTGGCAAAACTTATTTCTCAGAAGCAAGTTGTTGTCAGTCCCCAAGCTTTTACATGGCTGTCTCAACTTCGTCACCGATGGGAGGATACC
CAGAAACACTGCTTTGTTAATATTTGTGATGCCCAGTTCCAGTACTTCTATGAATACTTAGGAAACAGCCCTCGACTAGTGATCACTCCT
CTAACTGACAGGTGTTATATTACCTTAACTCAATCACTTCATCTAACCATGAGTGGGGCTCCTGCTGGCCCAGCTGGTACCGGGAAAACA
GAGACCACCAAAGACCTAGGACGTGCCCTTGGCATGATGGTCTATGTATTCAACTGTTCAGAGCAAATGGACTACAAATCCATAGGCAAT
ATCTATAAGGGATTGGTGCAGACAGGAGCTTGGGGCTGCTTTGATGAGTTCAACCGAATCTCTGTGGAAGTTCTGTCAGTGGTGGCAGTA
CAAGTGAAAATGATTCATGATGCCATCAGAAACAGGAAGAAGAGATTTGTATTTCTTGGGGAAGCTATCACACTGAAGCCATCAGTTGGA
ATATTTATTACTATGAACCCGGGTTATGCTGGTCGAACCGAATTACCGGAAAATCTCAAAGCTCTTTTCAGACCCTGTGCCATGGTGGCC
CCTGACATTGAGCTAATCTGTGAAATCTTGTTAGTTGCTGAAGGTTTTGTGGATGCGCGTGCATTAGCCCGAAAGTTCATTACGTTGTAC
ACGCTTTGCAAGGAGCTTCTCTCCAAGCAGGATCATTACGACTGGGGACTTCGTGCTATTAAGTCTGTCTTGGTTGTGGCTGGATCTCTG
AAACGAGGAGATAAAAATAGACCCGAAGATCAGGTACTCATGAGAGCATTAAGGGATTTCAATATGCCCAAAATAGTGACTGACGACATC
CCAGTGTTTCTGGGCCTGGTCGGTGACCTGTTTCCAGCCCTGGATGTGCCCCGGAGGAGGAAGCTGCACTTTGAACAGATGGTCAGGCAG
TCTACCCTGGAGCTCCGCCTGCAGCCTGAAGAGAGCTTCATCCTCAAAGTTGTCCAGCTTGAGGAACTGTTGGCTGTGCGGCACTCGGTC
TTTGTAGTTGGAAATGCAGGCACAGGAAAGAGTAAGATTTTGAGAACACTGAACCGAACATATGTTAACATGAAACAGAAGCCGGTTTGG
AATGACTTAAACCCTAAAGCTGTGACAACAGATGAACTCTTTGGTTTCATACATCATGCTACCCGAGAATGGAAAGATGGCAAGATTGTT
TACTCTTATTTTATAGGTCTCTTCTCATCCATTCTACGAGAACAAGCAAATCTTAAGCATGATGGACCAAAATGGATAGTCCTGGATGGC
GATATTGACCCCATGTGGATTGAATCACTGAATACTGTAATGGATGATAACAAGGTGCTGACCCTCGCCAGCAATGAGCGCATTGCACTC
ACTCCCTTCATGAGGCTTCTGTTTGAGATACATCACTTAAGGAGCGCAACCCCGGCCACTGTTTCCAGAGCTGGTATTCTGTATGTGAAC
CCACAAGATCTGGGCTGGAATCCGTATGTGGCCAGTTGGATAGACAGAAGGCGGCATCAATCAGAAAAGGCCAATTTGACTATTCTTTTT
GATAAATATGTCCCTGCATGCTTGGATAAACTGAGAACAAGCTTTAAAACCATCACTTCAATTCCTGAGAGTAGCCTGGTGCAGACTCTA
TGTGTTCTTTTGGAGTGCTTGCTGACTCCTGAAAATGTACCTTCTGACAGCCCAAAAGAAGTTTATGAAGTCTATTTTGTATTTGCTTGT
ATCTGGGCTTTTGGAGGCACCCTGCTACAAGATCAGATTTCTGATTATCAAGCTGACTTCAGTCGGTGGTGGCAGAAAGAGATGAAAGCA
GTGAAATTTCCGTCGCAGGGAACAATCTTTGATTATTATGTGGACCACAAAACTAAGAAATTATTGCCCTGGGCTGACAAAATTGCCCAG
TTTACTATGGATCCAGATGTGCCTCTGCAGACAGTTCTCGTTCACACAACAGAGACAGCTCGTCTTAGATATTTCATGGAGTTGTTGCTT
GAGAAAGGAAAACCTCTAATGCTAGTAGGAAATGCAGGAGTGGGAAAAACAGTCTTTGTAGGTGACACATTGGCAAGTCTCTCTGAGGAT
TACATAGTATCCCGTGTGCCTTTCAACTACTACACGACATCCACAGCTCTGCAAAAAATTCTTGAGAAACCCCTAGAGAAAAAAGCTGGT
CATAACTATGGTCCTGGAGGAAATAAAAAATTGATTTATTTTATCGACGACATGAACATGCCTGAAGTGGACTTATATGGCACCGTTCAG
CCTCACACCCTGATCCGGCAGCATATTGATTATGGACATTGGTATGATAGACAGAAGGTGATGCTTAAAGAAATCCATAACTGCCAGTAT
GTCGCCTGCATGAATCCGATGGTGGGCAGCTTCACCATCAATCCCAGGCTACAGAGACATTTCACAGTGTTTGCATTCAATTTTCCATCT
TTGGATGCACTAAACACCATCTATGGCCAAATCTTTAGCTTCCATTTCCAACAGCAAGCATTTGCTCCATCAATTCTCAGGAGTGGCCCC
ACTTTGATCCAGGCAACAATAGCATTCCATCAGACAATGATGTGTAACTTTTTACCCACGGCTATTAAATTCCACTACATCTTTAATCTG
AGAGATTTATCAAACGTCTTCCAGGGGATTTTATTTGCTTCTCCTGAGTGTTTAAAAGGTCCACTTGATTTAATACATCTGTGGCTTCAT
GAATCTGCCCGTGTTTATGGAGACAAACTGATAGACAAAAAAGATTGTGATTTGTTTCAGAGAAGAATGCTGGAAACTGCTTATAAATAT
TTTGAAGGTATAGATAGTCACATGCTGCTTCAACAGCCCCTCATTTATTGCCACTTTGCTGATAGAGGGAAGGACCCACATTACATGCCA
GTGAAGGACTGGGAAGTGCTGAAGACGATTCTTACAGAAACGTTAGACAACTACAATGAACTAAATGCTGCCATGCACCTAGTTTTGTTT
GAAGATGCCATGCAACATGTGTGTCGCATCAGCCGGATCTTACGAACCCCTCAGGGCTGTGCTCTCTTGGTTGGAGTTGGGGGCAGTGGC
AAGCAGAGCTTGTCCAGGCTGGCAGCTTACCTTCGTGGCCTTGAGGTCTTTCAGATCACTCTGACCGAGGGCTATGGAATCCAGGAACTT
CGGGTAGATCTTGCCAATTTGTACATCCGAACTGGAGCCAAGAACATGCCCACTGTGTTCCTGCTGACAGATGCCCAGGTTCTAGATGAG
AGCTTCCTCGTGCTGATTAATGACTTGCTGGCATCAGGAGAAATCCCAGATCTGTTCAGCGATGAAGATGTGGACAAGATAATTTCTGGA
ATTCATAATGAAGTTCATGCTCTGGGCATGGTAGACTCCAGGGAAAACTGTTGGAAATTCTTTATGGCCAGGGTGCGACTACAGCTCAAA
ATCATTTTGTGTTTCTCTCCAGTTGGTCGCACGCTGAGAGTTAGAGCTCGGAAGTTCCCAGCCATAGTTAACTGCACGGCTATTGACTGG
TTTCATGCGTGGCCGCAGGAGGCTCTGGTCTCCGTCAGCAGGAGGTTCATTGAGGAAACCAAGGGAATTGAGCCAGTGCACAAAGACTCT
ATTAGCCTTTTCATGGCACATGTTCACACCACTGTAAATGAAATGAGTACCAGATATTACCAGAATGAGAGAAGACACAACTATACCACC
CCAAAGAGTTTTCTAGAACAAATATCACTGTTTAAGAACCTGTTGAAGAAGAAGCAAAATGAGGTATCCGAGAAAAAAGAACGCCTGGTG
AACGGCATCCAAAAGCTAAAAACCACAGCCTCTCAGGTGGGAGATCTAAAAGCCAGACTTGCCTCTCAAGAAGCCGAGCTGCAACTGAGA
AATCATGATGCCGAAGCTCTGATCACAAAGATCGGCCTTCAGACGGAGAAAGTGAGCCGGGAAAAGACCATCGCTGATGCTGAGGAGCGA
AAGGTGACAGCCATTCAGACTGAAGTGTTCCAGAAACAGAGAGAATGTGAAGCTGACTTACTCAAGGCTGAGCCTGCACTGGTGGCTGCT
ACAGCTGCACTCAATACACTCAACAGGGTCAACCTCAGTGAGCTGAAAGCCTTTCCCAACCCTCCCATCGCAGTTACCAATGTTACTGCA
GCCGTGATGGTCCTTCTGGCTCCTCGGGGAAGAGTGCCCAAAGACCGAAGTTGGAAAGCAGCTAAAGTCTTCATGGGAAAGGTTGATGAT
TTTTTGCAAGCATTAATTAACTATGACAAAGAGCACATTCCAGAGAACTGTCTAAAAGTGGTGAATGAACACTATTTGAAAGACCCAGAG
TTTAATCCAAACCTGATTCGAACCAAATCTTTTGCAGCAGCTGGCCTGTGTGCCTGGGTCATCAACATCATTAAATTCTATGAGGTCTAC
TGTGATGTGGAGCCAAAACGCCAAGCATTAGCCCAAGCAAACTTAGAACTGGCTGCAGCTACTGAAAAACTAGAGGCTATCAGGAAAAAG
CTTGTGGATCTGGATCGAAATCTGAGCAGACTCACGGCTTCATTTGAAAAAGCAACAGCTGAGAAAGTCCGGTGTCAAGAAGAGGTGAAC
CAAACCAACAAAACCATCAAATTAGCTAACAGACTTGTCAAGGAACTTGAGGCAAAGAAGATTCGCTGGGGTCAATCCATTAAGTCCTTT
GAAGCTCAAGAGAAGACACTCTGTGGAGATGTTCTTCTCACGGCGGCATTTGTGTCTTACGTCGGACCCTTCACAAGGCAGTATCGCCAG
GAGCTGGTGCACTGCAAGTGGGTTCCCTTTCTTCAACAGAAGGTTTCCATTCCACTAACCGAAGGCCTGGACTTGATATCCATGTTGACG
GATGATGCTACAATTGCCGCCTGGAATAACGAAGGACTGCCCAGTGACAGAATGTCCACCGAAAATGCCGCTATCCTAACACACTGTGAG
CGCTGGCCTCTGGTGATAGATCCCCAGCAACAGGGAATTAAGTGGATCAAGAATAAGTATGGAATGGACCTGAAAGTCACACATTTGGGC
CAGAAAGGGTTTTTGAATGCCATTGAAACTGCTTTGGCCTTTGGTGATGTCATCTTAATTGAAAATCTCGAGGAAACGATAGATCCAGTC
CTGGATCCACTACTTGGCAGGAACACAATTAAAAAAGGAAAGTATATCAGGATTGGAGATAAAGAATGTGAATTTAACAAGAACTTTCGC
CTTATCCTTCACACAAAATTGGCAAATCCTCACTATAAGCCGGAATTACAAGCTCAGACAACTCTCCTCAATTTCACAGTCACAGAAGAT
GGTCTAGAAGCCCAGCTGCTGGCAGAGGTTGTCAGTATTGAAAGGCCAGATTTGGAGAAACTTAAGTTGGTATTGACAAAGCACCAAAAT
GATTTTAAAATTGAGCTCAAGTATCTGGAAGACGATCTCCTTTTGCGCCTTTCTGCGGCAGAGGGAAGCTTTCTGGATGACACCAAACTG
GTAGAGAGATTGGAGGCAACAAAGACCACCGTGGCAGAGATAGAGCACAAGGTGATTGAAGCCAAAGAAAATGAAAGAAAAATCAACGAG
GCCCGAGAATGTTACAGACCAGTGGCAGCAAGAGCATCTCTTCTTTATTTTGTTATTAATGACCTCCAAAAAATCAACCCCCTCTACCAA
TTCTCTTTGAAGGCTTTTAACGTGCTGTTCCACAGAGCGATCGAGCAGGCTGACAAGGTGGAAGACATGCAGGGACGCATCTCTATCCTG
ATGGAGAGCATCACCCATGCTGTCTTCCTCTACACCAGCCAGGCGCTGTTTGAGAAGGACAAGCTCACCTTCCTGTCCCAGATGGCTTTT
CAGATTTTGTTGAGAAAGAAAGAGATAGACCCTCTTGAATTGGATTTCCTGCTTCGATTCACAGTTGAACACACTCATCTGAGTCCCGTT
GACTTCCTAACTTCTCAGTCATGGAGTGCTATCAAGGCAATTGCCGTCATGGAAGAATTTCGAGGCATAGACCGAGATGTGGAAGGATCT
GCCAAGCAGTGGAGGAAGTGGGTAGAATCCGAGTGTCCAGAAAAAGAAAAATTACCTCAAGAATGGAAGAAGAAAAGTTTAATACAGAAG
CTGATTCTTCTGAGAGCAATGCGCCCTGACAGAATGACGTATGCTCTCAGAAATTTTGTAGAGGAAAAACTGGGTGCGAAGTATGTGGAG
AGGACCAGATTGGACTTAGTTAAAGCATTCGAAGAAAGCAGCCCAGCCACCCCCATATTCTTCATCCTGTCTCCGGGGGTAGATGCCCTT
AAAGACCTGGAGATTCTTGGCAAAAGACTTGGCTTTACAATTGACTCTGGAAAATTCCACAATGTGTCTTTAGGACAAGGTCAGGAGACG
GTGGCAGAAGTGGCCCTGGAGAAAGCTTCCAAAGGAGGACACTGGGTCATCCTCCAAAATGTTCATTTGGTAGCCAAGTGGCTAGGAACC
TTGGAGAAGCTCCTTGAAAGATTCAGCCAAGGAAGCCACAGAGATTACAGGGTTTTCATGAGTGCTGAGTCTGCACCTACACCAGATGAG
CATATCATCCCTCAAGGACTCCTGGAAAATTCCATTAAGATCACTAATGAACCCCCAACAGGGATGCTGGCCAATTTGCATGCCGCCCTG
TACAACTTTGATCAGGATACACTTGAAATATGCTCCAAGGAGCAGGAGTTTAAAAGCATCCTTTTTTCTCTCTGCTACTTCCACGCCTGT
GTTGCTGGGAGACTGAGGTTTGGCCCCCAGGGCTGGAGCCGAAGCTATCCTTTTAATCCTGGAGACCTCACCATTTGTGCCAGTGTCCTC
TACAACTACTTAGAGGCAAACTCTAAAGTCCCATGGGAAGATCTCCGTTATCTCTTTGGTGAGATCATGTATGGAGGCCACATCACAGAT
GACTGGGATCGCAAACTGTGTCGGGTGTATTTAGAAGAATTCATGAATCCATCTCTGACTGAAGATGAACTGATGCTGGCACCAGGTTTT
GCTGCCCCACCCTACCTAGATTATGCAGGCTACCACCAGTACATAGAGGAGATGCTTCCTCCAGAAAGCCCGGCACTGTATGGCCTCCAC
CCAAATGCTGAAATAGAATTCCTGACAGTGACATCCAACACTCTCTTCAGAACTTTGCTGGAGATGCAGCCCAGGAATGCACTCAGTGGT
GATGAACTGGGGCAGTCTACAGAAGAAAAGGTTAAGAATGTCTTGGATGACATTTTGGAGAAACTTCCAGAAGAGTTCAACATGGCAGAG
ATAATGCAAAAAAATTCAAATAGAAGCCCATATGTTCTTGTTTGCTTCCAAGAATGTGAGAGGATGAATATTCTCATTCGGGAAATACGT
ATATCACTTGAACAACTGGACCTTAGTTTGAAGGGGGAATTGGCATTATCTCCTGCTGTGGAAGCCCAGCAGTTTGCATTGAGTTATGAC
ACGGTACCAGACACTTGGAGCAAACTGGCTTATCCTTCTACTTATGGCCTAGCCCAGTGGTTCAATGACCTCCTCCTGCGATGCCGAGAA
CTCGATACTTGGACACAAGACCTTACCCTTCCGGCTGTCGTGTGGCTCTCCGGCTTCTTCAACCCTCAGTCCTTCTTAACTGCAATCATG
CAGACGATGGCTCGAAAAAATGAGTGGCCCCTGGATAAAACGCGCTTGACTGCTGATGTTACCAAAAAAACAAAGGAAGATTATGGACAC
CCGCCAAGGGAAGGTGCATACCTCCACGGACTCTTCATGGAGGGCGCCCGCTGGGACACCCAAGCAGGAACCATTGTTGAAGCCCGTCTC
AAGGAGCTGGCATGCCCTATGCCGGTCATCTTTGCAAAAGCCACCCCCGTGGACAGACAAGAAACCAAACAGACCTACGAGTGCCCTGTG
TATAGAACCAAACTGAGAGGCCCCAGCTACATCTGGACCTTCAGGCTGAAGAGCGAAGAGAAGACTGCAAAATGGGTTCTGGCTGGAGTG


* Fusion transcript sequences (Full-length transcript).
