FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 19053

FusionGeneSummary for KLHL7_BRAF

check button Fusion gene summary
Fusion gene informationFusion gene name: KLHL7_BRAF
Fusion gene ID: 19053
HgeneTgene
Gene symbol

KLHL7

BRAF

Gene ID

55975

673

Gene namekelch like family member 7B-Raf proto-oncogene, serine/threonine kinase
SynonymsCISS3|KLHL6|SBBI26B-RAF1|B-raf|BRAF1|NS7|RAFB1
Cytomap

7p15.3

7q34

Type of geneprotein-codingprotein-coding
Descriptionkelch-like protein 7kelch-like 6kelch-like 7kelch/BTBserine/threonine-protein kinase B-raf94 kDa B-raf proteinB-Raf proto-oncogene serine/threonine-protein kinase (p94)B-Raf serine/threonine-proteinmurine sarcoma viral (v-raf) oncogene homolog B1proto-oncogene B-Rafv-raf murine sarcoma viral oncogene
Modification date2018052220180527
UniProtAcc

Q8IXQ5

P15056

Ensembl transtripts involved in fusion geneENST00000322231, ENST00000339077, 
ENST00000539124, ENST00000542558, 
ENST00000409689, ENST00000545443, 
ENST00000479288, ENST00000322275, 
ENST00000410047, ENST00000545771, 
ENST00000288602, 
Fusion gene scores* DoF score5 X 5 X 3=7524 X 11 X 10=2640
# samples 535
** MAII scorelog2(5/75*10)=-0.584962500721156
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(35/2640*10)=-2.91511110241349
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: KLHL7 [Title/Abstract] AND BRAF [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneKLHL7

GO:0016567

protein ubiquitination

21828050

TgeneBRAF

GO:0006468

protein phosphorylation

17563371

TgeneBRAF

GO:0010828

positive regulation of glucose transmembrane transport

23010278

TgeneBRAF

GO:0033138

positive regulation of peptidyl-serine phosphorylation

19667065

TgeneBRAF

GO:0043066

negative regulation of apoptotic process

19667065

TgeneBRAF

GO:0070374

positive regulation of ERK1 and ERK2 cascade

22065586

TgeneBRAF

GO:0071277

cellular response to calcium ion

18567582

TgeneBRAF

GO:0090150

establishment of protein localization to membrane

23010278


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDGBMTCGA-28-5218-01AKLHL7chr7

23165418

+BRAFchr7

140482957

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
intron-3CDSENST00000322231ENST00000288602KLHL7chr7

23165418

+BRAFchr7

140482957

-
intron-3CDSENST00000339077ENST00000288602KLHL7chr7

23165418

+BRAFchr7

140482957

-
intron-3CDSENST00000539124ENST00000288602KLHL7chr7

23165418

+BRAFchr7

140482957

-
intron-3CDSENST00000542558ENST00000288602KLHL7chr7

23165418

+BRAFchr7

140482957

-
intron-3CDSENST00000409689ENST00000288602KLHL7chr7

23165418

+BRAFchr7

140482957

-
intron-3CDSENST00000545443ENST00000288602KLHL7chr7

23165418

+BRAFchr7

140482957

-
intron-3CDSENST00000479288ENST00000288602KLHL7chr7

23165418

+BRAFchr7

140482957

-
In-frameENST00000322275ENST00000288602KLHL7chr7

23165418

+BRAFchr7

140482957

-
Frame-shitENST00000410047ENST00000288602KLHL7chr7

23165418

+BRAFchr7

140482957

-
intron-3CDSENST00000545771ENST00000288602KLHL7chr7

23165418

+BRAFchr7

140482957

-

Top

FusionProtFeatures for KLHL7_BRAF


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
KLHL7

Q8IXQ5

BRAF

P15056

Substrate-specific adapter of a BCR (BTB-CUL3-RBX1) E3ubiquitin ligase complex. The BCR(KLHL7) complex acts by mediatingubiquitination and subsequent degradation of substrate proteins.Probably mediates 'Lys-48'-linked ubiquitination.{ECO:0000269|PubMed:21828050}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for KLHL7_BRAF


