FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 18700

FusionGeneSummary for KIAA1430_CCDC110

check button Fusion gene summary
Fusion gene informationFusion gene name: KIAA1430_CCDC110
Fusion gene ID: 18700
HgeneTgene
Gene symbol

KIAA1430

CCDC110

Gene ID

57587

256309

Gene namecilia and flagella associated protein 97coiled-coil domain containing 110
SynonymsKIAA1430|hmwCT52|KM-HN-1|KMHN1
Cytomap

4q35.1

4q35.1

Type of geneprotein-codingprotein-coding
Descriptioncilia- and flagella-associated protein 97coiled-coil domain-containing protein 110cancer/testis antigen 52cancer/testis antigen KM-HN-1
Modification date2018051920180519
UniProtAcc

Q8TBZ0

Ensembl transtripts involved in fusion geneENST00000458385, ENST00000514798, 
ENST00000296775, ENST00000502992, 
ENST00000393540, ENST00000307588, 
ENST00000510617, ENST00000507501, 
Fusion gene scores* DoF score2 X 2 X 2=83 X 4 X 3=36
# samples 34
** MAII scorelog2(3/8*10)=1.90689059560852log2(4/36*10)=0.15200309344505
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: KIAA1430 [Title/Abstract] AND CCDC110 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBRCATCGA-E2-A15E-01AKIAA1430chr4

186096940

-CCDC110chr4

186384203

-
TCGARVBRCATCGA-E2-A15E-06AKIAA1430chr4

186096940

-CCDC110chr4

186383862

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shiftENST00000458385ENST00000393540KIAA1430chr4