>In-frame_KLHL7_ENST00000339077_chr7_23145765_+_DNAH11_ENST00000409508_chr7_21584624_+_14148nt
CGGGTTCTGCCCGGGGACGCAGCCCAGTTGGTAGCGTCGCTCCCTGAGCGTTTCTAAGGGGGCCGCCCGGCCTTGTCTTTCGGCAGTGGC
CGAGCCACCGCCGCCTGCCGCGCGTTCCAGAGCTGGGCGCTGCAGCTGCACTGCCGATCGCCGTGTTTGGTCGATAGAATCCCCAGTGTG
CCCAGAGAGTGCGACCCCTCGCCCGGCCCGGCGAGCCCCGGGCGTGAACCGAGCTGAGGGAGGATGGCAGCCTCTGGGGTGGAGAAGAGC
AGCAAGAAGAAGACCGAGAAGAAACTTGCTGCTCGGGAAGAAGCTAAATTGTTGGCGGGTTTCATGGGCGTCATGAATAACATGCGGAAA
CAGATTCCAAGAGATGCAAACCATAAACTTGTTTTTATTTCCAAGAAGATTACTGAAAGCATTGGAGTAAATGACTTTTCTCAAGTGGTT
TTATTTGGAGAGTTACCTGCGTTGTCTCTTGGACATGTATCTGCTTTCCTTGATGAGATTTTAGTGCCAGTTCTTTCTAATAAGAACAAC
CATAAGTCCTGGTCCTGTTTTACTTCACAAGATATGGAATATCACATAGAAGTCATGAAAAAGAAGATGTATATTTTTAGGGGCAAAATG
TCTAGAAGAACTCTTCTACCAATTCCCACTGTTGCAGGAAAGATGGATCTGGATCAGAATTGTTCAGAGAACAAGCCACCGTCAAACGAA
AGGATAATACTTCATGCAATTGAATCTGTGGTTATTGAATGGTCACATCAAATCCAAGAAATTATAGAAAGAGATTCAGTGCAGCGTTTG
TTGAATGGTCTTCACTTGTCTCCTCAAGCAGAACTAGATTTCTGGATGATGAGGAGAGAAAATCTGTCATGCATTTATGATCAACTTCAG
GCACCTGTTGTCCTCAAAATGGTTAAGATCCTGACAACTAAACAAAGCAGCTATTTTCCTACTCTGAAGGACATTTTTCTGGCTGTGGAA
AATGCTCTTCTCGAAGCCCAAGATGTGGAACTTTACCTGAGACCTCTGAGGAGACACATCCAGTGTCTCCAGGAGACGGAATTCCCACAG
ACACGCATATTAATCGCTCCATTATTTCATACCATCTGTCTGATCTGGAGTCATTCCAAGTTTTATAACACCCCAGCTCGGGTTATAGTT
TTATTGCAAGAGTTTTGTAATCTCTTCATTAACCAGGCAACAGCTTACCTTTCACCTGAGGACCTTTTGAGGGGAGAAATAGAAGAGTCA
CTGGAAAAGGTGCAGGTGGCTGTTAACATCTTAAAGACTTTCAAAAACTCCTTTTTCAACTATAGAAAAAAATTGGCAAGCTACTTTATG
GGAAGAAAGCTGAGACCATGGGATTTCCAGTCTCATCTGGTGTTTTGCAGATTTGACAAGTTTCTTGATCGTTTAATAAAAATAGAGGAT
ATATTTGCCACCACTTTGGAATTTGAAAAGCTGGAAAGACTGGAATTTGGTGGTACCAAAGGAGCAATTTTAAATGGACAAGTCCACGAG
ATGAGTGAAGAACTTATGGAACTCTGTAAACTTTTTAAACAGAGCACTTATGACCCATCTGATTGCACTAACATGGAGTTTGAAAGTGAT
TATGTGGCATTTAAGTCCAAAACTCTGGAATTTGACAGAAGGCTTGGGACAATTATTTGTGAAGCTTTCTTTAACTGCAATGGCTTAGAA
GCTGCATTTAAGCTTTTGACCATATTTGGAAATTTTCTAGAGAAGCCAGTTGTCATGGAAATTTTCAGCCTACATTACAGCACACTAGTG
CATATGTTTAATACAGAGCTGGATGTGTGTAAGCAACTGTATAATGAACACATGAAACAGATTGAATGTGGTCATGTAGTTCTTAACAAG
AACATGCCATTTACCTCAGGAAATATGAAATGGGCCCAGCAGGTTCTCCAACGACTTCAAATGTTTTGGTCAAACTTCGCATCTCTCCGT
TATCTATTTTTGGGCAATCCTGATCACGCTTTAGTTTATCAAAAGTATGTTGAAATGACCACTTTGCTTGATCAATTTGAAAGTCGTATC
TATAATGAATGGAAAAGTAATGTGGATGAAATCTGTGAATTCAATTTGAATCAACCCTTGGTTAAATTCAGTGCCATAAATGGTCTTCTC
TGTGTCAATTTTGACCCAAAGCTAGTGGCTGTATTGAGAGAAGTGAAATATCTTTTGATGTTGAAGAAACAAGACATACCAGATTCAGCT
TTAGCCATCTTCAAGAAAAGGAACACTATTTTAAAGTACATTGGAAATCTTGACCTTCTTGTGCAAGGGTATAATAAACTCAAACAGACG
CTCCTGGAAGTTGAATACCCTCTGATTGAAGATGAGCTGAGGGCTATTGACGAGCAGCTGACAGCAGCCACAACGTGGCTGACATGGCAG
GATGACTGCTGGGGCTACATCGAGAGGGTGAGGGCAGCCACGTCCGAGTTGGAGCACAGAGTTGAGCGCACACAGAAAAACGTGAAGGTG
ATCCAGCAGACCATGAGGGGCTGGGCCAGGTGCGTGCTACCTCCCAGGAGAGAGCACAGACGAGAGGCAGCCTTCACCTTGGAGGACAAG
GGTGATTTGTTTACAAAAAAATACAAGTTAATCCAAGGAGATGGCTGCAAGATCCACAACTTGGTCGAGGAAAATAGGAAGCTCTTCAAA
GCCAATCCCTCTCTGGATACCTGGAAAATTTATGTAGAATTCATTGACGACATTGTGGTGGAAGGCTTTTTTCAGGCTATAATGCACGAC
TTAGACTTCTTTCTGAAGAATACAGAGAAACAATTGAAACCGGCACCGTTTTTTCAAGCACAAATGATCTTGTTGCCTCCTGAGATTGTG
TTTAAACCTTCCCTAGACAGAGAGGCTGGGGATGGCTTCTATGATCTTGTAGAAGAAATGTTATGCAATAGTTTTAGAATGTCTGCCCAG
ATGAACCGAATAGCAACACACCTGGAAATTAAAAATTATCAGAATGATATGGATAACATGTTAGGCCTGGCAGAGGTCAGGCAGGAGATC
ATGAACAGAGTGGTGAATGTCATCAACAAAGTCTTAGATTTCAGAAACACCCTGGAGACCCACACTTACCTCTGGGTGGATGATCGAGCT
GAGTTTATGAAGCATTTTCTCTTGTATGGCCATGCTGTGTCTTCCGATGAAATGGATGCTCATGCAAATGAAGAAATTCCCGAACAACCA
CCAACTCTTGAGCAATTCAAAGAACAGATTGACATTTATGAAGCTTTGTATGTTCAAATGAGCAAATTTGAGGACTTTAGAGTGTTTGAT
AGTTGGTTCAAGGTGGACATGAAGCCTTTCAAAGTGAGCTTGTTAACCATAATTAAGAAATGGAGCTGGATGTTTCAGGAGCATCTTTTG
AGATTTGTCATTGACAGTCTGAATGAGCTACAAGAATTTATAAAGGAGACAGATTCCGGACTTCAGAGAGAATTAAATGAAGGTGATCAT
GATGGTTTAGTTGACATCATGGTGCATCTTCTGGCTGTAAGAAGCCGACAGAGAGCTACTGATGAACTCTTTGAACCTCTAAAAGAAACG
ATCACCCTCTTGGAAAGCTATGGCCAGAAGATGCCTGAGCAGGTCTATATTCAGCTAGAGGAATTACCTGAAAGATGGGAAACTACCAAA
AAGATCGCAGCAACTGTCAGACATGAAGTCTCACCTCTCCATAATGCGGAAGTCACTCTTATAAGGAAAAAATGTATTTTGTTTGACGCA
AAGCAGGCAGAGTTCAGAGAGAGATTCAGACACTATGCCCCTCTTGGATTTAATGCAGAAAATCCATACACAGCGCTTGATAAGGCAAAT
GAAGAGCTTGAGGCCTTAGAAGAAGAAATGTTGCAGATGCAAGAATCTACTCGTCTTTTTGAAGTGGCTCTTCCAGAGTACAAACAAATG
AAACAGTGTCGCAAAGAAATAAAATTGCTCAAGGGACTGTGGGATGTCATTATTTATGTTCGAAGAAGCATTGATAATTGGACTAAAACC
CAGTGGAGACAGATTCATGTGGAACAGATGGATGTAGAACTCAGAAGGTTTGCCAAGGAAATTTGGTCACTCAACAAGGAAGTCCGCGTC
TGGGATGCTTACACGGGCCTGGAAGGCACAGTTAAGGACATGACAGCCTCCCTGAGGGCCATCACAGAGTTACAGAGCCCTGCCCTCAGG
GACAGGCATTGGCACCAGCTGATGAAAGCTATTGGGGTCAAGTTTTTAATAAATGAAGCCACAACTTTGGCAGATTTGTTAGCACTGCGG
TTACACAGAGTGGAAGATGATGTCCGAAGGATTGTGGACAAGGCGGTGAAAGAGCTGGGGACTGAGAAGGTTATTACTGAAATCAGTCAG
ACCTGGGCAACCATGAAGTTTTCTTACGAAGTTCACTATCGAACAGGCATTCCATTACTAAAGTCTGATGAACAACTTTTTGAAACTCTA
GAGCACAACCAAGTTCAGTTGCAGACTCTTCTTCAAAGCAAGTATGTAGAATATTTCATTGAGCAAGTGTTAAGCTGGCAAAATAAATTA
AACATAGCAGACTTGGTCATCTTCACTTGGATGGAAGTCCAGCGAACTTGGTCTCACCTGGAAAGCATTTTTGTCTGTTCAGAAGATATT
CGAATCCAGCTTGTGAAAGATGCTAGAAGATTTGATGGGGTGGATGCTGAATTTAAGGAGTTAATGTTCAAGACAGCCAAAGTAGAAAAT
GTGTTAGAAGCAACGTGCAGACCTAATCTCTATGAAAAACTTAAAGATTTACAGTCCAGGCTTTCTCTTTGTGAAAAAGCTCTCGCTGAA
TACCTGGAAACCAAGCGCATAGCCTTTCCTCGCTTCTATTTCGTCTCTTCTGCTGATTTACTTGACATTCTCTCAAAAGGAGCTCAGCCT
AAACAGGTAACATGTCACCTTGCCAAACTTTTCGACAGCATTGCAGATCTGCAGTTTGAAGACAATCAGGATGTTTCTGCACACAGGGCA
GTTGGAATGTACAGCAAAGAAAAGGAGTATGTCCCATTCCAAGCCGAGTGTGAATGTGTGGGCCATGTGGAAACATGGCTTCTGCAACTT
GAACAGACTATGCAAGAAACGGTGCGTCATTCTATAACAGAAGCCATAGTGGCCTACGAGGAAAAACCTAGGGAACTGTGGATTTTTGAT
TTCCCAGCTCAGGTTGCACTAACCAGCTCACAAATATGGTGGACCACAGATGTAGGAATAGCCTTCAGTAGACTGGAAGAAGGCTACGAA
ACAGCCCTGAAGGATTTCCATAAAAAACAGATTTCTCAGCTGAATACACTGATTACACTTTTGCTGGGAGAACTTCCACCTGGAGACAGA
CAGAAGATCATGACAATTTGTACCATAGATGTCCATGCCAGAGACGTGGTGGCAAAACTTATTTCTCAGAAGGTTGTCAGTCCCCAAGCT
TTTACATGGCTGTCTCAACTTCGTCACCGATGGGAGGATACCCAGAAACACTGCTTTGTTAATATTTGTGATGCCCAGTTCCAGTACTTC
TATGAATACTTAGGAAACAGCCCTCGACTAGTGATCACTCCTCTAACTGACAGGTGTTATATTACCTTAACTCAATCACTTCATCTAACC
ATGAGTGGGGCTCCTGCTGGCCCAGCTGGTACCGGGAAAACAGAGACCACCAAAGACCTAGGACGTGCCCTTGGCATGATGGTCTATGTA
TTCAACTGTTCAGAGCAAATGGACTACAAATCCATAGGCAATATCTATAAGGGATTGGTGCAGACAGGAGCTTGGGGCTGCTTTGATGAG
TTCAACCGAATCTCTGTGGAAGTTCTGTCAGTGGTGGCAGTACAAGTGAAAATGATTCATGATGCCATCAGAAACAGGAAGAAGAGATTT
GTATTTCTTGGGGAAGCTATCACACTGAAGCCATCAGTTGGAATATTTATTACTATGAACCCGGGTTATGCTGGTCGAACCGAATTACCG
GAAAATCTCAAAGCTCTTTTCAGACCCTGTGCCATGGTGGCCCCTGACATTGAGCTAATCTGTGAAATCTTGTTAGTTGCTGAAGGTTTT
GTGGATGCGCGTGCATTAGCCCGAAAGTTCATTACGTTGTACACGCTTTGCAAGGAGCTTCTCTCCAAGCAGGATCATTACGACTGGGGA
CTTCGTGCTATTAAGTCTGTCTTGGTTGTGGCTGGATCTCTGAAACGAGGAGATAAAAATAGACCCGAAGATCAGGTACTCATGAGAGCA
TTAAGGGATTTCAATATGCCCAAAATAGTGACTGACGACATCCCAGTGTTTCTGGGCCTGGTCGGTGACCTGTTTCCAGCCCTGGATGTG
CCCCGGAGGAGGAAGCTGCACTTTGAACAGATGGTCAGGCAGTCTACCCTGGAGCTCCGCCTGCAGCCTGAAGAGAGCTTCATCCTCAAA
GTTGTCCAGCTTGAGGAACTGTTGGCTGTGCGGCACTCGGTCTTTGTAGTTGGAAATGCAGGCACAGGAAAGAGTAAGATTTTGAGAACA
CTGAACCGAACATATGTTAACATGAAACAGAAGCCGGTTTGGAATGACTTAAACCCTAAAGCTGTGACAACAGATGAACTCTTTGGTTTC
ATACATCATGCTACCCGAGAATGGAAAGATGGCAAGATTGTTTACTCTTATTTTATAGGTCTCTTCTCATCCATTCTACGAGAACAAGCA
AATCTTAAGCATGATGGACCAAAATGGATAGTCCTGGATGGCGATATTGACCCCATGTGGATTGAATCACTGAATACTGTAATGGATGAT
AACAAGGTGCTGACCCTCGCCAGCAATGAGCGCATTGCACTCACTCCCTTCATGAGGCTTCTGTTTGAGATACATCACTTAAGGAGCGCA
ACCCCGGCCACTGTTTCCAGAGCTGGTATTCTGTATGTGAACCCACAAGATCTGGGCTGGAATCCGTATGTGGCCAGTTGGATAGACAGA
AGGCGGCATCAATCAGAAAAGGCCAATTTGACTATTCTTTTTGATAAATATGTCCCTGCATGCTTGGATAAACTGAGAACAAGCTTTAAA
ACCATCACTTCAATTCCTGAGAGTAGCCTGGTGCAGACTCTATGTGTTCTTTTGGAGTGCTTGCTGACTCCTGAAAATGTACCTTCTGAC
AGCCCAAAAGAAGTTTATGAAGTCTATTTTGTATTTGCTTGTATCTGGGCTTTTGGAGGCACCCTGCTACAAGATCAGATTTCTGATTAT
CAAGCTGACTTCAGTCGGTGGTGGCAGAAAGAGATGAAAGCAGTGAAATTTCCGTCGCAGGGAACAATCTTTGATTATTATGTGGACCAC
AAAACTAAGAAATTATTGCCCTGGGCTGACAAAATTGCCCAGTTTACTATGGATCCAGATGTGCCTCTGCAGACAGTTCTCGTTCACACA
ACAGAGACAGCTCGTCTTAGATATTTCATGGAGTTGTTGCTTGAGAAAGGAAAACCTCTAATGCTAGTAGGAAATGCAGGAGTGGGAAAA
ACAGTCTTTGTAGGTGACACATTGGCAAGTCTCTCTGAGGATTACATAGTATCCCGTGTGCCTTTCAACTACTACACGACATCCACAGCT
CTGCAAAAAATTCTTGAGAAACCCCTAGAGAAAAAAGCTGGTCATAACTATGGTCCTGGAGGAAATAAAAAATTGATTTATTTTATCGAC
GACATGAACATGCCTGAAGTGGACTTATATGGCACCGTTCAGCCTCACACCCTGATCCGGCAGCATATTGATTATGGACATTGGTATGAT
AGACAGAAGGTGATGCTTAAAGAAATCCATAACTGCCAGTATGTCGCCTGCATGAATCCGATGGTGGGCAGCTTCACCATCAATCCCAGG
CTACAGAGACATTTCACAGTGTTTGCATTCAATTTTCCATCTTTGGATGCACTAAACACCATCTATGGCCAAATCTTTAGCTTCCATTTC
CAACAGCAAGCATTTGCTCCATCAATTCTCAGGAGTGGCCCCACTTTGATCCAGGCAACAATAGCATTCCATCAGACAATGATGTGTAAC