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_KLHL7_ENST00000322275_chr7_23165418_+_BRAF_ENST00000288602_chr7_140482957_-_617aa
MAASGVEKSSKKKTEKKLAAREEAKLLAGFMGVMNNMRKQKTLCDVILMVQERKIPAHRVVLAAASHFFNLMFTTNMLESKSFEVELKDA
EPDIIEQLVEFATTARISVNSNNVQSLLDAANQTQIEPVKKMCVDFLKEQVDASNCLGEAEKVDQSLPECGMLFTV__SLVAHE_TSRCL
CSSPPLSAGYVPRPPVNA_NCR_Y_ILTILCFL_YIHATDEV_FLN_TVKD_QQ___NRTTLRSTTGLSATPPASLPGSLTNVKALQKSP
GPQRERKSSSSSEDRNRMKTLGRRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRH
VNILLFMGTSTKPQLAIVTQWCEGSSLTHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATV
KSRWSGSHQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVTAFGIVLTELMTGQLPTSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMK


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_KLHL7_ENST00000322275_chr7_23165418_+_BRAF_ENST00000288602_chr7_140482957_-_1851nt
ATGGCAGCCTCTGGGGTGGAGAAGAGCAGCAAGAAGAAGACCGAGAAGAAACTTGCTGCTCGGGAAGAAGCTAAATTGTTGGCGGGTTTC
ATGGGCGTCATGAATAACATGCGGAAACAGAAAACGTTGTGTGACGTGATCCTCATGGTCCAGGAAAGAAAGATACCTGCTCATCGTGTT
GTTCTTGCTGCAGCCAGTCATTTTTTTAACTTAATGTTCACAACTAACATGCTTGAATCAAAGTCCTTTGAAGTAGAACTCAAAGATGCT
GAACCTGATATTATTGAACAACTGGTGGAATTTGCTTATACTGCTAGAATTTCCGTGAATAGCAACAATGTTCAGTCTTTGCTGGATGCA
GCAAACCAATATCAGATTGAACCTGTGAAGAAAATGTGTGTTGATTTTTTGAAAGAACAAGTTGATGCTTCAAATTGTCTTGGAGAAGCA
GAAAAAGTTGATCAGAGCCTTCCAGAGTGTGGTATGCTTTTCACTGTGTGATGATCCTTAGTGGCACATGAATGAACGTCCAGATGTTTG
TGCAGTAGCCCACCCTTATCTGCAGGATACGTTCCAAGACCCCCAGTGAATGCCTGAAACTGCAGATAGTACTGAATCCTATATATACTG
TGTTTTTTATGATACATACATGCCTATGATGAAGTTTAATTTCTAAATTAGACAGTAAAAGATTAACAACAATAATAATAAAATAGAACA
ACTTTAAGATCAACCACAGGTTTGTCTGCTACCCCCCCTGCCTCATTACCTGGCTCACTAACTAACGTGAAAGCCTTACAGAAATCTCCA
GGACCTCAGCGAGAAAGGAAGTCATCTTCATCCTCAGAAGACAGGAATCGAATGAAAACACTTGGTAGACGGGACTCGAGTGATGATTGG
GAGATTCCTGATGGGCAGATTACAGTGGGACAAAGAATTGGATCTGGATCATTTGGAACAGTCTACAAGGGAAAGTGGCATGGTGATGTG
GCAGTGAAAATGTTGAATGTGACAGCACCTACACCTCAGCAGTTACAAGCCTTCAAAAATGAAGTAGGAGTACTCAGGAAAACACGACAT
GTGAATATCCTACTCTTCATGGGCTATTCCACAAAGCCACAACTGGCTATTGTTACCCAGTGGTGTGAGGGCTCCAGCTTGTATCACCAT
CTCCATATCATTGAGACCAAATTTGAGATGATCAAACTTATAGATATTGCACGACAGACTGCACAGGGCATGGATTACTTACACGCCAAG
TCAATCATCCACAGAGACCTCAAGAGTAATAATATATTTCTTCATGAAGACCTCACAGTAAAAATAGGTGATTTTGGTCTAGCTACAGTG
AAATCTCGATGGAGTGGGTCCCATCAGTTTGAACAGTTGTCTGGATCCATTTTGTGGATGGCACCAGAAGTCATCAGAATGCAAGATAAA
AATCCATACAGCTTTCAGTCAGATGTATATGCATTTGGAATTGTTCTGTATGAATTGATGACTGGACAGTTACCTTATTCAAACATCAAC
AACAGGGACCAGATAATTTTTATGGTGGGACGAGGATACCTGTCTCCAGATCTCAGTAAGGTACGGAGTAACTGTCCAAAAGCCATGAAG
AGATTAATGGCAGAGTGCCTCAAAAAGAAAAGAGATGAGAGACCACTCTTTCCCCAAATTCTCGCCTCTATTGAGCTGCTGGCCCGCTCA
TTGCCAAAAATTCACCGCAGTGCATCAGAACCCTCCTTGAATCGGGCTGGTTTCCAAACAGAGGATTTTAGTCTATATGCTTGTGCTTCT