186096940

-CCDC110chr4

186384203

-
Frame-shiftENST00000458385ENST00000307588KIAA1430chr4

186096940

-CCDC110chr4

186384203

-
Frame-shiftENST00000458385ENST00000510617KIAA1430chr4

186096940

-CCDC110chr4

186384203

-
5CDS-5UTRENST00000458385ENST00000507501KIAA1430chr4

186096940

-CCDC110chr4

186384203

-
In-frameENST00000514798ENST00000393540KIAA1430chr4

186096940

-CCDC110chr4

186384203

-
In-frameENST00000514798ENST00000307588KIAA1430chr4

186096940

-CCDC110chr4

186384203

-
In-frameENST00000514798ENST00000510617KIAA1430chr4

186096940

-CCDC110chr4

186384203

-
5CDS-5UTRENST00000514798ENST00000507501KIAA1430chr4

186096940

-CCDC110chr4

186384203

-
Frame-shiftENST00000296775ENST00000393540KIAA1430chr4

186096940

-CCDC110chr4

186384203

-
Frame-shiftENST00000296775ENST00000307588KIAA1430chr4

186096940

-CCDC110chr4

186384203

-
Frame-shiftENST00000296775ENST00000510617KIAA1430chr4

186096940

-CCDC110chr4

186384203

-
5CDS-5UTRENST00000296775ENST00000507501KIAA1430chr4

186096940

-CCDC110chr4

186384203

-
intron-3CDSENST00000502992ENST00000393540KIAA1430chr4

186096940

-CCDC110chr4

186384203

-
intron-3CDSENST00000502992ENST00000307588KIAA1430chr4

186096940

-CCDC110chr4

186384203

-
intron-3CDSENST00000502992ENST00000510617KIAA1430chr4

186096940

-CCDC110chr4

186384203

-
intron-5UTRENST00000502992ENST00000507501KIAA1430chr4

186096940

-CCDC110chr4

186384203

-
Frame-shiftENST00000458385ENST00000393540KIAA1430chr4

186096940

-CCDC110chr4

186383862

-
Frame-shiftENST00000458385ENST00000307588KIAA1430chr4

186096940

-CCDC110chr4

186383862

-
Frame-shiftENST00000458385ENST00000510617KIAA1430chr4

186096940

-CCDC110chr4

186383862

-
5CDS-5UTRENST00000458385ENST00000507501KIAA1430chr4

186096940

-CCDC110chr4

186383862

-
Frame-shiftENST00000514798ENST00000393540KIAA1430chr4

186096940

-CCDC110chr4

186383862

-
Frame-shiftENST00000514798ENST00000307588KIAA1430chr4

186096940

-CCDC110chr4

186383862

-
Frame-shiftENST00000514798ENST00000510617KIAA1430chr4

186096940

-CCDC110chr4

186383862

-
5CDS-5UTRENST00000514798ENST00000507501KIAA1430chr4

186096940