TTTTTACCCACGGCTATTAAATTCCACTACATCTTTAATCTGAGAGATTTATCAAACGTCTTCCAGGGGATTTTATTTGCTTCTCCTGAG
TGTTTAAAAGGTCCACTTGATTTAATACATCTGTGGCTTCATGAATCTGCCCGTGTTTATGGAGACAAACTGATAGACAAAAAAGATTGT
GATTTGTTTCAGAGAAGAATGCTGGAAACTGCTTATAAATATTTTGAAGGTATAGATAGTCACATGCTGCTTCAACAGCCCCTCATTTAT
TGCCACTTTGCTGATAGAGGGAAGGACCCACATTACATGCCAGTGAAGGACTGGGAAGTGCTGAAGACGATTCTTACAGAAACGTTAGAC
AACTACAATGAACTAAATGCTGCCATGCACCTAGTTTTGTTTGAAGATGCCATGCAACATGTGTGTCGCATCAGCCGGATCTTACGAACC
CCTCAGGGCTGTGCTCTCTTGGTTGGAGTTGGGGGCAGTGGCAAGCAGAGCTTGTCCAGGCTGGCAGCTTACCTTCGTGGCCTTGAGGTC
TTTCAGATCACTCTGACCGAGGGCTATGGAATCCAGGAACTTCGGGTAGATCTTGCCAATTTGTACATCCGAACTGGAGCCAAGAACATG
CCCACTGTGTTCCTGCTGACAGATGCCCAGGTTCTAGATGAGAGCTTCCTCGTGCTGATTAATGACTTGCTGGCATCAGGAGAAATCCCA
GATCTGTTCAGCGATGAAGATGTGGACAAGATAATTTCTGGAATTCATAATGAAGTTCATGCTCTGGGCATGGTAGACTCCAGGGAAAAC
TGTTGGAAATTCTTTATGGCCAGGGTGCGACTACAGCTCAAAATCATTTTGTGTTTCTCTCCAGTTGGTCGCACGCTGAGAGTTAGAGCT
CGGAAGTTCCCAGCCATAGTTAACTGCACGGCTATTGACTGGTTTCATGCGTGGCCGCAGGAGGCTCTGGTCTCCGTCAGCAGGAGGTTC
ATTGAGGAAACCAAGGGAATTGAGCCAGTGCACAAAGACTCTATTAGCCTTTTCATGGCACATGTTCACACCACTGTAAATGAAATGAGT
ACCAGATATTACCAGAATGAGAGAAGACACAACTATACCACCCCAAAGAGTTTTCTAGAACAAATATCACTGTTTAAGAACCTGTTGAAG
AAGAAGCAAAATGAGGTATCCGAGAAAAAAGAACGCCTGGTGAACGGCATCCAAAAGCTAAAAACCACAGCCTCTCAGGTGGGAGATCTA
AAAGCCAGACTTGCCTCTCAAGAAGCCGAGCTGCAACTGAGAAATCATGATGCCGAAGCTCTGATCACAAAGATCGGCCTTCAGACGGAG
AAAGTGAGCCGGGAAAAGACCATCGCTGATGCTGAGGAGCGAAAGGTGACAGCCATTCAGACTGAAGTGTTCCAGAAACAGAGAGAATGT
GAAGCTGACTTACTCAAGGCTGAGCCTGCACTGGTGGCTGCTACAGCTGCACTCAATACACTCAACAGGGTCAACCTCAGTGAGCTGAAA
GCCTTTCCCAACCCTCCCATCGCAGTTACCAATGTTACTGCAGCCGTGATGGTCCTTCTGGCTCCTCGGGGAAGAGTGCCCAAAGACCGA
AGTTGGAAAGCAGCTAAAGTCTTCATGGGAAAGGTTGATGATTTTTTGCAAGCATTAATTAACTATGACAAAGAGCACATTCCAGAGAAC
TGTCTAAAAGTGGTGAATGAACACTATTTGAAAGACCCAGAGTTTAATCCAAACCTGATTCGAACCAAATCTTTTGCAGCAGCTGGCCTG
TGTGCCTGGGTCATCAACATCATTAAATTCTATGAGGTCTACTGTGATGTGGAGCCAAAACGCCAAGCATTAGCCCAAGCAAACTTAGAA
CTGGCTGCAGCTACTGAAAAACTAGAGGCTATCAGGAAAAAGCTTGTGGATCTGGATCGAAATCTGAGCAGACTCACGGCTTCATTTGAA
AAAGCAACAGCTGAGAAAGTCCGGTGTCAAGAAGAGGTGAACCAAACCAACAAAACCATCAAATTAGCTAACAGACTTGTCAAGGAACTT
GAGGCAAAGAAGATTCGCTGGGGTCAATCCATTAAGTCCTTTGAAGCTCAAGAGAAGACACTCTGTGGAGATGTTCTTCTCACGGCGGCA
TTTGTGTCTTACGTCGGACCCTTCACAAGGCAGTATCGCCAGGAGCTGGTGCACTGCAAGTGGGTTCCCTTTCTTCAACAGAAGGTTTCC
ATTCCACTAACCGAAGGCCTGGACTTGATATCCATGTTGACGGATGATGCTACAATTGCCGCCTGGAATAACGAAGGACTGCCCAGTGAC
AGAATGTCCACCGAAAATGCCGCTATCCTAACACACTGTGAGCGCTGGCCTCTGGTGATAGATCCCCAGCAACAGGGAATTAAGTGGATC
AAGAATAAGTATGGAATGGACCTGAAAGTCACACATTTGGGCCAGAAAGGGTTTTTGAATGCCATTGAAACTGCTTTGGCCTTTGGTGAT
GTCATCTTAATTGAAAATCTCGAGGAAACGATAGATCCAGTCCTGGATCCACTACTTGGCAGGAACACAATTAAAAAAGGAAAGTATATC
AGGATTGGAGATAAAGAATGTGAATTTAACAAGAACTTTCGCCTTATCCTTCACACAAAATTGGCAAATCCTCACTATAAGCCGGAATTA
CAAGCTCAGACAACTCTCCTCAATTTCACAGTCACAGAAGATGGTCTAGAAGCCCAGCTGCTGGCAGAGGTTGTCAGTATTGAAAGGCCA
GATTTGGAGAAACTTAAGTTGGTATTGACAAAGCACCAAAATGATTTTAAAATTGAGCTCAAGTATCTGGAAGACGATCTCCTTTTGCGC
CTTTCTGCGGCAGAGGGAAGCTTTCTGGATGACACCAAACTGGTAGAGAGATTGGAGGCAACAAAGACCACCGTGGCAGAGATAGAGCAC
AAGGTGATTGAAGCCAAAGAAAATGAAAGAAAAATCAACGAGGCCCGAGAATGTTACAGACCAGTGGCAGCAAGAGCATCTCTTCTTTAT
TTTGTTATTAATGACCTCCAAAAAATCAACCCCCTCTACCAATTCTCTTTGAAGGCTTTTAACGTGCTGTTCCACAGAGCGATCGAGCAG
GCTGACAAGGTGGAAGACATGCAGGGACGCATCTCTATCCTGATGGAGAGCATCACCCATGCTGTCTTCCTCTACACCAGCCAGGCGCTG
TTTGAGAAGGACAAGCTCACCTTCCTGTCCCAGATGGCTTTTCAGATTTTGTTGAGAAAGAAAGAGATAGACCCTCTTGAATTGGATTTC
CTGCTTCGATTCACAGTTGAACACACTCATCTGAGTCCCGTTGACTTCCTAACTTCTCAGTCATGGAGTGCTATCAAGGCAATTGCCGTC
ATGGAAGAATTTCGAGGCATAGACCGAGATGTGGAAGGATCTGCCAAGCAGTGGAGGAAGTGGGTAGAATCCGAGTGTCCAGAAAAAGAA
AAATTACCTCAAGAATGGAAGAAGAAAAGTTTAATACAGAAGCTGATTCTTCTGAGAGCAATGCGCCCTGACAGAATGACGTATGCTCTC
AGAAATTTTGTAGAGGAAAAACTGGGTGCGAAGTATGTGGAGAGGACCAGATTGGACTTAGTTAAAGCATTCGAAGAAAGCAGCCCAGCC
ACCCCCATATTCTTCATCCTGTCTCCGGGGGTAGATGCCCTTAAAGACCTGGAGATTCTTGGCAAAAGACTTGGCTTTACAATTGACTCT
GGAAAATTCCACAATGTGTCTTTAGGACAAGGTCAGGAGACGGTGGCAGAAGTGGCCCTGGAGAAAGCTTCCAAAGGAGGACACTGGGTC
ATCCTCCAAAATGTTCATTTGGTAGCCAAGTGGCTAGGAACCTTGGAGAAGCTCCTTGAAAGATTCAGCCAAGGAAGCCACAGAGATTAC
AGGGTTTTCATGAGTGCTGAGTCTGCACCTACACCAGATGAGCATATCATCCCTCAAGGACTCCTGGAAAATTCCATTAAGATCACTAAT
GAACCCCCAACAGGGATGCTGGCCAATTTGCATGCCGCCCTGTACAACTTTGATCAGGATACACTTGAAATATGCTCCAAGGAGCAGGAG
TTTAAAAGCATCCTTTTTTCTCTCTGCTACTTCCACGCCTGTGTTGCTGGGAGACTGAGGTTTGGCCCCCAGGGCTGGAGCCGAAGCTAT
CCTTTTAATCCTGGAGACCTCACCATTTGTGCCAGTGTCCTCTACAACTACTTAGAGGCAAACTCTAAAGTCCCATGGGAAGATCTCCGT
TATCTCTTTGGTGAGATCATGTATGGAGGCCACATCACAGATGACTGGGATCGCAAACTGTGTCGGGTGTATTTAGAAGAATTCATGAAT
CCATCTCTGACTGAAGATGAACTGATGCTGGCACCAGGTTTTGCTGCCCCACCCTACCTAGATTATGCAGGCTACCACCAGTACATAGAG
GAGATGCTTCCTCCAGAAAGCCCGGCACTGTATGGCCTCCACCCAAATGCTGAAATAGAATTCCTGACAGTGACATCCAACACTCTCTTC
AGAACTTTGCTGGAGATGCAGCCCAGGAATGCACTCAGTGGTGATGAACTGGGGCAGTCTACAGAAGAAAAGGTTAAGAATGTCTTGGAT
GACATTTTGGAGAAACTTCCAGAAGAGTTCAACATGGCAGAGATAATGCAAAAAAATTCAAATAGAAGCCCATATGTTCTTGTTTGCTTC
CAAGAATGTGAGAGGATGAATATTCTCATTCGGGAAATACGTATATCACTTGAACAACTGGACCTTAGTTTGAAGGGGGAATTGGCATTA
TCTCCTGCTGTGGAAGCCCAGCAGTTTGCATTGAGTTATGACACGGTACCAGACACTTGGAGCAAACTGGCTTATCCTTCTACTTATGGC
CTAGCCCAGTGGTTCAATGACCTCCTCCTGCGATGCCGAGAACTCGATACTTGGACACAAGACCTTACCCTTCCGGCTGTCGTGTGGCTC
TCCGGCTTCTTCAACCCTCAGTCCTTCTTAACTGCAATCATGCAGACGATGGCTCGAAAAAATGAGTGGCCCCTGGATAAAACGCGCTTG
ACTGCTGATGTTACCAAAAAAACAAAGGAAGATTATGGACACCCGCCAAGGGAAGGTGCATACCTCCACGGACTCTTCATGGAGGGCGCC
CGCTGGGACACCCAAGCAGGAACCATTGTTGAAGCCCGTCTCAAGGAGCTGGCATGCCCTATGCCGGTCATCTTTGCAAAAGCCACCCCC
GTGGACAGACAAGAAACCAAACAGACCTACGAGTGCCCTGTGTATAGAACCAAACTGAGAGGCCCCAGCTACATCTGGACCTTCAGGCTG
AAGAGCGAAGAGAAGACTGCAAAATGGGTTCTGGCTGGAGTGGCTCTGCTTCTAGAAGCGTAAGGTAACACTGGCATTCCTCTAGCCTCT
GCTGGAGTGCAGTGAGGATTTTCTAGCATGTTGCTGCACTGTTCCCATGCACATTATTCTAACTTTTTAGTAACTCACACGTGCATTCTT
TTTTCAACGCTATCCTTAGAGTGAAAGTCAGAAAAAAATACTAGAAACTAACTCAGGGCTGAGCGTGGTGGCACACGACTGTAATCCCAG
TTACTCAGGAGGTAGGAGAATCACTTGAACCTAGGAGGCAAAGGTTGCAGTGAGCCGAGGTTGCACCACTGCACTCCCTCCTGGGCAACA
GAACAAGACTCCATCTCAAAAAAAAAAAAGTACATCATAAAAGTACATCATATGTGAACATGCAAAAGCAATGCAGCCGGAAAGAACGGA
GATTTTAATTTTTAACAAACAACAAATTAAATTATTAGCCCTTAAACTCTTTCAAAATATAAAAGCAGCAGGCCCCAGGTGAGTCCTGAA
GGAAGAGGCTAGCACTCTGTAAGGCCTCCAGTGTCCAGTGTCTACAATGTTGATGGTCCCCTTTTGTTCAGTCAAGTTTTAATAAAAATA

>In-frame_KLHL7_ENST00000339077_chr7_23145765_+_DNAH11_ENST00000328843_chr7_21584624_+_14169nt
CGGGTTCTGCCCGGGGACGCAGCCCAGTTGGTAGCGTCGCTCCCTGAGCGTTTCTAAGGGGGCCGCCCGGCCTTGTCTTTCGGCAGTGGC
CGAGCCACCGCCGCCTGCCGCGCGTTCCAGAGCTGGGCGCTGCAGCTGCACTGCCGATCGCCGTGTTTGGTCGATAGAATCCCCAGTGTG
CCCAGAGAGTGCGACCCCTCGCCCGGCCCGGCGAGCCCCGGGCGTGAACCGAGCTGAGGGAGGATGGCAGCCTCTGGGGTGGAGAAGAGC
AGCAAGAAGAAGACCGAGAAGAAACTTGCTGCTCGGGAAGAAGCTAAATTGTTGGCGGGTTTCATGGGCGTCATGAATAACATGCGGAAA
CAGATTCCAAGAGATGCAAACCATAAACTTGTTTTTATTTCCAAGAAGATTACTGAAAGCATTGGAGTAAATGACTTTTCTCAAGTGGTT
TTATTTGGAGAGTTACCTGCGTTGTCTCTTGGACATGTATCTGCTTTCCTTGATGAGATTTTAGTGCCAGTTCTTTCTAATAAGAACAAC
CATAAGTCCTGGTCCTGTTTTACTTCACAAGATATGGAATATCACATAGAAGTCATGAAAAAGAAGATGTATATTTTTAGGGGCAAAATG
TCTAGAAGAACTCTTCTACCAATTCCCACTGTTGCAGGAAAGATGGATCTGGATCAGAATTGTTCAGAGAACAAGCCACCGTCAAACGAA
AGGATAATACTTCATGCAATTGAATCTGTGGTTATTGAATGGTCACATCAAATCCAAGAAATTATAGAAAGAGATTCAGTGCAGCGTTTG
TTGAATGGTCTTCACTTGTCTCCTCAAGCAGAACTAGATTTCTGGATGATGAGGAGAGAAAATCTGTCATGCATTTATGATCAACTTCAG
GCACCTGTTGTCCTCAAAATGGTTAAGATCCTGACAACTAAACAAAGCAGCTATTTTCCTACTCTGAAGGACATTTTTCTGGCTGTGGAA
AATGCTCTTCTCGAAGCCCAAGATGTGGAACTTTACCTGAGACCTCTGAGGAGACACATCCAGTGTCTCCAGGAGACGGAATTCCCACAG
ACACGCATATTAATCGCTCCATTATTTCATACCATCTGTCTGATCTGGAGTCATTCCAAGTTTTATAACACCCCAGCTCGGGTTATAGTT
TTATTGCAAGAGTTTTGTAATCTCTTCATTAACCAGGCAACAGCTTACCTTTCACCTGAGGACCTTTTGAGGGGAGAAATAGAAGAGTCA
CTGGAAAAGGTGCAGGTGGCTGTTAACATCTTAAAGACTTTCAAAAACTCCTTTTTCAACTATAGAAAAAAATTGGCAAGCTACTTTATG
GGAAGAAAGCTGAGACCATGGGATTTCCAGTCTCATCTGGTGTTTTGCAGATTTGACAAGTTTCTTGATCGTTTAATAAAAATAGAGGAT
ATATTTGCCACCACTTTGGAATTTGAAAAGCTGGAAAGACTGGAATTTGGTGGTACCAAAGGAGCAATTTTAAATGGACAAGTCCACGAG
ATGAGTGAAGAACTTATGGAACTCTGTAAACTTTTTAAACAGAGCACTTATGACCCATCTGATTGCACTAACATGGAGTTTGAAAGTGAT
TATGTGGCATTTAAGTCCAAAACTCTGGAATTTGACAGAAGGCTTGGGACAATTATTTGTGAAGCTTTCTTTAACTGCAATGGCTTAGAA
GCTGCATTTAAGCTTTTGACCATATTTGGAAATTTTCTAGAGAAGCCAGTTGTCATGGAAATTTTCAGCCTACATTACAGCACACTAGTG
CATATGTTTAATACAGAGCTGGATGTGTGTAAGCAACTGTATAATGAACACATGAAACAGATTGAATGTGGTCATGTAGTTCTTAACAAG
AACATGCCATTTACCTCAGGAAATATGAAATGGGCCCAGCAGGTTCTCCAACGACTTCAAATGTTTTGGTCAAACTTCGCATCTCTCCGT
TATCTATTTTTGGGCAATCCTGATCACGCTTTAGTTTATCAAAAGTATGTTGAAATGACCACTTTGCTTGATCAATTTGAAAGTCGTATC
TATAATGAATGGAAAAGTAATGTGGATGAAATCTGTGAATTCAATTTGAATCAACCCTTGGTTAAATTCAGTGCCATAAATGGTCTTCTC