* Fusion transcript sequences (Full-length transcript).
>In-frame_KLHL7_ENST00000322275_chr7_23165418_+_BRAF_ENST00000288602_chr7_140482957_-_1953nt
GATGGCGGCAATGGCGGTGGCGCTGCGGGGATTAGGAGGGCGCTTCCGGTGGCGGACGCAGGCCGTGGCGGGCGGGGTGCGGGGCGCGGC
GCGGGGCGCAGCAGAAAACGTTGTGTGACGTGATCCTCATGGTCCAGGAAAGAAAGATACCTGCTCATCGTGTTGTTCTTGCTGCAGCCA
GTCATTTTTTTAACTTAATGTTCACAACTAACATGCTTGAATCAAAGTCCTTTGAAGTAGAACTCAAAGATGCTGAACCTGATATTATTG
AACAACTGGTGGAATTTGCTTATACTGCTAGAATTTCCGTGAATAGCAACAATGTTCAGTCTTTGCTGGATGCAGCAAACCAATATCAGA
TTGAACCTGTGAAGAAAATGTGTGTTGATTTTTTGAAAGAACAAGTTGATGCTTCAAATTGTCTTGGAGAAGCAGAAAAAGTTGATCAGA
GCCTTCCAGAGTGTGGTATGCTTTTCACTGTGTGATGATCCTTAGTGGCACATGAATGAACGTCCAGATGTTTGTGCAGTAGCCCACCCT
TATCTGCAGGATACGTTCCAAGACCCCCAGTGAATGCCTGAAACTGCAGATAGTACTGAATCCTATATATACTGTGTTTTTTATGATACA
TACATGCCTATGATGAAGTTTAATTTCTAAATTAGACAGTAAAAGATTAACAACAATAATAATAAAATAGAACAACTTTAAGATCAACCA
CAGGTTTGTCTGCTACCCCCCCTGCCTCATTACCTGGCTCACTAACTAACGTGAAAGCCTTACAGAAATCTCCAGGACCTCAGCGAGAAA
GGAAGTCATCTTCATCCTCAGAAGACAGGAATCGAATGAAAACACTTGGTAGACGGGACTCGAGTGATGATTGGGAGATTCCTGATGGGC
AGATTACAGTGGGACAAAGAATTGGATCTGGATCATTTGGAACAGTCTACAAGGGAAAGTGGCATGGTGATGTGGCAGTGAAAATGTTGA
ATGTGACAGCACCTACACCTCAGCAGTTACAAGCCTTCAAAAATGAAGTAGGAGTACTCAGGAAAACACGACATGTGAATATCCTACTCT
TCATGGGCTATTCCACAAAGCCACAACTGGCTATTGTTACCCAGTGGTGTGAGGGCTCCAGCTTGTATCACCATCTCCATATCATTGAGA
CCAAATTTGAGATGATCAAACTTATAGATATTGCACGACAGACTGCACAGGGCATGGATTACTTACACGCCAAGTCAATCATCCACAGAG
ACCTCAAGAGTAATAATATATTTCTTCATGAAGACCTCACAGTAAAAATAGGTGATTTTGGTCTAGCTACAGTGAAATCTCGATGGAGTG
GGTCCCATCAGTTTGAACAGTTGTCTGGATCCATTTTGTGGATGGCACCAGAAGTCATCAGAATGCAAGATAAAAATCCATACAGCTTTC
AGTCAGATGTATATGCATTTGGAATTGTTCTGTATGAATTGATGACTGGACAGTTACCTTATTCAAACATCAACAACAGGGACCAGATAA
TTTTTATGGTGGGACGAGGATACCTGTCTCCAGATCTCAGTAAGGTACGGAGTAACTGTCCAAAAGCCATGAAGAGATTAATGGCAGAGT
GCCTCAAAAAGAAAAGAGATGAGAGACCACTCTTTCCCCAAATTCTCGCCTCTATTGAGCTGCTGGCCCGCTCATTGCCAAAAATTCACC
GCAGTGCATCAGAACCCTCCTTGAATCGGGCTGGTTTCCAAACAGAGGATTTTAGTCTATATGCTTGTGCTTCTCCAAAAACACCCATCC
AGGCAGGGGGATATGGTGCGTTTCCTGTCCACTGAAACAAATGAGTGAGAGAGTTCAGGAGAGTAGCAACAAAAGGAAAATAAATGAACA