-CCDC110chr4

186383862

-
Frame-shiftENST00000296775ENST00000393540KIAA1430chr4

186096940

-CCDC110chr4

186383862

-
Frame-shiftENST00000296775ENST00000307588KIAA1430chr4

186096940

-CCDC110chr4

186383862

-
Frame-shiftENST00000296775ENST00000510617KIAA1430chr4

186096940

-CCDC110chr4

186383862

-
5CDS-5UTRENST00000296775ENST00000507501KIAA1430chr4

186096940

-CCDC110chr4

186383862

-
intron-3CDSENST00000502992ENST00000393540KIAA1430chr4

186096940

-CCDC110chr4

186383862

-
intron-3CDSENST00000502992ENST00000307588KIAA1430chr4

186096940

-CCDC110chr4

186383862

-
intron-3CDSENST00000502992ENST00000510617KIAA1430chr4

186096940

-CCDC110chr4

186383862

-
intron-5UTRENST00000502992ENST00000507501KIAA1430chr4

186096940

-CCDC110chr4

186383862

-

Top

FusionProtFeatures for KIAA1430_CCDC110


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
KIAA1430

CCDC110

Q8TBZ0

Lectin that binds to various sugars: galactose > mannose= fucose > N-acetylglucosamine > N-acetylgalactosamine(PubMed:10224141). Acts as a chemoattractant, probably involved inthe regulation of cell migration (PubMed:28301481).{ECO:0000269|PubMed:10224141, ECO:0000269|PubMed:28301481}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for KIAA1430_CCDC110


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_KIAA1430_ENST00000514798_chr4_186096940_-_CCDC110_ENST00000393540_chr4_186384203_-_758aa
NMAAXQNQKIKSNHNQHXKSFSSSWNHFRLCECRLCRMSACLQRIKKKTFLWRKVIILRIPRHFIQWKKNXVVIVXTVSLKVXMFHPRYI
PRTHXLXELQQTIYLQTXLYTLQKILTSXRIIITFIVFYLLHLQMXCLKLIQXFWINPKLLCLFSSMDFVKIXMTFAILSNKXKKSFKSH
MMGKWHLQMNFRLYKLIQMFTGMVNMTCPLFTRIKXTLLRKKTWTVTXMKIXNQREFQNXRHXXRNYSPSGKLCQNSMCIFVENVKSYLR
VKCTGERKMRKTIKKFPSLAKILQIXNSIPEFQDTHCPSSTKQNMKXKTKKDNHFXXNKDQXYLKMRKLPKLIPLLSSVLQKFSTYRITX
KNLCRYRKKXWNWRVKIXTLSPKXNLLSLPHNLSYRKLKHMKSNLRIWLKKRVLFSLSXVKQKNTAKSVLKNLKKXLVNIMFCKAKIKLX
RKKIYNFLXRSNKXWKHXINXKVRNTKLKVIWPLXIMKIIEXVXKWKQXKPIFCXYKMKKKCXRKKHTSFXKKKAHLEMNXKKASXRXSS
XKRKKDWQKRNKRHFFKXXKQLKMKNSTLKQHYKNLLLPDKLWKEKLRIFKPTNLLPKRIFCKKXKMQNQKQVFIRIACQKLARNVKCYQ
KWXWKPKQIIRFXKKNXRNIVKKIXNLKTASVDLLKTKYFXKITXEAXKMKGIPWNLRCGIFNENIXVXVIKFVISIMTLQKQLTFQEER