TGTGTCAATTTTGACCCAAAGCTAGTGGCTGTATTGAGAGAAGTGAAATATCTTTTGATGTTGAAGAAACAAGACATACCAGATTCAGCT
TTAGCCATCTTCAAGAAAAGGAACACTATTTTAAAGTACATTGGAAATCTTGACCTTCTTGTGCAAGGGTATAATAAACTCAAACAGACG
CTCCTGGAAGTTGAATACCCTCTGATTGAAGATGAGCTGAGGGCTATTGACGAGCAGCTGACAGCAGCCACAACGTGGCTGACATGGCAG
GATGACTGCTGGGGCTACATCGAGAGGGTGAGGGCAGCCACGTCCGAGTTGGAGCACAGAGTTGAGCGCACACAGAAAAACGTGAAGGTG
ATCCAGCAGACCATGAGGGGCTGGGCCAGGTGCGTGCTACCTCCCAGGAGAGAGCACAGACGAGAGGCAGCCTTCACCTTGGAGGACAAG
GGTGATTTGTTTACAAAAAAATACAAGTTAATCCAAGGAGATGGCTGCAAGATCCACAACTTGGTCGAGGAAAATAGGAAGCTCTTCAAA
GCCAATCCCTCTCTGGATACCTGGAAAATTTATGTAGAATTCATTGACGACATTGTGGTGGAAGGCTTTTTTCAGGCTATAATGCACGAC
TTAGACTTCTTTCTGAAGAATACAGAGAAACAATTGAAACCGGCACCGTTTTTTCAAGCACAAATGATCTTGTTGCCTCCTGAGATTGTG
TTTAAACCTTCCCTAGACAGAGAGGCTGGGGATGGCTTCTATGATCTTGTAGAAGAAATGTTATGCAATAGTTTTAGAATGTCTGCCCAG
ATGAACCGAATAGCAACACACCTGGAAATTAAAAATTATCAGAATGATATGGATAACATGTTAGGCCTGGCAGAGGTCAGGCAGGAGATC
ATGAACAGAGTGGTGAATGTCATCAACAAAGTCTTAGATTTCAGAAACACCCTGGAGACCCACACTTACCTCTGGGTGGATGATCGAGCT
GAGTTTATGAAGCATTTTCTCTTGTATGGCCATGCTGTGTCTTCCGATGAAATGGATGCTCATGCAAATGAAGAAATTCCCGAACAACCA
CCAACTCTTGAGCAATTCAAAGAACAGATTGACATTTATGAAGCTTTGTATGTTCAAATGAGCAAATTTGAGGACTTTAGAGTGTTTGAT
AGTTGGTTCAAGGTGGACATGAAGCCTTTCAAAGTGAGCTTGTTAACCATAATTAAGAAATGGAGCTGGATGTTTCAGGAGCATCTTTTG
AGATTTGTCATTGACAGTCTGAATGAGCTACAAGAATTTATAAAGGAGACAGATTCCGGACTTCAGAGAGAATTAAATGAAGGTGATCAT
GATGGTTTAGTTGACATCATGGTGCATCTTCTGGCTGTAAGAAGCCGACAGAGAGCTACTGATGAACTCTTTGAACCTCTAAAAGAAACG
ATCACCCTCTTGGAAAGCTATGGCCAGAAGATGCCTGAGCAGGTCTATATTCAGCTAGAGGAATTACCTGAAAGATGGGAAACTACCAAA
AAGATCGCAGCAACTGTCAGACATGAAGTCTCACCTCTCCATAATGCGGAAGTCACTCTTATAAGGAAAAAATGTATTTTGTTTGACGCA
AAGCAGGCAGAGTTCAGAGAGAGATTCAGACACTATGCCCCTCTTGGATTTAATGCAGAAAATCCATACACAGCGCTTGATAAGGCAAAT
GAAGAGCTTGAGGCCTTAGAAGAAGAAATGTTGCAGATGCAAGAATCTACTCGTCTTTTTGAAGTGGCTCTTCCAGAGTACAAACAAATG
AAACAGTGTCGCAAAGAAATAAAATTGCTCAAGGGACTGTGGGATGTCATTATTTATGTTCGAAGAAGCATTGATAATTGGACTAAAACC
CAGTGGAGACAGATTCATGTGGAACAGATGGATGTAGAACTCAGAAGGTTTGCCAAGGCGAGTTCCATAACTGAAATTTGGTCACTCAAC
AAGGAAGTCCGCGTCTGGGATGCTTACACGGGCCTGGAAGGCACAGTTAAGGACATGACAGCCTCCCTGAGGGCCATCACAGAGTTACAG
AGCCCTGCCCTCAGGGACAGGCATTGGCACCAGCTGATGAAAGCTATTGGGGTCAAGTTTTTAATAAATGAAGCCACAACTTTGGCAGAT
TTGTTAGCACTGCGGTTACACAGAGTGGAAGATGATGTCCGAAGGATTGTGGACAAGGCGGTGAAAGAGCTGGGGACTGAGAAGGTTATT
ACTGAAATCAGTCAGACCTGGGCAACCATGAAGTTTTCTTACGAAGTTCACTATCGAACAGGCATTCCATTACTAAAGTCTGATGAACAA
CTTTTTGAAACTCTAGAGCACAACCAAGTTCAGTTGCAGACTCTTCTTCAAAGCAAGTATGTAGAATATTTCATTGAGCAAGTGTTAAGC
TGGCAAAATAAATTAAACATAGCAGACTTGGTCATCTTCACTTGGATGGAAGTCCAGCGAACTTGGTCTCACCTGGAAAGCATTTTTGTC
TGTTCAGAAGATATTCGAATCCAGCTTGTGAAAGATGCTAGAAGATTTGATGGGGTGGATGCTGAATTTAAGGAGTTAATGTTCAAGACA
GCCAAAGTAGAAAATGTGTTAGAAGCAACGTGCAGACCTAATCTCTATGAAAAACTTAAAGATTTACAGTCCAGGCTTTCTCTTTGTGAA
AAAGCTCTCGCTGAATACCTGGAAACCAAGCGCATAGCCTTTCCTCGCTTCTATTTCGTCTCTTCTGCTGATTTACTTGACATTCTCTCA
AAAGGAGCTCAGCCTAAACAGGTAACATGTCACCTTGCCAAACTTTTCGACAGCATTGCAGATCTGCAGTTTGAAGACAATCAGGATGTT
TCTGCACACAGGGCAGTTGGAATGTACAGCAAAGAAAAGGAGTATGTCCCATTCCAAGCCGAGTGTGAATGTGTGGGCCATGTGGAAACA
TGGCTTCTGCAACTTGAACAGACTATGCAAGAAACGGTGCGTCATTCTATAACAGAAGCCATAGTGGCCTACGAGGAAAAACCTAGGGAA
CTGTGGATTTTTGATTTCCCAGCTCAGGTTGCACTAACCAGCTCACAAATATGGTGGACCACAGATGTAGGAATAGCCTTCAGTAGACTG
GAAGAAGGCTACGAAACAGCCCTGAAGGATTTCCATAAAAAACAGATTTCTCAGCTGAATACACTGATTACACTTTTGCTGGGAGAACTT
CCACCTGGAGACAGACAGAAGATCATGACAATTTGTACCATAGATGTCCATGCCAGAGACGTGGTGGCAAAACTTATTTCTCAGAAGCAA
GTTGTTGTCAGTCCCCAAGCTTTTACATGGCTGTCTCAACTTCGTCACCGATGGGAGGATACCCAGAAACACTGCTTTGTTAATATTTGT
GATGCCCAGTTCCAGTACTTCTATGAATACTTAGGAAACAGCCCTCGACTAGTGATCACTCCTCTAACTGACAGGTGTTATATTACCTTA
ACTCAATCACTTCATCTAACCATGAGTGGGGCTCCTGCTGGCCCAGCTGGTACCGGGAAAACAGAGACCACCAAAGACCTAGGACGTGCC
CTTGGCATGATGGTCTATGTATTCAACTGTTCAGAGCAAATGGACTACAAATCCATAGGCAATATCTATAAGGGATTGGTGCAGACAGGA
GCTTGGGGCTGCTTTGATGAGTTCAACCGAATCTCTGTGGAAGTTCTGTCAGTGGTGGCAGTACAAGTGAAAATGATTCATGATGCCATC
AGAAACAGGAAGAAGAGATTTGTATTTCTTGGGGAAGCTATCACACTGAAGCCATCAGTTGGAATATTTATTACTATGAACCCGGGTTAT
GCTGGTCGAACCGAATTACCGGAAAATCTCAAAGCTCTTTTCAGACCCTGTGCCATGGTGGCCCCTGACATTGAGCTAATCTGTGAAATC
TTGTTAGTTGCTGAAGGTTTTGTGGATGCGCGTGCATTAGCCCGAAAGTTCATTACGTTGTACACGCTTTGCAAGGAGCTTCTCTCCAAG
CAGGATCATTACGACTGGGGACTTCGTGCTATTAAGTCTGTCTTGGTTGTGGCTGGATCTCTGAAACGAGGAGATAAAAATAGACCCGAA
GATCAGGTACTCATGAGAGCATTAAGGGATTTCAATATGCCCAAAATAGTGACTGACGACATCCCAGTGTTTCTGGGCCTGGTCGGTGAC
CTGTTTCCAGCCCTGGATGTGCCCCGGAGGAGGAAGCTGCACTTTGAACAGATGGTCAGGCAGTCTACCCTGGAGCTCCGCCTGCAGCCT
GAAGAGAGCTTCATCCTCAAAGTTGTCCAGCTTGAGGAACTGTTGGCTGTGCGGCACTCGGTCTTTGTAGTTGGAAATGCAGGCACAGGA
AAGAGTAAGATTTTGAGAACACTGAACCGAACATATGTTAACATGAAACAGAAGCCGGTTTGGAATGACTTAAACCCTAAAGCTGTGACA
ACAGATGAACTCTTTGGTTTCATACATCATGCTACCCGAGAATGGAAAGATGGCAAGATTGTTTACTCTTATTTTATAGGTCTCTTCTCA
TCCATTCTACGAGAACAAGCAAATCTTAAGCATGATGGACCAAAATGGATAGTCCTGGATGGCGATATTGACCCCATGTGGATTGAATCA
CTGAATACTGTAATGGATGATAACAAGGTGCTGACCCTCGCCAGCAATGAGCGCATTGCACTCACTCCCTTCATGAGGCTTCTGTTTGAG
ATACATCACTTAAGGAGCGCAACCCCGGCCACTGTTTCCAGAGCTGGTATTCTGTATGTGAACCCACAAGATCTGGGCTGGAATCCGTAT
GTGGCCAGTTGGATAGACAGAAGGCGGCATCAATCAGAAAAGGCCAATTTGACTATTCTTTTTGATAAATATGTCCCTGCATGCTTGGAT
AAACTGAGAACAAGCTTTAAAACCATCACTTCAATTCCTGAGAGTAGCCTGGTGCAGACTCTATGTGTTCTTTTGGAGTGCTTGCTGACT
CCTGAAAATGTACCTTCTGACAGCCCAAAAGAAGTTTATGAAGTCTATTTTGTATTTGCTTGTATCTGGGCTTTTGGAGGCACCCTGCTA
CAAGATCAGATTTCTGATTATCAAGCTGACTTCAGTCGGTGGTGGCAGAAAGAGATGAAAGCAGTGAAATTTCCGTCGCAGGGAACAATC
TTTGATTATTATGTGGACCACAAAACTAAGAAATTATTGCCCTGGGCTGACAAAATTGCCCAGTTTACTATGGATCCAGATGTGCCTCTG
CAGACAGTTCTCGTTCACACAACAGAGACAGCTCGTCTTAGATATTTCATGGAGTTGTTGCTTGAGAAAGGAAAACCTCTAATGCTAGTA
GGAAATGCAGGAGTGGGAAAAACAGTCTTTGTAGGTGACACATTGGCAAGTCTCTCTGAGGATTACATAGTATCCCGTGTGCCTTTCAAC
TACTACACGACATCCACAGCTCTGCAAAAAATTCTTGAGAAACCCCTAGAGAAAAAAGCTGGTCATAACTATGGTCCTGGAGGAAATAAA
AAATTGATTTATTTTATCGACGACATGAACATGCCTGAAGTGGACTTATATGGCACCGTTCAGCCTCACACCCTGATCCGGCAGCATATT
GATTATGGACATTGGTATGATAGACAGAAGGTGATGCTTAAAGAAATCCATAACTGCCAGTATGTCGCCTGCATGAATCCGATGGTGGGC
AGCTTCACCATCAATCCCAGGCTACAGAGACATTTCACAGTGTTTGCATTCAATTTTCCATCTTTGGATGCACTAAACACCATCTATGGC
CAAATCTTTAGCTTCCATTTCCAACAGCAAGCATTTGCTCCATCAATTCTCAGGAGTGGCCCCACTTTGATCCAGGCAACAATAGCATTC
CATCAGACAATGATGTGTAACTTTTTACCCACGGCTATTAAATTCCACTACATCTTTAATCTGAGAGATTTATCAAACGTCTTCCAGGGG
ATTTTATTTGCTTCTCCTGAGTGTTTAAAAGGTCCACTTGATTTAATACATCTGTGGCTTCATGAATCTGCCCGTGTTTATGGAGACAAA
CTGATAGACAAAAAAGATTGTGATTTGTTTCAGAGAAGAATGCTGGAAACTGCTTATAAATATTTTGAAGGTATAGATAGTCACATGCTG
CTTCAACAGCCCCTCATTTATTGCCACTTTGCTGATAGAGGGAAGGACCCACATTACATGCCAGTGAAGGACTGGGAAGTGCTGAAGACG
ATTCTTACAGAAACGTTAGACAACTACAATGAACTAAATGCTGCCATGCACCTAGTTTTGTTTGAAGATGCCATGCAACATGTGTGTCGC
ATCAGCCGGATCTTACGAACCCCTCAGGGCTGTGCTCTCTTGGTTGGAGTTGGGGGCAGTGGCAAGCAGAGCTTGTCCAGGCTGGCAGCT
TACCTTCGTGGCCTTGAGGTCTTTCAGATCACTCTGACCGAGGGCTATGGAATCCAGGAACTTCGGGTAGATCTTGCCAATTTGTACATC
CGAACTGGAGCCAAGAACATGCCCACTGTGTTCCTGCTGACAGATGCCCAGGTTCTAGATGAGAGCTTCCTCGTGCTGATTAATGACTTG
CTGGCATCAGGAGAAATCCCAGATCTGTTCAGCGATGAAGATGTGGACAAGATAATTTCTGGAATTCATAATGAAGTTCATGCTCTGGGC
ATGGTAGACTCCAGGGAAAACTGTTGGAAATTCTTTATGGCCAGGGTGCGACTACAGCTCAAAATCATTTTGTGTTTCTCTCCAGTTGGT
CGCACGCTGAGAGTTAGAGCTCGGAAGTTCCCAGCCATAGTTAACTGCACGGCTATTGACTGGTTTCATGCGTGGCCGCAGGAGGCTCTG
GTCTCCGTCAGCAGGAGGTTCATTGAGGAAACCAAGGGAATTGAGCCAGTGCACAAAGACTCTATTAGCCTTTTCATGGCACATGTTCAC
ACCACTGTAAATGAAATGAGTACCAGATATTACCAGAATGAGAGAAGACACAACTATACCACCCCAAAGAGTTTTCTAGAACAAATATCA
CTGTTTAAGAACCTGTTGAAGAAGAAGCAAAATGAGGTATCCGAGAAAAAAGAACGCCTGGTGAACGGCATCCAAAAGCTAAAAACCACA
GCCTCTCAGGTGGGAGATCTAAAAGCCAGACTTGCCTCTCAAGAAGCCGAGCTGCAACTGAGAAATCATGATGCCGAAGCTCTGATCACA
AAGATCGGCCTTCAGACGGAGAAAGTGAGCCGGGAAAAGACCATCGCTGATGCTGAGGAGCGAAAGGTGACAGCCATTCAGACTGAAGTG
TTCCAGAAACAGAGAGAATGTGAAGCTGACTTACTCAAGGCTGAGCCTGCACTGGTGGCTGCTACAGCTGCACTCAATACACTCAACAGG
GTCAACCTCAGTGAGCTGAAAGCCTTTCCCAACCCTCCCATCGCAGTTACCAATGTTACTGCAGCCGTGATGGTCCTTCTGGCTCCTCGG
GGAAGAGTGCCCAAAGACCGAAGTTGGAAAGCAGCTAAAGTCTTCATGGGAAAGGTTGATGATTTTTTGCAAGCATTAATTAACTATGAC
AAAGAGCACATTCCAGAGAACTGTCTAAAAGTGGTGAATGAACACTATTTGAAAGACCCAGAGTTTAATCCAAACCTGATTCGAACCAAA
TCTTTTGCAGCAGCTGGCCTGTGTGCCTGGGTCATCAACATCATTAAATTCTATGAGGTCTACTGTGATGTGGAGCCAAAACGCCAAGCA
TTAGCCCAAGCAAACTTAGAACTGGCTGCAGCTACTGAAAAACTAGAGGCTATCAGGAAAAAGCTTGTGGATCTGGATCGAAATCTGAGC
AGACTCACGGCTTCATTTGAAAAAGCAACAGCTGAGAAAGTCCGGTGTCAAGAAGAGGTGAACCAAACCAACAAAACCATCAAATTAGCT
AACAGACTTGTCAAGGAACTTGAGGCAAAGAAGATTCGCTGGGGTCAATCCATTAAGTCCTTTGAAGCTCAAGAGAAGACACTCTGTGGA
GATGTTCTTCTCACGGCGGCATTTGTGTCTTACGTCGGACCCTTCACAAGGCAGTATCGCCAGGAGCTGGTGCACTGCAAGTGGGTTCCC