Top

FusionGenePPI for KLHL7_BRAF


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
KLHL7CUL3, RBX1, KLHL7, UBC, MOV10, NXF1, NUP50, C9orf41, NR2C2, YWHAZ, CKAP5, NUP153, FERMT3, BOD1L1, MSRB3, KLHL6, ARIH1, SDC2, STAT5A, CEP44, GLI3BRAFYWHAB, YWHAG, YWHAQ, YWHAZ, SFN, HRAS, AKT1, MAPK3, RAP1GAP, RAF1, MRAS, RAP1A, PAK2, TERF1, CCDC88A, NEDD4L, MAP2K1, RNF149, KSR1, BRAP, PRKCE, RPS6KB2, HSP90AA1, BRAF, YWHAE, HSPA5, MAP2K2, HSPA1A, HSPA8, YWHAH, HSPA9, ARAF, CDC37, HSP90AB1, PHKB, LIMK1, IQGAP1, MAPK1, BAD, LIPF, MUS81, FBXW7, FGFR2, BRCA2, VHL, FNTA, HDAC2, PIK3CA, EGFR, PTEN, FNIP1, FNIP2, RAB3GAP1, KRAS, KIAA0141, FKBPL, ARMCX3, KCNC4, RPTOR, CYLD, NRAS


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for KLHL7_BRAF


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
TgeneBRAFP15056DB08881VemurafenibSerine/threonine-protein kinase B-rafsmall moleculeapproved
TgeneBRAFP15056DB08896RegorafenibSerine/threonine-protein kinase B-rafsmall moleculeapproved
TgeneBRAFP15056DB00398SorafenibSerine/threonine-protein kinase B-rafsmall moleculeapproved|investigational
TgeneBRAFP15056DB08912DabrafenibSerine/threonine-protein kinase B-rafsmall moleculeapproved|investigational

Top

RelatedDiseases for KLHL7_BRAF


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneKLHL7C2751986RETINITIS PIGMENTOSA 421CTD_human;UNIPROT
TgeneBRAFC0025202melanoma21CTD_human
TgeneBRAFC1527249Colorectal Cancer8UNIPROT
TgeneBRAFC1275081Cardio-facio-cutaneous syndrome6CTD_human;ORPHANET;UNIPROT
TgeneBRAFC0009404Colorectal Neoplasms4CTD_human
TgeneBRAFC0040136Thyroid Neoplasm4CTD_human
TgeneBRAFC0024305Lymphoma, Non-Hodgkin3UNIPROT
TgeneBRAFC0684249Carcinoma of lung3UNIPROT
TgeneBRAFC3150970NOONAN SYNDROME 73CTD_human;UNIPROT
TgeneBRAFC0152013Adenocarcinoma of lung (disorder)2CTD_human
TgeneBRAFC0002448Ameloblastoma1CTD_human
TgeneBRAFC0004114Astrocytoma1CTD_human
TgeneBRAFC0010276Craniopharyngioma1CTD_human;ORPHANET
TgeneBRAFC0017638Glioma1CTD_human
TgeneBRAFC0022665Kidney Neoplasm1CTD_human
TgeneBRAFC0023903Liver neoplasms1CTD_human
TgeneBRAFC0024694Mandibular Neoplasms1CTD_human
TgeneBRAFC0028326Noonan Syndrome1CTD_human;ORPHANET
TgeneBRAFC0033578Prostatic Neoplasms1CTD_human
TgeneBRAFC0036920Sezary Syndrome1CTD_human
TgeneBRAFC0079773Lymphoma, T-Cell, Cutaneous1CTD_human
TgeneBRAFC0206686Adrenocortical carcinoma1CTD_human
TgeneBRAFC0206754Neuroendocrine Tumors1CTD_human
TgeneBRAFC0238463Papillary thyroid carcinoma1CTD_human;ORPHANET
TgeneBRAFC0587248Costello syndrome (disorder)1CTD_human
TgeneBRAFC0596263Carcinogenesis1CTD_human
TgeneBRAFC0920269Microsatellite Instability1CTD_human
TgeneBRAFC2239176Liver carcinoma1CTD_human