>In-frame_KIAA1430_ENST00000514798_chr4_186096940_-_CCDC110_ENST00000307588_chr4_186384203_-_795aa
NMAAXQNQKIKSNHNQHXKSFSSSWNHFRLCECRLCRMSAWYSRKSVKYXTKVLLKXKTHNLAQKKIWCLARALKRICLQRIKKKTFLWR
KVIILRIPRHFIQWKKNXVVIVXTVSLKVXMFHPRYIPRTHXLXELQQTIYLQTXLYTLQKILTSXRIIITFIVFYLLHLQMXCLKLIQX
FWINPKLLCLFSSMDFVKIXMTFAILSNKXKKSFKSHMMGKWHLQMNFRLYKLIQMFTGMVNMTCPLFTRIKXTLLRKKTWTVTXMKIXN
QREFQNXRHXXRNYSPSGKLCQNSMCIFVENVKSYLRVKCTGERKMRKTIKKFPSLAKILQIXNSIPEFQDTHCPSSTKQNMKXKTKKDN
HFXXNKDQXYLKMRKLPKLIPLLSSVLQKFSTYRITXKNLCRYRKKXWNWRVKIXTLSPKXNLLSLPHNLSYRKLKHMKSNLRIWLKKRV
LFSLSXVKQKNTAKSVLKNLKKXLVNIMFCKAKIKLXRKKIYNFLXRSNKXWKHXINXKVRNTKLKVIWPLXIMKIIEXVXKWKQXKPIF
CXYKMKKKCXRKKHTSFXKKKAHLEMNXKKASXRXSSXKRKKDWQKRNKRHFFKXXKQLKMKNSTLKQHYKNLLLPDKLWKEKLRIFKPT
NLLPKRIFCKKXKMQNQKQVFIRIACQKLARNVKCYQKWXWKPKQIIRFXKKNXRNIVKKIXNLKTASVDLLKTKYFXKITXEAXKMKGI

>In-frame_KIAA1430_ENST00000514798_chr4_186096940_-_CCDC110_ENST00000510617_chr4_186384203_-_798aa
NMAAXQNQKIKSNHNQHXKSFSSSWNHFRLCECRLCRMSAWYSRKSVKYXTKVLLKXKTHNLAQKKIWCLARALKRICLQRIKKKTFLWR
KVIILRIPRHFIQWKKNXVVIVXTVSLKVXMFHPRYIPRTHXLXELQQTIYLQTXLYTLQKILTSXRIIITFIVFYLLHLQMXCLKLIQX
FWINPKLLCLFSSMDFVKIXMTFAILSNKXKKSFKSHMMGKWHLQMNFRLYKLIQMFTGMVNMTCPLFTRIKXTLLRKKTWTVTXMKIXN
QREFQNXRHXXRNYSPSGKLCQNSMCIFVENVKSYLRVKCTGERKMRKTIKKFPSLAKILQIXNSIPEFQDTHCPSSTKQNMKXKTKKDN
HFXXNKDQXYLKMRKLPKLIPLLSSVLQKFSTYRITXKNLCRYRKKXWNWRVKIXTLSPKXNLLSLPHNLSYRKLKHMKSNLRIWLKKRV
LFSLSXVKQKNTAKSVLKNLKKXLVNIMFCKAKIKLXRKKIYNFLXRSNKXWKHXINXKVRNTKLKVIWPLXIMKIIEXVXKWKQXKPIF
CXYKMKKKCXRKKHTSFXKKKAHLEMNXKKASXRXSSXKRKKDWQKRNKRHFFKXXKQLKMKNSTLKQHYKNLLLPDKLWKEKLRIFKPT
NLLPKRIFCKKXKMQNQKQVFIRIACQKLARNVKCYQKWXWKPKQIIRFXKKNXRNIVKKIXNLKTASVDLLKTKYFXKITXEAXKMKGI