TTTCTTCAACAGAAGGTTTCCATTCCACTAACCGAAGGCCTGGACTTGATATCCATGTTGACGGATGATGCTACAATTGCCGCCTGGAAT
AACGAAGGACTGCCCAGTGACAGAATGTCCACCGAAAATGCCGCTATCCTAACACACTGTGAGCGCTGGCCTCTGGTGATAGATCCCCAG
CAACAGGGAATTAAGTGGATCAAGAATAAGTATGGAATGGACCTGAAAGTCACACATTTGGGCCAGAAAGGGTTTTTGAATGCCATTGAA
ACTGCTTTGGCCTTTGGTGATGTCATCTTAATTGAAAATCTCGAGGAAACGATAGATCCAGTCCTGGATCCACTACTTGGCAGGAACACA
ATTAAAAAAGGAAAGTATATCAGGATTGGAGATAAAGAATGTGAATTTAACAAGAACTTTCGCCTTATCCTTCACACAAAATTGGCAAAT
CCTCACTATAAGCCGGAATTACAAGCTCAGACAACTCTCCTCAATTTCACAGTCACAGAAGATGGTCTAGAAGCCCAGCTGCTGGCAGAG
GTTGTCAGTATTGAAAGGCCAGATTTGGAGAAACTTAAGTTGGTATTGACAAAGCACCAAAATGATTTTAAAATTGAGCTCAAGTATCTG
GAAGACGATCTCCTTTTGCGCCTTTCTGCGGCAGAGGGAAGCTTTCTGGATGACACCAAACTGGTAGAGAGATTGGAGGCAACAAAGACC
ACCGTGGCAGAGATAGAGCACAAGGTGATTGAAGCCAAAGAAAATGAAAGAAAAATCAACGAGGCCCGAGAATGTTACAGACCAGTGGCA
GCAAGAGCATCTCTTCTTTATTTTGTTATTAATGACCTCCAAAAAATCAACCCCCTCTACCAATTCTCTTTGAAGGCTTTTAACGTGCTG
TTCCACAGAGCGATCGAGCAGGCTGACAAGGTGGAAGACATGCAGGGACGCATCTCTATCCTGATGGAGAGCATCACCCATGCTGTCTTC
CTCTACACCAGCCAGGCGCTGTTTGAGAAGGACAAGCTCACCTTCCTGTCCCAGATGGCTTTTCAGATTTTGTTGAGAAAGAAAGAGATA
GACCCTCTTGAATTGGATTTCCTGCTTCGATTCACAGTTGAACACACTCATCTGAGTCCCGTTGACTTCCTAACTTCTCAGTCATGGAGT
GCTATCAAGGCAATTGCCGTCATGGAAGAATTTCGAGGCATAGACCGAGATGTGGAAGGATCTGCCAAGCAGTGGAGGAAGTGGGTAGAA
TCCGAGTGTCCAGAAAAAGAAAAATTACCTCAAGAATGGAAGAAGAAAAGTTTAATACAGAAGCTGATTCTTCTGAGAGCAATGCGCCCT
GACAGAATGACGTATGCTCTCAGAAATTTTGTAGAGGAAAAACTGGGTGCGAAGTATGTGGAGAGGACCAGATTGGACTTAGTTAAAGCA
TTCGAAGAAAGCAGCCCAGCCACCCCCATATTCTTCATCCTGTCTCCGGGGGTAGATGCCCTTAAAGACCTGGAGATTCTTGGCAAAAGA
CTTGGCTTTACAATTGACTCTGGAAAATTCCACAATGTGTCTTTAGGACAAGGTCAGGAGACGGTGGCAGAAGTGGCCCTGGAGAAAGCT
TCCAAAGGAGGACACTGGGTCATCCTCCAAAATGTTCATTTGGTAGCCAAGTGGCTAGGAACCTTGGAGAAGCTCCTTGAAAGATTCAGC
CAAGGAAGCCACAGAGATTACAGGGTTTTCATGAGTGCTGAGTCTGCACCTACACCAGATGAGCATATCATCCCTCAAGGACTCCTGGAA
AATTCCATTAAGATCACTAATGAACCCCCAACAGGGATGCTGGCCAATTTGCATGCCGCCCTGTACAACTTTGATCAGGATACACTTGAA
ATATGCTCCAAGGAGCAGGAGTTTAAAAGCATCCTTTTTTCTCTCTGCTACTTCCACGCCTGTGTTGCTGGGAGACTGAGGTTTGGCCCC
CAGGGCTGGAGCCGAAGCTATCCTTTTAATCCTGGAGACCTCACCATTTGTGCCAGTGTCCTCTACAACTACTTAGAGGCAAACTCTAAA
GTCCCATGGGAAGATCTCCGTTATCTCTTTGGTGAGATCATGTATGGAGGCCACATCACAGATGACTGGGATCGCAAACTGTGTCGGGTG
TATTTAGAAGAATTCATGAATCCATCTCTGACTGAAGATGAACTGATGCTGGCACCAGGTTTTGCTGCCCCACCCTACCTAGATTATGCA
GGCTACCACCAGTACATAGAGGAGATGCTTCCTCCAGAAAGCCCGGCACTGTATGGCCTCCACCCAAATGCTGAAATAGAATTCCTGACA
GTGACATCCAACACTCTCTTCAGAACTTTGCTGGAGATGCAGCCCAGGAATGCACTCAGTGGTGATGAACTGGGGCAGTCTACAGAAGAA
AAGGTTAAGAATGTCTTGGATGACATTTTGGAGAAACTTCCAGAAGAGTTCAACATGGCAGAGATAATGCAAAAAAATTCAAATAGAAGC
CCATATGTTCTTGTTTGCTTCCAAGAATGTGAGAGGATGAATATTCTCATTCGGGAAATACGTATATCACTTGAACAACTGGACCTTAGT
TTGAAGGGGGAATTGGCATTATCTCCTGCTGTGGAAGCCCAGCAGTTTGCATTGAGTTATGACACGGTACCAGACACTTGGAGCAAACTG
GCTTATCCTTCTACTTATGGCCTAGCCCAGTGGTTCAATGACCTCCTCCTGCGATGCCGAGAACTCGATACTTGGACACAAGACCTTACC
CTTCCGGCTGTCGTGTGGCTCTCCGGCTTCTTCAACCCTCAGTCCTTCTTAACTGCAATCATGCAGACGATGGCTCGAAAAAATGAGTGG
CCCCTGGATAAAACGCGCTTGACTGCTGATGTTACCAAAAAAACAAAGGAAGATTATGGACACCCGCCAAGGGAAGGTGCATACCTCCAC
GGACTCTTCATGGAGGGCGCCCGCTGGGACACCCAAGCAGGAACCATTGTTGAAGCCCGTCTCAAGGAGCTGGCATGCCCTATGCCGGTC
ATCTTTGCAAAAGCCACCCCCGTGGACAGACAAGAAACCAAACAGACCTACGAGTGCCCTGTGTATAGAACCAAACTGAGAGGCCCCAGC
TACATCTGGACCTTCAGGCTGAAGAGCGAAGAGAAGACTGCAAAATGGGTTCTGGCTGGAGTGGCTCTGCTTCTAGAAGCGTAAGGTAAC
ACTGGCATTCCTCTAGCCTCTGCTGGAGTGCAGTGAGGATTTTCTAGCATGTTGCTGCACTGTTCCCATGCACATTATTCTAACTTTTTA
GTAACTCACACGTGCATTCTTTTTTCAACGCTATCCTTAGAGTGAAAGTCAGAAAAAAATACTAGAAACTAACTCAGGGCTGAGCGTGGT
GGCACACGACTGTAATCCCAGTTACTCAGGAGGTAGGAGAATCACTTGAACCTAGGAGGCAAAGGTTGCAGTGAGCCGAGGTTGCACCAC
TGCACTCCCTCCTGGGCAACAGAACAAGACTCCATCTCAAAAAAAAAAAAGTACATCATAAAAGTACATCATATGTGAACATGCAAAAGC
AATGCAGCCGGAAAGAACGGAGATTTTAATTTTTAACAAACAACAAATTAAATTATTAGCCCTTAAACTCTTTCAAAATATAAAAGCAGC
AGGCCCCAGGTGAGTCCTGAAGGAAGAGGCTAGCACTCTGTAAGGCCTCCAGTGTCCAGTGTCTACAATGTTGATGGTCCCCTTTTGTTC

>In-frame_KLHL7_ENST00000322275_chr7_23145765_+_DNAH11_ENST00000409508_chr7_21584624_+_14147nt
GGGTTCTGCCCGGGGACGCAGCCCAGTTGGTAGCGTCGCTCCCTGAGCGTTTCTAAGGGGGCCGCCCGGCCTTGTCTTTCGGCAGTGGCC
GAGCCACCGCCGCCTGCCGCGCGTTCCAGAGCTGGGCGCTGCAGCTGCACTGCCGATCGCCGTGTTTGGTCGATAGAATCCCCAGTGTGC
CCAGAGAGTGCGACCCCTCGCCCGGCCCGGCGAGCCCCGGGCGTGAACCGAGCTGAGGGAGGATGGCAGCCTCTGGGGTGGAGAAGAGCA
GCAAGAAGAAGACCGAGAAGAAACTTGCTGCTCGGGAAGAAGCTAAATTGTTGGCGGGTTTCATGGGCGTCATGAATAACATGCGGAAAC
AGATTCCAAGAGATGCAAACCATAAACTTGTTTTTATTTCCAAGAAGATTACTGAAAGCATTGGAGTAAATGACTTTTCTCAAGTGGTTT
TATTTGGAGAGTTACCTGCGTTGTCTCTTGGACATGTATCTGCTTTCCTTGATGAGATTTTAGTGCCAGTTCTTTCTAATAAGAACAACC
ATAAGTCCTGGTCCTGTTTTACTTCACAAGATATGGAATATCACATAGAAGTCATGAAAAAGAAGATGTATATTTTTAGGGGCAAAATGT
CTAGAAGAACTCTTCTACCAATTCCCACTGTTGCAGGAAAGATGGATCTGGATCAGAATTGTTCAGAGAACAAGCCACCGTCAAACGAAA
GGATAATACTTCATGCAATTGAATCTGTGGTTATTGAATGGTCACATCAAATCCAAGAAATTATAGAAAGAGATTCAGTGCAGCGTTTGT
TGAATGGTCTTCACTTGTCTCCTCAAGCAGAACTAGATTTCTGGATGATGAGGAGAGAAAATCTGTCATGCATTTATGATCAACTTCAGG
CACCTGTTGTCCTCAAAATGGTTAAGATCCTGACAACTAAACAAAGCAGCTATTTTCCTACTCTGAAGGACATTTTTCTGGCTGTGGAAA
ATGCTCTTCTCGAAGCCCAAGATGTGGAACTTTACCTGAGACCTCTGAGGAGACACATCCAGTGTCTCCAGGAGACGGAATTCCCACAGA
CACGCATATTAATCGCTCCATTATTTCATACCATCTGTCTGATCTGGAGTCATTCCAAGTTTTATAACACCCCAGCTCGGGTTATAGTTT
TATTGCAAGAGTTTTGTAATCTCTTCATTAACCAGGCAACAGCTTACCTTTCACCTGAGGACCTTTTGAGGGGAGAAATAGAAGAGTCAC
TGGAAAAGGTGCAGGTGGCTGTTAACATCTTAAAGACTTTCAAAAACTCCTTTTTCAACTATAGAAAAAAATTGGCAAGCTACTTTATGG
GAAGAAAGCTGAGACCATGGGATTTCCAGTCTCATCTGGTGTTTTGCAGATTTGACAAGTTTCTTGATCGTTTAATAAAAATAGAGGATA
TATTTGCCACCACTTTGGAATTTGAAAAGCTGGAAAGACTGGAATTTGGTGGTACCAAAGGAGCAATTTTAAATGGACAAGTCCACGAGA
TGAGTGAAGAACTTATGGAACTCTGTAAACTTTTTAAACAGAGCACTTATGACCCATCTGATTGCACTAACATGGAGTTTGAAAGTGATT
ATGTGGCATTTAAGTCCAAAACTCTGGAATTTGACAGAAGGCTTGGGACAATTATTTGTGAAGCTTTCTTTAACTGCAATGGCTTAGAAG
CTGCATTTAAGCTTTTGACCATATTTGGAAATTTTCTAGAGAAGCCAGTTGTCATGGAAATTTTCAGCCTACATTACAGCACACTAGTGC
ATATGTTTAATACAGAGCTGGATGTGTGTAAGCAACTGTATAATGAACACATGAAACAGATTGAATGTGGTCATGTAGTTCTTAACAAGA
ACATGCCATTTACCTCAGGAAATATGAAATGGGCCCAGCAGGTTCTCCAACGACTTCAAATGTTTTGGTCAAACTTCGCATCTCTCCGTT
ATCTATTTTTGGGCAATCCTGATCACGCTTTAGTTTATCAAAAGTATGTTGAAATGACCACTTTGCTTGATCAATTTGAAAGTCGTATCT
ATAATGAATGGAAAAGTAATGTGGATGAAATCTGTGAATTCAATTTGAATCAACCCTTGGTTAAATTCAGTGCCATAAATGGTCTTCTCT
GTGTCAATTTTGACCCAAAGCTAGTGGCTGTATTGAGAGAAGTGAAATATCTTTTGATGTTGAAGAAACAAGACATACCAGATTCAGCTT
TAGCCATCTTCAAGAAAAGGAACACTATTTTAAAGTACATTGGAAATCTTGACCTTCTTGTGCAAGGGTATAATAAACTCAAACAGACGC
TCCTGGAAGTTGAATACCCTCTGATTGAAGATGAGCTGAGGGCTATTGACGAGCAGCTGACAGCAGCCACAACGTGGCTGACATGGCAGG
ATGACTGCTGGGGCTACATCGAGAGGGTGAGGGCAGCCACGTCCGAGTTGGAGCACAGAGTTGAGCGCACACAGAAAAACGTGAAGGTGA
TCCAGCAGACCATGAGGGGCTGGGCCAGGTGCGTGCTACCTCCCAGGAGAGAGCACAGACGAGAGGCAGCCTTCACCTTGGAGGACAAGG
GTGATTTGTTTACAAAAAAATACAAGTTAATCCAAGGAGATGGCTGCAAGATCCACAACTTGGTCGAGGAAAATAGGAAGCTCTTCAAAG
CCAATCCCTCTCTGGATACCTGGAAAATTTATGTAGAATTCATTGACGACATTGTGGTGGAAGGCTTTTTTCAGGCTATAATGCACGACT
TAGACTTCTTTCTGAAGAATACAGAGAAACAATTGAAACCGGCACCGTTTTTTCAAGCACAAATGATCTTGTTGCCTCCTGAGATTGTGT
TTAAACCTTCCCTAGACAGAGAGGCTGGGGATGGCTTCTATGATCTTGTAGAAGAAATGTTATGCAATAGTTTTAGAATGTCTGCCCAGA
TGAACCGAATAGCAACACACCTGGAAATTAAAAATTATCAGAATGATATGGATAACATGTTAGGCCTGGCAGAGGTCAGGCAGGAGATCA
TGAACAGAGTGGTGAATGTCATCAACAAAGTCTTAGATTTCAGAAACACCCTGGAGACCCACACTTACCTCTGGGTGGATGATCGAGCTG
AGTTTATGAAGCATTTTCTCTTGTATGGCCATGCTGTGTCTTCCGATGAAATGGATGCTCATGCAAATGAAGAAATTCCCGAACAACCAC
CAACTCTTGAGCAATTCAAAGAACAGATTGACATTTATGAAGCTTTGTATGTTCAAATGAGCAAATTTGAGGACTTTAGAGTGTTTGATA
GTTGGTTCAAGGTGGACATGAAGCCTTTCAAAGTGAGCTTGTTAACCATAATTAAGAAATGGAGCTGGATGTTTCAGGAGCATCTTTTGA
GATTTGTCATTGACAGTCTGAATGAGCTACAAGAATTTATAAAGGAGACAGATTCCGGACTTCAGAGAGAATTAAATGAAGGTGATCATG
ATGGTTTAGTTGACATCATGGTGCATCTTCTGGCTGTAAGAAGCCGACAGAGAGCTACTGATGAACTCTTTGAACCTCTAAAAGAAACGA
TCACCCTCTTGGAAAGCTATGGCCAGAAGATGCCTGAGCAGGTCTATATTCAGCTAGAGGAATTACCTGAAAGATGGGAAACTACCAAAA
AGATCGCAGCAACTGTCAGACATGAAGTCTCACCTCTCCATAATGCGGAAGTCACTCTTATAAGGAAAAAATGTATTTTGTTTGACGCAA
AGCAGGCAGAGTTCAGAGAGAGATTCAGACACTATGCCCCTCTTGGATTTAATGCAGAAAATCCATACACAGCGCTTGATAAGGCAAATG
AAGAGCTTGAGGCCTTAGAAGAAGAAATGTTGCAGATGCAAGAATCTACTCGTCTTTTTGAAGTGGCTCTTCCAGAGTACAAACAAATGA
AACAGTGTCGCAAAGAAATAAAATTGCTCAAGGGACTGTGGGATGTCATTATTTATGTTCGAAGAAGCATTGATAATTGGACTAAAACCC
AGTGGAGACAGATTCATGTGGAACAGATGGATGTAGAACTCAGAAGGTTTGCCAAGGAAATTTGGTCACTCAACAAGGAAGTCCGCGTCT
GGGATGCTTACACGGGCCTGGAAGGCACAGTTAAGGACATGACAGCCTCCCTGAGGGCCATCACAGAGTTACAGAGCCCTGCCCTCAGGG
ACAGGCATTGGCACCAGCTGATGAAAGCTATTGGGGTCAAGTTTTTAATAAATGAAGCCACAACTTTGGCAGATTTGTTAGCACTGCGGT
TACACAGAGTGGAAGATGATGTCCGAAGGATTGTGGACAAGGCGGTGAAAGAGCTGGGGACTGAGAAGGTTATTACTGAAATCAGTCAGA
CCTGGGCAACCATGAAGTTTTCTTACGAAGTTCACTATCGAACAGGCATTCCATTACTAAAGTCTGATGAACAACTTTTTGAAACTCTAG
AGCACAACCAAGTTCAGTTGCAGACTCTTCTTCAAAGCAAGTATGTAGAATATTTCATTGAGCAAGTGTTAAGCTGGCAAAATAAATTAA
ACATAGCAGACTTGGTCATCTTCACTTGGATGGAAGTCCAGCGAACTTGGTCTCACCTGGAAAGCATTTTTGTCTGTTCAGAAGATATTC
GAATCCAGCTTGTGAAAGATGCTAGAAGATTTGATGGGGTGGATGCTGAATTTAAGGAGTTAATGTTCAAGACAGCCAAAGTAGAAAATG
TGTTAGAAGCAACGTGCAGACCTAATCTCTATGAAAAACTTAAAGATTTACAGTCCAGGCTTTCTCTTTGTGAAAAAGCTCTCGCTGAAT
ACCTGGAAACCAAGCGCATAGCCTTTCCTCGCTTCTATTTCGTCTCTTCTGCTGATTTACTTGACATTCTCTCAAAAGGAGCTCAGCCTA
AACAGGTAACATGTCACCTTGCCAAACTTTTCGACAGCATTGCAGATCTGCAGTTTGAAGACAATCAGGATGTTTCTGCACACAGGGCAG
TTGGAATGTACAGCAAAGAAAAGGAGTATGTCCCATTCCAAGCCGAGTGTGAATGTGTGGGCCATGTGGAAACATGGCTTCTGCAACTTG
AACAGACTATGCAAGAAACGGTGCGTCATTCTATAACAGAAGCCATAGTGGCCTACGAGGAAAAACCTAGGGAACTGTGGATTTTTGATT
TCCCAGCTCAGGTTGCACTAACCAGCTCACAAATATGGTGGACCACAGATGTAGGAATAGCCTTCAGTAGACTGGAAGAAGGCTACGAAA
CAGCCCTGAAGGATTTCCATAAAAAACAGATTTCTCAGCTGAATACACTGATTACACTTTTGCTGGGAGAACTTCCACCTGGAGACAGAC
AGAAGATCATGACAATTTGTACCATAGATGTCCATGCCAGAGACGTGGTGGCAAAACTTATTTCTCAGAAGGTTGTCAGTCCCCAAGCTT
TTACATGGCTGTCTCAACTTCGTCACCGATGGGAGGATACCCAGAAACACTGCTTTGTTAATATTTGTGATGCCCAGTTCCAGTACTTCT
ATGAATACTTAGGAAACAGCCCTCGACTAGTGATCACTCCTCTAACTGACAGGTGTTATATTACCTTAACTCAATCACTTCATCTAACCA
TGAGTGGGGCTCCTGCTGGCCCAGCTGGTACCGGGAAAACAGAGACCACCAAAGACCTAGGACGTGCCCTTGGCATGATGGTCTATGTAT
TCAACTGTTCAGAGCAAATGGACTACAAATCCATAGGCAATATCTATAAGGGATTGGTGCAGACAGGAGCTTGGGGCTGCTTTGATGAGT
TCAACCGAATCTCTGTGGAAGTTCTGTCAGTGGTGGCAGTACAAGTGAAAATGATTCATGATGCCATCAGAAACAGGAAGAAGAGATTTG
TATTTCTTGGGGAAGCTATCACACTGAAGCCATCAGTTGGAATATTTATTACTATGAACCCGGGTTATGCTGGTCGAACCGAATTACCGG
AAAATCTCAAAGCTCTTTTCAGACCCTGTGCCATGGTGGCCCCTGACATTGAGCTAATCTGTGAAATCTTGTTAGTTGCTGAAGGTTTTG
TGGATGCGCGTGCATTAGCCCGAAAGTTCATTACGTTGTACACGCTTTGCAAGGAGCTTCTCTCCAAGCAGGATCATTACGACTGGGGAC
TTCGTGCTATTAAGTCTGTCTTGGTTGTGGCTGGATCTCTGAAACGAGGAGATAAAAATAGACCCGAAGATCAGGTACTCATGAGAGCAT
TAAGGGATTTCAATATGCCCAAAATAGTGACTGACGACATCCCAGTGTTTCTGGGCCTGGTCGGTGACCTGTTTCCAGCCCTGGATGTGC
CCCGGAGGAGGAAGCTGCACTTTGAACAGATGGTCAGGCAGTCTACCCTGGAGCTCCGCCTGCAGCCTGAAGAGAGCTTCATCCTCAAAG
TTGTCCAGCTTGAGGAACTGTTGGCTGTGCGGCACTCGGTCTTTGTAGTTGGAAATGCAGGCACAGGAAAGAGTAAGATTTTGAGAACAC
TGAACCGAACATATGTTAACATGAAACAGAAGCCGGTTTGGAATGACTTAAACCCTAAAGCTGTGACAACAGATGAACTCTTTGGTTTCA
TACATCATGCTACCCGAGAATGGAAAGATGGCAAGATTGTTTACTCTTATTTTATAGGTCTCTTCTCATCCATTCTACGAGAACAAGCAA
ATCTTAAGCATGATGGACCAAAATGGATAGTCCTGGATGGCGATATTGACCCCATGTGGATTGAATCACTGAATACTGTAATGGATGATA
ACAAGGTGCTGACCCTCGCCAGCAATGAGCGCATTGCACTCACTCCCTTCATGAGGCTTCTGTTTGAGATACATCACTTAAGGAGCGCAA
CCCCGGCCACTGTTTCCAGAGCTGGTATTCTGTATGTGAACCCACAAGATCTGGGCTGGAATCCGTATGTGGCCAGTTGGATAGACAGAA
GGCGGCATCAATCAGAAAAGGCCAATTTGACTATTCTTTTTGATAAATATGTCCCTGCATGCTTGGATAAACTGAGAACAAGCTTTAAAA
CCATCACTTCAATTCCTGAGAGTAGCCTGGTGCAGACTCTATGTGTTCTTTTGGAGTGCTTGCTGACTCCTGAAAATGTACCTTCTGACA
GCCCAAAAGAAGTTTATGAAGTCTATTTTGTATTTGCTTGTATCTGGGCTTTTGGAGGCACCCTGCTACAAGATCAGATTTCTGATTATC
AAGCTGACTTCAGTCGGTGGTGGCAGAAAGAGATGAAAGCAGTGAAATTTCCGTCGCAGGGAACAATCTTTGATTATTATGTGGACCACA
AAACTAAGAAATTATTGCCCTGGGCTGACAAAATTGCCCAGTTTACTATGGATCCAGATGTGCCTCTGCAGACAGTTCTCGTTCACACAA
CAGAGACAGCTCGTCTTAGATATTTCATGGAGTTGTTGCTTGAGAAAGGAAAACCTCTAATGCTAGTAGGAAATGCAGGAGTGGGAAAAA
CAGTCTTTGTAGGTGACACATTGGCAAGTCTCTCTGAGGATTACATAGTATCCCGTGTGCCTTTCAACTACTACACGACATCCACAGCTC
TGCAAAAAATTCTTGAGAAACCCCTAGAGAAAAAAGCTGGTCATAACTATGGTCCTGGAGGAAATAAAAAATTGATTTATTTTATCGACG
ACATGAACATGCCTGAAGTGGACTTATATGGCACCGTTCAGCCTCACACCCTGATCCGGCAGCATATTGATTATGGACATTGGTATGATA
GACAGAAGGTGATGCTTAAAGAAATCCATAACTGCCAGTATGTCGCCTGCATGAATCCGATGGTGGGCAGCTTCACCATCAATCCCAGGC
TACAGAGACATTTCACAGTGTTTGCATTCAATTTTCCATCTTTGGATGCACTAAACACCATCTATGGCCAAATCTTTAGCTTCCATTTCC
AACAGCAAGCATTTGCTCCATCAATTCTCAGGAGTGGCCCCACTTTGATCCAGGCAACAATAGCATTCCATCAGACAATGATGTGTAACT
TTTTACCCACGGCTATTAAATTCCACTACATCTTTAATCTGAGAGATTTATCAAACGTCTTCCAGGGGATTTTATTTGCTTCTCCTGAGT
GTTTAAAAGGTCCACTTGATTTAATACATCTGTGGCTTCATGAATCTGCCCGTGTTTATGGAGACAAACTGATAGACAAAAAAGATTGTG
ATTTGTTTCAGAGAAGAATGCTGGAAACTGCTTATAAATATTTTGAAGGTATAGATAGTCACATGCTGCTTCAACAGCCCCTCATTTATT
GCCACTTTGCTGATAGAGGGAAGGACCCACATTACATGCCAGTGAAGGACTGGGAAGTGCTGAAGACGATTCTTACAGAAACGTTAGACA
ACTACAATGAACTAAATGCTGCCATGCACCTAGTTTTGTTTGAAGATGCCATGCAACATGTGTGTCGCATCAGCCGGATCTTACGAACCC
CTCAGGGCTGTGCTCTCTTGGTTGGAGTTGGGGGCAGTGGCAAGCAGAGCTTGTCCAGGCTGGCAGCTTACCTTCGTGGCCTTGAGGTCT
TTCAGATCACTCTGACCGAGGGCTATGGAATCCAGGAACTTCGGGTAGATCTTGCCAATTTGTACATCCGAACTGGAGCCAAGAACATGC
CCACTGTGTTCCTGCTGACAGATGCCCAGGTTCTAGATGAGAGCTTCCTCGTGCTGATTAATGACTTGCTGGCATCAGGAGAAATCCCAG
ATCTGTTCAGCGATGAAGATGTGGACAAGATAATTTCTGGAATTCATAATGAAGTTCATGCTCTGGGCATGGTAGACTCCAGGGAAAACT
GTTGGAAATTCTTTATGGCCAGGGTGCGACTACAGCTCAAAATCATTTTGTGTTTCTCTCCAGTTGGTCGCACGCTGAGAGTTAGAGCTC
GGAAGTTCCCAGCCATAGTTAACTGCACGGCTATTGACTGGTTTCATGCGTGGCCGCAGGAGGCTCTGGTCTCCGTCAGCAGGAGGTTCA
TTGAGGAAACCAAGGGAATTGAGCCAGTGCACAAAGACTCTATTAGCCTTTTCATGGCACATGTTCACACCACTGTAAATGAAATGAGTA
CCAGATATTACCAGAATGAGAGAAGACACAACTATACCACCCCAAAGAGTTTTCTAGAACAAATATCACTGTTTAAGAACCTGTTGAAGA
AGAAGCAAAATGAGGTATCCGAGAAAAAAGAACGCCTGGTGAACGGCATCCAAAAGCTAAAAACCACAGCCTCTCAGGTGGGAGATCTAA
AAGCCAGACTTGCCTCTCAAGAAGCCGAGCTGCAACTGAGAAATCATGATGCCGAAGCTCTGATCACAAAGATCGGCCTTCAGACGGAGA
AAGTGAGCCGGGAAAAGACCATCGCTGATGCTGAGGAGCGAAAGGTGACAGCCATTCAGACTGAAGTGTTCCAGAAACAGAGAGAATGTG
AAGCTGACTTACTCAAGGCTGAGCCTGCACTGGTGGCTGCTACAGCTGCACTCAATACACTCAACAGGGTCAACCTCAGTGAGCTGAAAG
CCTTTCCCAACCCTCCCATCGCAGTTACCAATGTTACTGCAGCCGTGATGGTCCTTCTGGCTCCTCGGGGAAGAGTGCCCAAAGACCGAA
GTTGGAAAGCAGCTAAAGTCTTCATGGGAAAGGTTGATGATTTTTTGCAAGCATTAATTAACTATGACAAAGAGCACATTCCAGAGAACT
GTCTAAAAGTGGTGAATGAACACTATTTGAAAGACCCAGAGTTTAATCCAAACCTGATTCGAACCAAATCTTTTGCAGCAGCTGGCCTGT
GTGCCTGGGTCATCAACATCATTAAATTCTATGAGGTCTACTGTGATGTGGAGCCAAAACGCCAAGCATTAGCCCAAGCAAACTTAGAAC
TGGCTGCAGCTACTGAAAAACTAGAGGCTATCAGGAAAAAGCTTGTGGATCTGGATCGAAATCTGAGCAGACTCACGGCTTCATTTGAAA
AAGCAACAGCTGAGAAAGTCCGGTGTCAAGAAGAGGTGAACCAAACCAACAAAACCATCAAATTAGCTAACAGACTTGTCAAGGAACTTG
AGGCAAAGAAGATTCGCTGGGGTCAATCCATTAAGTCCTTTGAAGCTCAAGAGAAGACACTCTGTGGAGATGTTCTTCTCACGGCGGCAT
TTGTGTCTTACGTCGGACCCTTCACAAGGCAGTATCGCCAGGAGCTGGTGCACTGCAAGTGGGTTCCCTTTCTTCAACAGAAGGTTTCCA
TTCCACTAACCGAAGGCCTGGACTTGATATCCATGTTGACGGATGATGCTACAATTGCCGCCTGGAATAACGAAGGACTGCCCAGTGACA
GAATGTCCACCGAAAATGCCGCTATCCTAACACACTGTGAGCGCTGGCCTCTGGTGATAGATCCCCAGCAACAGGGAATTAAGTGGATCA
AGAATAAGTATGGAATGGACCTGAAAGTCACACATTTGGGCCAGAAAGGGTTTTTGAATGCCATTGAAACTGCTTTGGCCTTTGGTGATG
TCATCTTAATTGAAAATCTCGAGGAAACGATAGATCCAGTCCTGGATCCACTACTTGGCAGGAACACAATTAAAAAAGGAAAGTATATCA
GGATTGGAGATAAAGAATGTGAATTTAACAAGAACTTTCGCCTTATCCTTCACACAAAATTGGCAAATCCTCACTATAAGCCGGAATTAC
AAGCTCAGACAACTCTCCTCAATTTCACAGTCACAGAAGATGGTCTAGAAGCCCAGCTGCTGGCAGAGGTTGTCAGTATTGAAAGGCCAG
ATTTGGAGAAACTTAAGTTGGTATTGACAAAGCACCAAAATGATTTTAAAATTGAGCTCAAGTATCTGGAAGACGATCTCCTTTTGCGCC
TTTCTGCGGCAGAGGGAAGCTTTCTGGATGACACCAAACTGGTAGAGAGATTGGAGGCAACAAAGACCACCGTGGCAGAGATAGAGCACA
AGGTGATTGAAGCCAAAGAAAATGAAAGAAAAATCAACGAGGCCCGAGAATGTTACAGACCAGTGGCAGCAAGAGCATCTCTTCTTTATT
TTGTTATTAATGACCTCCAAAAAATCAACCCCCTCTACCAATTCTCTTTGAAGGCTTTTAACGTGCTGTTCCACAGAGCGATCGAGCAGG
CTGACAAGGTGGAAGACATGCAGGGACGCATCTCTATCCTGATGGAGAGCATCACCCATGCTGTCTTCCTCTACACCAGCCAGGCGCTGT
TTGAGAAGGACAAGCTCACCTTCCTGTCCCAGATGGCTTTTCAGATTTTGTTGAGAAAGAAAGAGATAGACCCTCTTGAATTGGATTTCC
TGCTTCGATTCACAGTTGAACACACTCATCTGAGTCCCGTTGACTTCCTAACTTCTCAGTCATGGAGTGCTATCAAGGCAATTGCCGTCA
TGGAAGAATTTCGAGGCATAGACCGAGATGTGGAAGGATCTGCCAAGCAGTGGAGGAAGTGGGTAGAATCCGAGTGTCCAGAAAAAGAAA
AATTACCTCAAGAATGGAAGAAGAAAAGTTTAATACAGAAGCTGATTCTTCTGAGAGCAATGCGCCCTGACAGAATGACGTATGCTCTCA
GAAATTTTGTAGAGGAAAAACTGGGTGCGAAGTATGTGGAGAGGACCAGATTGGACTTAGTTAAAGCATTCGAAGAAAGCAGCCCAGCCA
CCCCCATATTCTTCATCCTGTCTCCGGGGGTAGATGCCCTTAAAGACCTGGAGATTCTTGGCAAAAGACTTGGCTTTACAATTGACTCTG
GAAAATTCCACAATGTGTCTTTAGGACAAGGTCAGGAGACGGTGGCAGAAGTGGCCCTGGAGAAAGCTTCCAAAGGAGGACACTGGGTCA
TCCTCCAAAATGTTCATTTGGTAGCCAAGTGGCTAGGAACCTTGGAGAAGCTCCTTGAAAGATTCAGCCAAGGAAGCCACAGAGATTACA
GGGTTTTCATGAGTGCTGAGTCTGCACCTACACCAGATGAGCATATCATCCCTCAAGGACTCCTGGAAAATTCCATTAAGATCACTAATG
AACCCCCAACAGGGATGCTGGCCAATTTGCATGCCGCCCTGTACAACTTTGATCAGGATACACTTGAAATATGCTCCAAGGAGCAGGAGT
TTAAAAGCATCCTTTTTTCTCTCTGCTACTTCCACGCCTGTGTTGCTGGGAGACTGAGGTTTGGCCCCCAGGGCTGGAGCCGAAGCTATC
CTTTTAATCCTGGAGACCTCACCATTTGTGCCAGTGTCCTCTACAACTACTTAGAGGCAAACTCTAAAGTCCCATGGGAAGATCTCCGTT
ATCTCTTTGGTGAGATCATGTATGGAGGCCACATCACAGATGACTGGGATCGCAAACTGTGTCGGGTGTATTTAGAAGAATTCATGAATC
CATCTCTGACTGAAGATGAACTGATGCTGGCACCAGGTTTTGCTGCCCCACCCTACCTAGATTATGCAGGCTACCACCAGTACATAGAGG