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_KIAA1430_ENST00000514798_chr4_186096940_-_CCDC110_ENST00000393540_chr4_186384203_-_2276nt
AATATGGCTGCATAGCAGAATCAGAAAATCAAATCCAACCACAATCAGCATTGAAAGTCCTTCAGCAGCAGTTGGAATCATTTCAGGCTT
TGCGAATGCAGACTTTGCAGAATGTCAGCATGCCTACAGAGAATCAAGAAGAAAACCTTTCTATGGAGAAAAGTCATCATTTTGAGGATT
CCAAGACACTTCATTCAGTGGAAGAAAAATTAAGTGGTGATAGTGTGAACAGTCTCCCTCAAAGTGTAAATGTTCCATCCCAGATACATT
CCGAGGACACATTAACTCTGAGAACTTCAACAGACAATTTATCTTCAAACATAATTATACACCCTTCAGAAAATTCTGACATCTTGAAGA
ATTATAATAACTTTTATCGTTTTCTACCTACTGCACCTCCAAATGTGATGTCTCAAGCTGATACAGTAATTCTGGATAAATCCAAAATTA
CTGTGCCTTTTCTCAAGCATGGATTTTGTGAAAATTTAGATGACATTTGCCATTCTATCAAACAAATGAAAGAAGAGCTTCAAAAGTCAC
ATGATGGGGAAGTGGCACTTACAAATGAACTTCAGACTTTACAAACTGATCCAGATGTTCACAGGAATGGTAAATATGACATGTCCCCTA
TTCACCAGGATAAAATGAACTTTATTAAGGAAGAAAACTTGGACGGTAACTTAAATGAAGATATAAAATCAAAGAGAATTTCAGAATTAG
AGGCATTAGTGAAGAAATTACTCCCCTTCAGGGAAACTGTGTCAAAATTCCATGTGCATTTTTGTAGAAAATGTAAAAAGTTATCTAAGA
GTGAAATGCACAGGGGAAAGAAAAATGAGAAAAACAATAAAGAAATTCCCATCACTGGCAAAAATATTACAGATTTAAAATTCCATTCCA
GAGTTCCAAGATACACACTGTCCTTCCTCGACCAAACAAAACATGAAATGAAAGACAAAGAAAGACAACCATTTCTAGTAAAACAAGGAT
CAATAATATCTGAAAATGAGAAAACTTCCAAAGTTAATTCCGTTACTGAGCAGTGTGTTGCAAAAATTCAGTACTTACAGAATTACCTAA
AAGAATCTGTGCAGATACAGAAAAAAGTAATGGAACTGGAGAGTGAAAATCTAAACCTTAAGTCCAAAATGAAACCTCTTATCTTTACCA
CACAATCTCTCATACAGAAAGTTGAAACATATGAAAAGCAACTTAAGAATCTGGTTGAAGAAAAGAGTACTATTCAGTCTAAGTTAAGTA
AAACAGAAGAATACAGCAAAGAGTGTCTTAAAGAATTTAAAAAAATAATTAGTAAATATAATGTTCTGCAAGGCCAAAATAAAACTCTAG
AGGAAAAAAATATACAACTTTCTTTAGAGAAGCAACAAATGATGGAAGCATTAGATCAACTAAAAAGTAAGGAACACAAAACTCAAAGTG
ATATGGCCATTGTAAATAATGAAAATAATCGAATGAGTATAGAAATGGAAGCAATGAAAACCAATATTCTGTTGATACAAGATGAAAAAG
AAATGTTAGAGAAAAAAACACACCAGCTTCTAAAAGAAAAAAGCTCACTTGGAAATGAACTAAAAGAAAGCCAGCTAGAGATAATCCAGC
TAAAAGAGAAAGAAAGATTGGCAAAAACGGAACAAGAGACACTTCTTCAAATAATAGAAACAGTTAAAGATGAAAAACTCAACCTTGAAA
CAACATTACAAGAATCTACTGCTGCCAGACAAATTATGGAAAGAGAAATTGAGAATATTCAAACCTACCAATCTACTGCCGAAGAGAATT
TTCTGCAAGAAATAAAAAATGCAAAATCAGAAGCAAGTATTTATAAGAATAGCTTGTCAGAAATTGGCAAGGAATGTGAAATGTTATCAA
AAATGGTAATGGAAACCAAAACAGATAATCAGATTCTAAAAGAAGAACTAAAGAAACATAGTCAAGAAAATATAAAATTTGAAAACAGCA
TCAGTAGACTTACTGAAGACAAAATACTTTTAGAAAATTACGTAAGAAGCATAGAAAATGAAAGGGATACCTTGGAATTTGAGATGCGGC
ATCTTCAACGAGAATATTTAAGTTTAAGTGATAAAATTTGTAATCAGCATAATGACCCTTCAAAAACAACTTACATTTCAAGAAGAGAGA
AATTCCATTTTGACAACTATACTCACGAAGATACTTCTAGTCCTCAGAGTAGGCCTTTGGCTTCGGATTTGAAAGGTTATTTCAAAGTTA

>In-frame_KIAA1430_ENST00000514798_chr4_186096940_-_CCDC110_ENST00000307588_chr4_186384203_-_2387nt
AATATGGCTGCATAGCAGAATCAGAAAATCAAATCCAACCACAATCAGCATTGAAAGTCCTTCAGCAGCAGTTGGAATCATTTCAGGCTT
TGCGAATGCAGACTTTGCAGAATGTCAGCATGGTACAGTCGGAAATCAGTGAAATATTGAACAAAAGTATTATTGAAGTAGAAAACCCAC
AATTTAGCTCAGAAAAAAATCTGGTGTTTGGCACGCGCATTGAAAAGGATTTGCCTACAGAGAATCAAGAAGAAAACCTTTCTATGGAGA
AAAGTCATCATTTTGAGGATTCCAAGACACTTCATTCAGTGGAAGAAAAATTAAGTGGTGATAGTGTGAACAGTCTCCCTCAAAGTGTAA
ATGTTCCATCCCAGATACATTCCGAGGACACATTAACTCTGAGAACTTCAACAGACAATTTATCTTCAAACATAATTATACACCCTTCAG
AAAATTCTGACATCTTGAAGAATTATAATAACTTTTATCGTTTTCTACCTACTGCACCTCCAAATGTGATGTCTCAAGCTGATACAGTAA
TTCTGGATAAATCCAAAATTACTGTGCCTTTTCTCAAGCATGGATTTTGTGAAAATTTAGATGACATTTGCCATTCTATCAAACAAATGA
AAGAAGAGCTTCAAAAGTCACATGATGGGGAAGTGGCACTTACAAATGAACTTCAGACTTTACAAACTGATCCAGATGTTCACAGGAATG
GTAAATATGACATGTCCCCTATTCACCAGGATAAAATGAACTTTATTAAGGAAGAAAACTTGGACGGTAACTTAAATGAAGATATAAAAT
CAAAGAGAATTTCAGAATTAGAGGCATTAGTGAAGAAATTACTCCCCTTCAGGGAAACTGTGTCAAAATTCCATGTGCATTTTTGTAGAA
AATGTAAAAAGTTATCTAAGAGTGAAATGCACAGGGGAAAGAAAAATGAGAAAAACAATAAAGAAATTCCCATCACTGGCAAAAATATTA
CAGATTTAAAATTCCATTCCAGAGTTCCAAGATACACACTGTCCTTCCTCGACCAAACAAAACATGAAATGAAAGACAAAGAAAGACAAC
CATTTCTAGTAAAACAAGGATCAATAATATCTGAAAATGAGAAAACTTCCAAAGTTAATTCCGTTACTGAGCAGTGTGTTGCAAAAATTC
AGTACTTACAGAATTACCTAAAAGAATCTGTGCAGATACAGAAAAAAGTAATGGAACTGGAGAGTGAAAATCTAAACCTTAAGTCCAAAA
TGAAACCTCTTATCTTTACCACACAATCTCTCATACAGAAAGTTGAAACATATGAAAAGCAACTTAAGAATCTGGTTGAAGAAAAGAGTA
CTATTCAGTCTAAGTTAAGTAAAACAGAAGAATACAGCAAAGAGTGTCTTAAAGAATTTAAAAAAATAATTAGTAAATATAATGTTCTGC
AAGGCCAAAATAAAACTCTAGAGGAAAAAAATATACAACTTTCTTTAGAGAAGCAACAAATGATGGAAGCATTAGATCAACTAAAAAGTA
AGGAACACAAAACTCAAAGTGATATGGCCATTGTAAATAATGAAAATAATCGAATGAGTATAGAAATGGAAGCAATGAAAACCAATATTC
TGTTGATACAAGATGAAAAAGAAATGTTAGAGAAAAAAACACACCAGCTTCTAAAAGAAAAAAGCTCACTTGGAAATGAACTAAAAGAAA
GCCAGCTAGAGATAATCCAGCTAAAAGAGAAAGAAAGATTGGCAAAAACGGAACAAGAGACACTTCTTCAAATAATAGAAACAGTTAAAG
ATGAAAAACTCAACCTTGAAACAACATTACAAGAATCTACTGCTGCCAGACAAATTATGGAAAGAGAAATTGAGAATATTCAAACCTACC
AATCTACTGCCGAAGAGAATTTTCTGCAAGAAATAAAAAATGCAAAATCAGAAGCAAGTATTTATAAGAATAGCTTGTCAGAAATTGGCA
AGGAATGTGAAATGTTATCAAAAATGGTAATGGAAACCAAAACAGATAATCAGATTCTAAAAGAAGAACTAAAGAAACATAGTCAAGAAA
ATATAAAATTTGAAAACAGCATCAGTAGACTTACTGAAGACAAAATACTTTTAGAAAATTACGTAAGAAGCATAGAAAATGAAAGGGATA
CCTTGGAATTTGAGATGCGGCATCTTCAACGAGAATATTTAAGTTTAAGTGATAAAATTTGTAATCAGCATAATGACCCTTCAAAAACAA
CTTACATTTCAAGAAGAGAGAAATTCCATTTTGACAACTATACTCACGAAGATACTTCTAGTCCTCAGAGTAGGCCTTTGGCTTCGGATT