AGATGCTTCCTCCAGAAAGCCCGGCACTGTATGGCCTCCACCCAAATGCTGAAATAGAATTCCTGACAGTGACATCCAACACTCTCTTCA
GAACTTTGCTGGAGATGCAGCCCAGGAATGCACTCAGTGGTGATGAACTGGGGCAGTCTACAGAAGAAAAGGTTAAGAATGTCTTGGATG
ACATTTTGGAGAAACTTCCAGAAGAGTTCAACATGGCAGAGATAATGCAAAAAAATTCAAATAGAAGCCCATATGTTCTTGTTTGCTTCC
AAGAATGTGAGAGGATGAATATTCTCATTCGGGAAATACGTATATCACTTGAACAACTGGACCTTAGTTTGAAGGGGGAATTGGCATTAT
CTCCTGCTGTGGAAGCCCAGCAGTTTGCATTGAGTTATGACACGGTACCAGACACTTGGAGCAAACTGGCTTATCCTTCTACTTATGGCC
TAGCCCAGTGGTTCAATGACCTCCTCCTGCGATGCCGAGAACTCGATACTTGGACACAAGACCTTACCCTTCCGGCTGTCGTGTGGCTCT
CCGGCTTCTTCAACCCTCAGTCCTTCTTAACTGCAATCATGCAGACGATGGCTCGAAAAAATGAGTGGCCCCTGGATAAAACGCGCTTGA
CTGCTGATGTTACCAAAAAAACAAAGGAAGATTATGGACACCCGCCAAGGGAAGGTGCATACCTCCACGGACTCTTCATGGAGGGCGCCC
GCTGGGACACCCAAGCAGGAACCATTGTTGAAGCCCGTCTCAAGGAGCTGGCATGCCCTATGCCGGTCATCTTTGCAAAAGCCACCCCCG
TGGACAGACAAGAAACCAAACAGACCTACGAGTGCCCTGTGTATAGAACCAAACTGAGAGGCCCCAGCTACATCTGGACCTTCAGGCTGA
AGAGCGAAGAGAAGACTGCAAAATGGGTTCTGGCTGGAGTGGCTCTGCTTCTAGAAGCGTAAGGTAACACTGGCATTCCTCTAGCCTCTG
CTGGAGTGCAGTGAGGATTTTCTAGCATGTTGCTGCACTGTTCCCATGCACATTATTCTAACTTTTTAGTAACTCACACGTGCATTCTTT
TTTCAACGCTATCCTTAGAGTGAAAGTCAGAAAAAAATACTAGAAACTAACTCAGGGCTGAGCGTGGTGGCACACGACTGTAATCCCAGT
TACTCAGGAGGTAGGAGAATCACTTGAACCTAGGAGGCAAAGGTTGCAGTGAGCCGAGGTTGCACCACTGCACTCCCTCCTGGGCAACAG
AACAAGACTCCATCTCAAAAAAAAAAAAGTACATCATAAAAGTACATCATATGTGAACATGCAAAAGCAATGCAGCCGGAAAGAACGGAG
ATTTTAATTTTTAACAAACAACAAATTAAATTATTAGCCCTTAAACTCTTTCAAAATATAAAAGCAGCAGGCCCCAGGTGAGTCCTGAAG
GAAGAGGCTAGCACTCTGTAAGGCCTCCAGTGTCCAGTGTCTACAATGTTGATGGTCCCCTTTTGTTCAGTCAAGTTTTAATAAAAATAA

>In-frame_KLHL7_ENST00000322275_chr7_23145765_+_DNAH11_ENST00000328843_chr7_21584624_+_14168nt
GGGTTCTGCCCGGGGACGCAGCCCAGTTGGTAGCGTCGCTCCCTGAGCGTTTCTAAGGGGGCCGCCCGGCCTTGTCTTTCGGCAGTGGCC
GAGCCACCGCCGCCTGCCGCGCGTTCCAGAGCTGGGCGCTGCAGCTGCACTGCCGATCGCCGTGTTTGGTCGATAGAATCCCCAGTGTGC
CCAGAGAGTGCGACCCCTCGCCCGGCCCGGCGAGCCCCGGGCGTGAACCGAGCTGAGGGAGGATGGCAGCCTCTGGGGTGGAGAAGAGCA
GCAAGAAGAAGACCGAGAAGAAACTTGCTGCTCGGGAAGAAGCTAAATTGTTGGCGGGTTTCATGGGCGTCATGAATAACATGCGGAAAC
AGATTCCAAGAGATGCAAACCATAAACTTGTTTTTATTTCCAAGAAGATTACTGAAAGCATTGGAGTAAATGACTTTTCTCAAGTGGTTT
TATTTGGAGAGTTACCTGCGTTGTCTCTTGGACATGTATCTGCTTTCCTTGATGAGATTTTAGTGCCAGTTCTTTCTAATAAGAACAACC
ATAAGTCCTGGTCCTGTTTTACTTCACAAGATATGGAATATCACATAGAAGTCATGAAAAAGAAGATGTATATTTTTAGGGGCAAAATGT
CTAGAAGAACTCTTCTACCAATTCCCACTGTTGCAGGAAAGATGGATCTGGATCAGAATTGTTCAGAGAACAAGCCACCGTCAAACGAAA
GGATAATACTTCATGCAATTGAATCTGTGGTTATTGAATGGTCACATCAAATCCAAGAAATTATAGAAAGAGATTCAGTGCAGCGTTTGT
TGAATGGTCTTCACTTGTCTCCTCAAGCAGAACTAGATTTCTGGATGATGAGGAGAGAAAATCTGTCATGCATTTATGATCAACTTCAGG
CACCTGTTGTCCTCAAAATGGTTAAGATCCTGACAACTAAACAAAGCAGCTATTTTCCTACTCTGAAGGACATTTTTCTGGCTGTGGAAA
ATGCTCTTCTCGAAGCCCAAGATGTGGAACTTTACCTGAGACCTCTGAGGAGACACATCCAGTGTCTCCAGGAGACGGAATTCCCACAGA
CACGCATATTAATCGCTCCATTATTTCATACCATCTGTCTGATCTGGAGTCATTCCAAGTTTTATAACACCCCAGCTCGGGTTATAGTTT
TATTGCAAGAGTTTTGTAATCTCTTCATTAACCAGGCAACAGCTTACCTTTCACCTGAGGACCTTTTGAGGGGAGAAATAGAAGAGTCAC
TGGAAAAGGTGCAGGTGGCTGTTAACATCTTAAAGACTTTCAAAAACTCCTTTTTCAACTATAGAAAAAAATTGGCAAGCTACTTTATGG
GAAGAAAGCTGAGACCATGGGATTTCCAGTCTCATCTGGTGTTTTGCAGATTTGACAAGTTTCTTGATCGTTTAATAAAAATAGAGGATA
TATTTGCCACCACTTTGGAATTTGAAAAGCTGGAAAGACTGGAATTTGGTGGTACCAAAGGAGCAATTTTAAATGGACAAGTCCACGAGA
TGAGTGAAGAACTTATGGAACTCTGTAAACTTTTTAAACAGAGCACTTATGACCCATCTGATTGCACTAACATGGAGTTTGAAAGTGATT
ATGTGGCATTTAAGTCCAAAACTCTGGAATTTGACAGAAGGCTTGGGACAATTATTTGTGAAGCTTTCTTTAACTGCAATGGCTTAGAAG
CTGCATTTAAGCTTTTGACCATATTTGGAAATTTTCTAGAGAAGCCAGTTGTCATGGAAATTTTCAGCCTACATTACAGCACACTAGTGC
ATATGTTTAATACAGAGCTGGATGTGTGTAAGCAACTGTATAATGAACACATGAAACAGATTGAATGTGGTCATGTAGTTCTTAACAAGA
ACATGCCATTTACCTCAGGAAATATGAAATGGGCCCAGCAGGTTCTCCAACGACTTCAAATGTTTTGGTCAAACTTCGCATCTCTCCGTT
ATCTATTTTTGGGCAATCCTGATCACGCTTTAGTTTATCAAAAGTATGTTGAAATGACCACTTTGCTTGATCAATTTGAAAGTCGTATCT
ATAATGAATGGAAAAGTAATGTGGATGAAATCTGTGAATTCAATTTGAATCAACCCTTGGTTAAATTCAGTGCCATAAATGGTCTTCTCT
GTGTCAATTTTGACCCAAAGCTAGTGGCTGTATTGAGAGAAGTGAAATATCTTTTGATGTTGAAGAAACAAGACATACCAGATTCAGCTT
TAGCCATCTTCAAGAAAAGGAACACTATTTTAAAGTACATTGGAAATCTTGACCTTCTTGTGCAAGGGTATAATAAACTCAAACAGACGC
TCCTGGAAGTTGAATACCCTCTGATTGAAGATGAGCTGAGGGCTATTGACGAGCAGCTGACAGCAGCCACAACGTGGCTGACATGGCAGG
ATGACTGCTGGGGCTACATCGAGAGGGTGAGGGCAGCCACGTCCGAGTTGGAGCACAGAGTTGAGCGCACACAGAAAAACGTGAAGGTGA
TCCAGCAGACCATGAGGGGCTGGGCCAGGTGCGTGCTACCTCCCAGGAGAGAGCACAGACGAGAGGCAGCCTTCACCTTGGAGGACAAGG
GTGATTTGTTTACAAAAAAATACAAGTTAATCCAAGGAGATGGCTGCAAGATCCACAACTTGGTCGAGGAAAATAGGAAGCTCTTCAAAG
CCAATCCCTCTCTGGATACCTGGAAAATTTATGTAGAATTCATTGACGACATTGTGGTGGAAGGCTTTTTTCAGGCTATAATGCACGACT
TAGACTTCTTTCTGAAGAATACAGAGAAACAATTGAAACCGGCACCGTTTTTTCAAGCACAAATGATCTTGTTGCCTCCTGAGATTGTGT
TTAAACCTTCCCTAGACAGAGAGGCTGGGGATGGCTTCTATGATCTTGTAGAAGAAATGTTATGCAATAGTTTTAGAATGTCTGCCCAGA
TGAACCGAATAGCAACACACCTGGAAATTAAAAATTATCAGAATGATATGGATAACATGTTAGGCCTGGCAGAGGTCAGGCAGGAGATCA
TGAACAGAGTGGTGAATGTCATCAACAAAGTCTTAGATTTCAGAAACACCCTGGAGACCCACACTTACCTCTGGGTGGATGATCGAGCTG
AGTTTATGAAGCATTTTCTCTTGTATGGCCATGCTGTGTCTTCCGATGAAATGGATGCTCATGCAAATGAAGAAATTCCCGAACAACCAC
CAACTCTTGAGCAATTCAAAGAACAGATTGACATTTATGAAGCTTTGTATGTTCAAATGAGCAAATTTGAGGACTTTAGAGTGTTTGATA
GTTGGTTCAAGGTGGACATGAAGCCTTTCAAAGTGAGCTTGTTAACCATAATTAAGAAATGGAGCTGGATGTTTCAGGAGCATCTTTTGA
GATTTGTCATTGACAGTCTGAATGAGCTACAAGAATTTATAAAGGAGACAGATTCCGGACTTCAGAGAGAATTAAATGAAGGTGATCATG
ATGGTTTAGTTGACATCATGGTGCATCTTCTGGCTGTAAGAAGCCGACAGAGAGCTACTGATGAACTCTTTGAACCTCTAAAAGAAACGA
TCACCCTCTTGGAAAGCTATGGCCAGAAGATGCCTGAGCAGGTCTATATTCAGCTAGAGGAATTACCTGAAAGATGGGAAACTACCAAAA
AGATCGCAGCAACTGTCAGACATGAAGTCTCACCTCTCCATAATGCGGAAGTCACTCTTATAAGGAAAAAATGTATTTTGTTTGACGCAA
AGCAGGCAGAGTTCAGAGAGAGATTCAGACACTATGCCCCTCTTGGATTTAATGCAGAAAATCCATACACAGCGCTTGATAAGGCAAATG
AAGAGCTTGAGGCCTTAGAAGAAGAAATGTTGCAGATGCAAGAATCTACTCGTCTTTTTGAAGTGGCTCTTCCAGAGTACAAACAAATGA
AACAGTGTCGCAAAGAAATAAAATTGCTCAAGGGACTGTGGGATGTCATTATTTATGTTCGAAGAAGCATTGATAATTGGACTAAAACCC
AGTGGAGACAGATTCATGTGGAACAGATGGATGTAGAACTCAGAAGGTTTGCCAAGGCGAGTTCCATAACTGAAATTTGGTCACTCAACA
AGGAAGTCCGCGTCTGGGATGCTTACACGGGCCTGGAAGGCACAGTTAAGGACATGACAGCCTCCCTGAGGGCCATCACAGAGTTACAGA
GCCCTGCCCTCAGGGACAGGCATTGGCACCAGCTGATGAAAGCTATTGGGGTCAAGTTTTTAATAAATGAAGCCACAACTTTGGCAGATT
TGTTAGCACTGCGGTTACACAGAGTGGAAGATGATGTCCGAAGGATTGTGGACAAGGCGGTGAAAGAGCTGGGGACTGAGAAGGTTATTA
CTGAAATCAGTCAGACCTGGGCAACCATGAAGTTTTCTTACGAAGTTCACTATCGAACAGGCATTCCATTACTAAAGTCTGATGAACAAC
TTTTTGAAACTCTAGAGCACAACCAAGTTCAGTTGCAGACTCTTCTTCAAAGCAAGTATGTAGAATATTTCATTGAGCAAGTGTTAAGCT
GGCAAAATAAATTAAACATAGCAGACTTGGTCATCTTCACTTGGATGGAAGTCCAGCGAACTTGGTCTCACCTGGAAAGCATTTTTGTCT
GTTCAGAAGATATTCGAATCCAGCTTGTGAAAGATGCTAGAAGATTTGATGGGGTGGATGCTGAATTTAAGGAGTTAATGTTCAAGACAG
CCAAAGTAGAAAATGTGTTAGAAGCAACGTGCAGACCTAATCTCTATGAAAAACTTAAAGATTTACAGTCCAGGCTTTCTCTTTGTGAAA
AAGCTCTCGCTGAATACCTGGAAACCAAGCGCATAGCCTTTCCTCGCTTCTATTTCGTCTCTTCTGCTGATTTACTTGACATTCTCTCAA
AAGGAGCTCAGCCTAAACAGGTAACATGTCACCTTGCCAAACTTTTCGACAGCATTGCAGATCTGCAGTTTGAAGACAATCAGGATGTTT
CTGCACACAGGGCAGTTGGAATGTACAGCAAAGAAAAGGAGTATGTCCCATTCCAAGCCGAGTGTGAATGTGTGGGCCATGTGGAAACAT
GGCTTCTGCAACTTGAACAGACTATGCAAGAAACGGTGCGTCATTCTATAACAGAAGCCATAGTGGCCTACGAGGAAAAACCTAGGGAAC
TGTGGATTTTTGATTTCCCAGCTCAGGTTGCACTAACCAGCTCACAAATATGGTGGACCACAGATGTAGGAATAGCCTTCAGTAGACTGG
AAGAAGGCTACGAAACAGCCCTGAAGGATTTCCATAAAAAACAGATTTCTCAGCTGAATACACTGATTACACTTTTGCTGGGAGAACTTC
CACCTGGAGACAGACAGAAGATCATGACAATTTGTACCATAGATGTCCATGCCAGAGACGTGGTGGCAAAACTTATTTCTCAGAAGCAAG
TTGTTGTCAGTCCCCAAGCTTTTACATGGCTGTCTCAACTTCGTCACCGATGGGAGGATACCCAGAAACACTGCTTTGTTAATATTTGTG
ATGCCCAGTTCCAGTACTTCTATGAATACTTAGGAAACAGCCCTCGACTAGTGATCACTCCTCTAACTGACAGGTGTTATATTACCTTAA
CTCAATCACTTCATCTAACCATGAGTGGGGCTCCTGCTGGCCCAGCTGGTACCGGGAAAACAGAGACCACCAAAGACCTAGGACGTGCCC
TTGGCATGATGGTCTATGTATTCAACTGTTCAGAGCAAATGGACTACAAATCCATAGGCAATATCTATAAGGGATTGGTGCAGACAGGAG
CTTGGGGCTGCTTTGATGAGTTCAACCGAATCTCTGTGGAAGTTCTGTCAGTGGTGGCAGTACAAGTGAAAATGATTCATGATGCCATCA
GAAACAGGAAGAAGAGATTTGTATTTCTTGGGGAAGCTATCACACTGAAGCCATCAGTTGGAATATTTATTACTATGAACCCGGGTTATG
CTGGTCGAACCGAATTACCGGAAAATCTCAAAGCTCTTTTCAGACCCTGTGCCATGGTGGCCCCTGACATTGAGCTAATCTGTGAAATCT
TGTTAGTTGCTGAAGGTTTTGTGGATGCGCGTGCATTAGCCCGAAAGTTCATTACGTTGTACACGCTTTGCAAGGAGCTTCTCTCCAAGC
AGGATCATTACGACTGGGGACTTCGTGCTATTAAGTCTGTCTTGGTTGTGGCTGGATCTCTGAAACGAGGAGATAAAAATAGACCCGAAG
ATCAGGTACTCATGAGAGCATTAAGGGATTTCAATATGCCCAAAATAGTGACTGACGACATCCCAGTGTTTCTGGGCCTGGTCGGTGACC
TGTTTCCAGCCCTGGATGTGCCCCGGAGGAGGAAGCTGCACTTTGAACAGATGGTCAGGCAGTCTACCCTGGAGCTCCGCCTGCAGCCTG
AAGAGAGCTTCATCCTCAAAGTTGTCCAGCTTGAGGAACTGTTGGCTGTGCGGCACTCGGTCTTTGTAGTTGGAAATGCAGGCACAGGAA
AGAGTAAGATTTTGAGAACACTGAACCGAACATATGTTAACATGAAACAGAAGCCGGTTTGGAATGACTTAAACCCTAAAGCTGTGACAA