>In-frame_KIAA1430_ENST00000514798_chr4_186096940_-_CCDC110_ENST00000510617_chr4_186384203_-_2396nt
AATATGGCTGCATAGCAGAATCAGAAAATCAAATCCAACCACAATCAGCATTGAAAGTCCTTCAGCAGCAGTTGGAATCATTTCAGGCTT
TGCGAATGCAGACTTTGCAGAATGTCAGCATGGTACAGTCGGAAATCAGTGAAATATTGAACAAAAGTATTATTGAAGTAGAAAACCCAC
AATTTAGCTCAGAAAAAAATCTGGTGTTTGGCACGCGCATTGAAAAGGATTTGCCTACAGAGAATCAAGAAGAAAACCTTTCTATGGAGA
AAAGTCATCATTTTGAGGATTCCAAGACACTTCATTCAGTGGAAGAAAAATTAAGTGGTGATAGTGTGAACAGTCTCCCTCAAAGTGTAA
ATGTTCCATCCCAGATACATTCCGAGGACACATTAACTCTGAGAACTTCAACAGACAATTTATCTTCAAACATAATTATACACCCTTCAG
AAAATTCTGACATCTTGAAGAATTATAATAACTTTTATCGTTTTCTACCTACTGCACCTCCAAATGTGATGTCTCAAGCTGATACAGTAA
TTCTGGATAAATCCAAAATTACTGTGCCTTTTCTCAAGCATGGATTTTGTGAAAATTTAGATGACATTTGCCATTCTATCAAACAAATGA
AAGAAGAGCTTCAAAAGTCACATGATGGGGAAGTGGCACTTACAAATGAACTTCAGACTTTACAAACTGATCCAGATGTTCACAGGAATG
GTAAATATGACATGTCCCCTATTCACCAGGATAAAATGAACTTTATTAAGGAAGAAAACTTGGACGGTAACTTAAATGAAGATATAAAAT
CAAAGAGAATTTCAGAATTAGAGGCATTAGTGAAGAAATTACTCCCCTTCAGGGAAACTGTGTCAAAATTCCATGTGCATTTTTGTAGAA
AATGTAAAAAGTTATCTAAGAGTGAAATGCACAGGGGAAAGAAAAATGAGAAAAACAATAAAGAAATTCCCATCACTGGCAAAAATATTA
CAGATTTAAAATTCCATTCCAGAGTTCCAAGATACACACTGTCCTTCCTCGACCAAACAAAACATGAAATGAAAGACAAAGAAAGACAAC
CATTTCTAGTAAAACAAGGATCAATAATATCTGAAAATGAGAAAACTTCCAAAGTTAATTCCGTTACTGAGCAGTGTGTTGCAAAAATTC
AGTACTTACAGAATTACCTAAAAGAATCTGTGCAGATACAGAAAAAAGTAATGGAACTGGAGAGTGAAAATCTAAACCTTAAGTCCAAAA
TGAAACCTCTTATCTTTACCACACAATCTCTCATACAGAAAGTTGAAACATATGAAAAGCAACTTAAGAATCTGGTTGAAGAAAAGAGTA
CTATTCAGTCTAAGTTAAGTAAAACAGAAGAATACAGCAAAGAGTGTCTTAAAGAATTTAAAAAAATAATTAGTAAATATAATGTTCTGC
AAGGCCAAAATAAAACTCTAGAGGAAAAAAATATACAACTTTCTTTAGAGAAGCAACAAATGATGGAAGCATTAGATCAACTAAAAAGTA
AGGAACACAAAACTCAAAGTGATATGGCCATTGTAAATAATGAAAATAATCGAATGAGTATAGAAATGGAAGCAATGAAAACCAATATTC
TGTTGATACAAGATGAAAAAGAAATGTTAGAGAAAAAAACACACCAGCTTCTAAAAGAAAAAAGCTCACTTGGAAATGAACTAAAAGAAA
GCCAGCTAGAGATAATCCAGCTAAAAGAGAAAGAAAGATTGGCAAAAACGGAACAAGAGACACTTCTTCAAATAATAGAAACAGTTAAAG
ATGAAAAACTCAACCTTGAAACAACATTACAAGAATCTACTGCTGCCAGACAAATTATGGAAAGAGAAATTGAGAATATTCAAACCTACC
AATCTACTGCCGAAGAGAATTTTCTGCAAGAAATAAAAAATGCAAAATCAGAAGCAAGTATTTATAAGAATAGCTTGTCAGAAATTGGCA
AGGAATGTGAAATGTTATCAAAAATGGTAATGGAAACCAAAACAGATAATCAGATTCTAAAAGAAGAACTAAAGAAACATAGTCAAGAAA
ATATAAAATTTGAAAACAGCATCAGTAGACTTACTGAAGACAAAATACTTTTAGAAAATTACGTAAGAAGCATAGAAAATGAAAGGGATA
CCTTGGAATTTGAGATGCGGCATCTTCAACGAGAATATTTAAGTTTAAGTGATAAAATTTGTAATCAGCATAATGACCCTTCAAAAACAA
CTTACATTTCAAGAAGAGAGAAATTCCATTTTGACAACTATACTCACGAAGATACTTCTAGTCCTCAGAGTAGGCCTTTGGCTTCGGATT