CAGATGAACTCTTTGGTTTCATACATCATGCTACCCGAGAATGGAAAGATGGCAAGATTGTTTACTCTTATTTTATAGGTCTCTTCTCAT
CCATTCTACGAGAACAAGCAAATCTTAAGCATGATGGACCAAAATGGATAGTCCTGGATGGCGATATTGACCCCATGTGGATTGAATCAC
TGAATACTGTAATGGATGATAACAAGGTGCTGACCCTCGCCAGCAATGAGCGCATTGCACTCACTCCCTTCATGAGGCTTCTGTTTGAGA
TACATCACTTAAGGAGCGCAACCCCGGCCACTGTTTCCAGAGCTGGTATTCTGTATGTGAACCCACAAGATCTGGGCTGGAATCCGTATG
TGGCCAGTTGGATAGACAGAAGGCGGCATCAATCAGAAAAGGCCAATTTGACTATTCTTTTTGATAAATATGTCCCTGCATGCTTGGATA
AACTGAGAACAAGCTTTAAAACCATCACTTCAATTCCTGAGAGTAGCCTGGTGCAGACTCTATGTGTTCTTTTGGAGTGCTTGCTGACTC
CTGAAAATGTACCTTCTGACAGCCCAAAAGAAGTTTATGAAGTCTATTTTGTATTTGCTTGTATCTGGGCTTTTGGAGGCACCCTGCTAC
AAGATCAGATTTCTGATTATCAAGCTGACTTCAGTCGGTGGTGGCAGAAAGAGATGAAAGCAGTGAAATTTCCGTCGCAGGGAACAATCT
TTGATTATTATGTGGACCACAAAACTAAGAAATTATTGCCCTGGGCTGACAAAATTGCCCAGTTTACTATGGATCCAGATGTGCCTCTGC
AGACAGTTCTCGTTCACACAACAGAGACAGCTCGTCTTAGATATTTCATGGAGTTGTTGCTTGAGAAAGGAAAACCTCTAATGCTAGTAG
GAAATGCAGGAGTGGGAAAAACAGTCTTTGTAGGTGACACATTGGCAAGTCTCTCTGAGGATTACATAGTATCCCGTGTGCCTTTCAACT
ACTACACGACATCCACAGCTCTGCAAAAAATTCTTGAGAAACCCCTAGAGAAAAAAGCTGGTCATAACTATGGTCCTGGAGGAAATAAAA
AATTGATTTATTTTATCGACGACATGAACATGCCTGAAGTGGACTTATATGGCACCGTTCAGCCTCACACCCTGATCCGGCAGCATATTG
ATTATGGACATTGGTATGATAGACAGAAGGTGATGCTTAAAGAAATCCATAACTGCCAGTATGTCGCCTGCATGAATCCGATGGTGGGCA
GCTTCACCATCAATCCCAGGCTACAGAGACATTTCACAGTGTTTGCATTCAATTTTCCATCTTTGGATGCACTAAACACCATCTATGGCC
AAATCTTTAGCTTCCATTTCCAACAGCAAGCATTTGCTCCATCAATTCTCAGGAGTGGCCCCACTTTGATCCAGGCAACAATAGCATTCC
ATCAGACAATGATGTGTAACTTTTTACCCACGGCTATTAAATTCCACTACATCTTTAATCTGAGAGATTTATCAAACGTCTTCCAGGGGA
TTTTATTTGCTTCTCCTGAGTGTTTAAAAGGTCCACTTGATTTAATACATCTGTGGCTTCATGAATCTGCCCGTGTTTATGGAGACAAAC
TGATAGACAAAAAAGATTGTGATTTGTTTCAGAGAAGAATGCTGGAAACTGCTTATAAATATTTTGAAGGTATAGATAGTCACATGCTGC
TTCAACAGCCCCTCATTTATTGCCACTTTGCTGATAGAGGGAAGGACCCACATTACATGCCAGTGAAGGACTGGGAAGTGCTGAAGACGA
TTCTTACAGAAACGTTAGACAACTACAATGAACTAAATGCTGCCATGCACCTAGTTTTGTTTGAAGATGCCATGCAACATGTGTGTCGCA
TCAGCCGGATCTTACGAACCCCTCAGGGCTGTGCTCTCTTGGTTGGAGTTGGGGGCAGTGGCAAGCAGAGCTTGTCCAGGCTGGCAGCTT
ACCTTCGTGGCCTTGAGGTCTTTCAGATCACTCTGACCGAGGGCTATGGAATCCAGGAACTTCGGGTAGATCTTGCCAATTTGTACATCC
GAACTGGAGCCAAGAACATGCCCACTGTGTTCCTGCTGACAGATGCCCAGGTTCTAGATGAGAGCTTCCTCGTGCTGATTAATGACTTGC
TGGCATCAGGAGAAATCCCAGATCTGTTCAGCGATGAAGATGTGGACAAGATAATTTCTGGAATTCATAATGAAGTTCATGCTCTGGGCA
TGGTAGACTCCAGGGAAAACTGTTGGAAATTCTTTATGGCCAGGGTGCGACTACAGCTCAAAATCATTTTGTGTTTCTCTCCAGTTGGTC
GCACGCTGAGAGTTAGAGCTCGGAAGTTCCCAGCCATAGTTAACTGCACGGCTATTGACTGGTTTCATGCGTGGCCGCAGGAGGCTCTGG
TCTCCGTCAGCAGGAGGTTCATTGAGGAAACCAAGGGAATTGAGCCAGTGCACAAAGACTCTATTAGCCTTTTCATGGCACATGTTCACA
CCACTGTAAATGAAATGAGTACCAGATATTACCAGAATGAGAGAAGACACAACTATACCACCCCAAAGAGTTTTCTAGAACAAATATCAC
TGTTTAAGAACCTGTTGAAGAAGAAGCAAAATGAGGTATCCGAGAAAAAAGAACGCCTGGTGAACGGCATCCAAAAGCTAAAAACCACAG
CCTCTCAGGTGGGAGATCTAAAAGCCAGACTTGCCTCTCAAGAAGCCGAGCTGCAACTGAGAAATCATGATGCCGAAGCTCTGATCACAA
AGATCGGCCTTCAGACGGAGAAAGTGAGCCGGGAAAAGACCATCGCTGATGCTGAGGAGCGAAAGGTGACAGCCATTCAGACTGAAGTGT
TCCAGAAACAGAGAGAATGTGAAGCTGACTTACTCAAGGCTGAGCCTGCACTGGTGGCTGCTACAGCTGCACTCAATACACTCAACAGGG
TCAACCTCAGTGAGCTGAAAGCCTTTCCCAACCCTCCCATCGCAGTTACCAATGTTACTGCAGCCGTGATGGTCCTTCTGGCTCCTCGGG
GAAGAGTGCCCAAAGACCGAAGTTGGAAAGCAGCTAAAGTCTTCATGGGAAAGGTTGATGATTTTTTGCAAGCATTAATTAACTATGACA
AAGAGCACATTCCAGAGAACTGTCTAAAAGTGGTGAATGAACACTATTTGAAAGACCCAGAGTTTAATCCAAACCTGATTCGAACCAAAT
CTTTTGCAGCAGCTGGCCTGTGTGCCTGGGTCATCAACATCATTAAATTCTATGAGGTCTACTGTGATGTGGAGCCAAAACGCCAAGCAT
TAGCCCAAGCAAACTTAGAACTGGCTGCAGCTACTGAAAAACTAGAGGCTATCAGGAAAAAGCTTGTGGATCTGGATCGAAATCTGAGCA
GACTCACGGCTTCATTTGAAAAAGCAACAGCTGAGAAAGTCCGGTGTCAAGAAGAGGTGAACCAAACCAACAAAACCATCAAATTAGCTA
ACAGACTTGTCAAGGAACTTGAGGCAAAGAAGATTCGCTGGGGTCAATCCATTAAGTCCTTTGAAGCTCAAGAGAAGACACTCTGTGGAG
ATGTTCTTCTCACGGCGGCATTTGTGTCTTACGTCGGACCCTTCACAAGGCAGTATCGCCAGGAGCTGGTGCACTGCAAGTGGGTTCCCT
TTCTTCAACAGAAGGTTTCCATTCCACTAACCGAAGGCCTGGACTTGATATCCATGTTGACGGATGATGCTACAATTGCCGCCTGGAATA
ACGAAGGACTGCCCAGTGACAGAATGTCCACCGAAAATGCCGCTATCCTAACACACTGTGAGCGCTGGCCTCTGGTGATAGATCCCCAGC
AACAGGGAATTAAGTGGATCAAGAATAAGTATGGAATGGACCTGAAAGTCACACATTTGGGCCAGAAAGGGTTTTTGAATGCCATTGAAA
CTGCTTTGGCCTTTGGTGATGTCATCTTAATTGAAAATCTCGAGGAAACGATAGATCCAGTCCTGGATCCACTACTTGGCAGGAACACAA
TTAAAAAAGGAAAGTATATCAGGATTGGAGATAAAGAATGTGAATTTAACAAGAACTTTCGCCTTATCCTTCACACAAAATTGGCAAATC
CTCACTATAAGCCGGAATTACAAGCTCAGACAACTCTCCTCAATTTCACAGTCACAGAAGATGGTCTAGAAGCCCAGCTGCTGGCAGAGG
TTGTCAGTATTGAAAGGCCAGATTTGGAGAAACTTAAGTTGGTATTGACAAAGCACCAAAATGATTTTAAAATTGAGCTCAAGTATCTGG
AAGACGATCTCCTTTTGCGCCTTTCTGCGGCAGAGGGAAGCTTTCTGGATGACACCAAACTGGTAGAGAGATTGGAGGCAACAAAGACCA
CCGTGGCAGAGATAGAGCACAAGGTGATTGAAGCCAAAGAAAATGAAAGAAAAATCAACGAGGCCCGAGAATGTTACAGACCAGTGGCAG
CAAGAGCATCTCTTCTTTATTTTGTTATTAATGACCTCCAAAAAATCAACCCCCTCTACCAATTCTCTTTGAAGGCTTTTAACGTGCTGT
TCCACAGAGCGATCGAGCAGGCTGACAAGGTGGAAGACATGCAGGGACGCATCTCTATCCTGATGGAGAGCATCACCCATGCTGTCTTCC
TCTACACCAGCCAGGCGCTGTTTGAGAAGGACAAGCTCACCTTCCTGTCCCAGATGGCTTTTCAGATTTTGTTGAGAAAGAAAGAGATAG
ACCCTCTTGAATTGGATTTCCTGCTTCGATTCACAGTTGAACACACTCATCTGAGTCCCGTTGACTTCCTAACTTCTCAGTCATGGAGTG
CTATCAAGGCAATTGCCGTCATGGAAGAATTTCGAGGCATAGACCGAGATGTGGAAGGATCTGCCAAGCAGTGGAGGAAGTGGGTAGAAT
CCGAGTGTCCAGAAAAAGAAAAATTACCTCAAGAATGGAAGAAGAAAAGTTTAATACAGAAGCTGATTCTTCTGAGAGCAATGCGCCCTG
ACAGAATGACGTATGCTCTCAGAAATTTTGTAGAGGAAAAACTGGGTGCGAAGTATGTGGAGAGGACCAGATTGGACTTAGTTAAAGCAT
TCGAAGAAAGCAGCCCAGCCACCCCCATATTCTTCATCCTGTCTCCGGGGGTAGATGCCCTTAAAGACCTGGAGATTCTTGGCAAAAGAC
TTGGCTTTACAATTGACTCTGGAAAATTCCACAATGTGTCTTTAGGACAAGGTCAGGAGACGGTGGCAGAAGTGGCCCTGGAGAAAGCTT
CCAAAGGAGGACACTGGGTCATCCTCCAAAATGTTCATTTGGTAGCCAAGTGGCTAGGAACCTTGGAGAAGCTCCTTGAAAGATTCAGCC
AAGGAAGCCACAGAGATTACAGGGTTTTCATGAGTGCTGAGTCTGCACCTACACCAGATGAGCATATCATCCCTCAAGGACTCCTGGAAA
ATTCCATTAAGATCACTAATGAACCCCCAACAGGGATGCTGGCCAATTTGCATGCCGCCCTGTACAACTTTGATCAGGATACACTTGAAA
TATGCTCCAAGGAGCAGGAGTTTAAAAGCATCCTTTTTTCTCTCTGCTACTTCCACGCCTGTGTTGCTGGGAGACTGAGGTTTGGCCCCC
AGGGCTGGAGCCGAAGCTATCCTTTTAATCCTGGAGACCTCACCATTTGTGCCAGTGTCCTCTACAACTACTTAGAGGCAAACTCTAAAG
TCCCATGGGAAGATCTCCGTTATCTCTTTGGTGAGATCATGTATGGAGGCCACATCACAGATGACTGGGATCGCAAACTGTGTCGGGTGT
ATTTAGAAGAATTCATGAATCCATCTCTGACTGAAGATGAACTGATGCTGGCACCAGGTTTTGCTGCCCCACCCTACCTAGATTATGCAG
GCTACCACCAGTACATAGAGGAGATGCTTCCTCCAGAAAGCCCGGCACTGTATGGCCTCCACCCAAATGCTGAAATAGAATTCCTGACAG
TGACATCCAACACTCTCTTCAGAACTTTGCTGGAGATGCAGCCCAGGAATGCACTCAGTGGTGATGAACTGGGGCAGTCTACAGAAGAAA
AGGTTAAGAATGTCTTGGATGACATTTTGGAGAAACTTCCAGAAGAGTTCAACATGGCAGAGATAATGCAAAAAAATTCAAATAGAAGCC
CATATGTTCTTGTTTGCTTCCAAGAATGTGAGAGGATGAATATTCTCATTCGGGAAATACGTATATCACTTGAACAACTGGACCTTAGTT
TGAAGGGGGAATTGGCATTATCTCCTGCTGTGGAAGCCCAGCAGTTTGCATTGAGTTATGACACGGTACCAGACACTTGGAGCAAACTGG
CTTATCCTTCTACTTATGGCCTAGCCCAGTGGTTCAATGACCTCCTCCTGCGATGCCGAGAACTCGATACTTGGACACAAGACCTTACCC
TTCCGGCTGTCGTGTGGCTCTCCGGCTTCTTCAACCCTCAGTCCTTCTTAACTGCAATCATGCAGACGATGGCTCGAAAAAATGAGTGGC
CCCTGGATAAAACGCGCTTGACTGCTGATGTTACCAAAAAAACAAAGGAAGATTATGGACACCCGCCAAGGGAAGGTGCATACCTCCACG
GACTCTTCATGGAGGGCGCCCGCTGGGACACCCAAGCAGGAACCATTGTTGAAGCCCGTCTCAAGGAGCTGGCATGCCCTATGCCGGTCA
TCTTTGCAAAAGCCACCCCCGTGGACAGACAAGAAACCAAACAGACCTACGAGTGCCCTGTGTATAGAACCAAACTGAGAGGCCCCAGCT
ACATCTGGACCTTCAGGCTGAAGAGCGAAGAGAAGACTGCAAAATGGGTTCTGGCTGGAGTGGCTCTGCTTCTAGAAGCGTAAGGTAACA
CTGGCATTCCTCTAGCCTCTGCTGGAGTGCAGTGAGGATTTTCTAGCATGTTGCTGCACTGTTCCCATGCACATTATTCTAACTTTTTAG
TAACTCACACGTGCATTCTTTTTTCAACGCTATCCTTAGAGTGAAAGTCAGAAAAAAATACTAGAAACTAACTCAGGGCTGAGCGTGGTG
GCACACGACTGTAATCCCAGTTACTCAGGAGGTAGGAGAATCACTTGAACCTAGGAGGCAAAGGTTGCAGTGAGCCGAGGTTGCACCACT
GCACTCCCTCCTGGGCAACAGAACAAGACTCCATCTCAAAAAAAAAAAAGTACATCATAAAAGTACATCATATGTGAACATGCAAAAGCA
ATGCAGCCGGAAAGAACGGAGATTTTAATTTTTAACAAACAACAAATTAAATTATTAGCCCTTAAACTCTTTCAAAATATAAAAGCAGCA
GGCCCCAGGTGAGTCCTGAAGGAAGAGGCTAGCACTCTGTAAGGCCTCCAGTGTCCAGTGTCTACAATGTTGATGGTCCCCTTTTGTTCA


Top

FusionGenePPI for KLHL7_DNAH11


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
KLHL7CUL3, RBX1, KLHL7, UBC, MOV10, NXF1, NUP50, C9orf41, NR2C2, YWHAZ, CKAP5, NUP153, FERMT3, BOD1L1, MSRB3, KLHL6, ARIH1, SDC2, STAT5A, CEP44, GLI3DNAH11ZDHHC17


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for KLHL7_DNAH11


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for KLHL7_DNAH11


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneKLHL7C2751986RETINITIS PIGMENTOSA 421CTD_human;UNIPROT
TgeneDNAH11C0010068Coronary heart disease1CTD_human
TgeneDNAH11C0043094Weight Gain1CTD_human
TgeneDNAH11C0242339Dyslipidemias1CTD_human
TgeneDNAH11C2678473CILIARY DYSKINESIA, PRIMARY, 7 (disorder)1CTD_human;UNIPROT