* Fusion transcript sequences (Full-length transcript).
>In-frame_KIAA1430_ENST00000514798_chr4_186096940_-_CCDC110_ENST00000393540_chr4_186384203_-_4176nt
CACGCCGCCCCTCCTTTCCCTTTCCGCTCTCTCCGCCTCCGGAAGCGCGGGCGCGCGGCGCCGGGAGCCCGTTCAGGGCCGCGGGAGTGC
GCCAGCGCCGCGCGTGGGGCTGTGGTGGCCGCGGCTCTCAGGTGAGGGGCGCGCGAGCGGCTCCTGGCTCCCTGCTCGCGGGGCGCCCGC
CACGCTCCTTTCCGTTCGCATCCGTCTCCCCGCTCCGGAGCCCAGGCGGCGGCGAGTACTCGGGATATATTTTTGCCATCATGGATCAGT
TTGGAGATATATTAGAAGGTGAAGTGGACCATTCTTTCTTTGACAGTGACTTTGAAGAAGGAAAGAAATGTGAAACTAACTCAGTTTTTG
ACAAGCAAAATGATGACCCAAAGGAAAGAATAGATAAAGATACAAAAAATGTAAATTCGAACACTGGAATGCAAACAACAGAAAATTATC
TTACTGAGAAGGGAAATGAAAGAAACGTGAAATTTCCCCCAGAACACCCCGTAGAGAATGATGTTACACAAACTGTAAGTTCTTTCTCAT
TGCCAGCCTCTTCAAGATCAAAAAAATTGTGTGATGTTACAACAGGACTTAAAATACACGTGTCCATTCCAAATAGAATTCCCAAAATTG
TAAAAGAAGGTGAAGATGATTACTACACAGATGGAGAGGAAAGCAGTGATGATGGGAAGAAATACCATGTGAAGTCCAAGTCCGCTAAAC
CATCTACTAACGTTAAAAAAAGCATAAGGAAAAAGTATTGCAAAGTTAGCTCCTCTTCCTCCTCCTCTTTATCTTCCTCATCTTCAGGTT
CAGGTACAGATTGTTTAGATGCAGGGTCTGATAGCCATCTATCTGATTCGTCTCCGTCATCTAAGTCATCTAAGAAACATGTATCTGGTA
TAACCCTCCTGTCACCAAAACACAAGTATAAATCAGGAATAAAATCGACAGAAACACAGCCTTCAAGTACTACACCAAAATGTGGCCACT
ACCCTGAGGAGTCTGAAGATACTGTGACTGACGTAAGTCCCTTATCAACTCCAGACATTAGCCCTCTTCAGTCTTTTGAACTGGGCATAG
CAAATGATCAAAAAGTGAAAATTAAAAAGCAAGAAAATGTGAGCCAAGAAATATATGAAGATGTTGAGGATTTGAAAAATAATTCAAAAT
ATTTGAAAGCAGCCAAAAAAGGGAAAGAAAAACATGAGCCTGATGTCTCCTCAAAGTCGTCTTCAGTGTTAGACTCCAGTTTAGACCACA
GACATAAACAGAAAGTCTTACATGACACAATGGATCTGAATCATCTCTTGAAAGCTTTTCTGCAATTAGATAAAAAAGGACCACAAAAAC
ATCACTTTGATCAGCCTTCAGTAGCACCCGGGAAAAACTACTCTTTCACAAGAGAAGAGGTGAGACAGATCGATCGGGAAAATCAGAGGC
TTTTGAAAGAACTGTCAAGACAGGCGGAAAAGCCGGGAAGCAAAAGTACAATTCCTAGATCGGCTGATCATCCCCCAAAGTTATATCACA
GTGCTCTCAACAGACAGAAGGAACAACAAAGGATTGAGAGAGAAAACTTGAATATGGCTGCATAGCAGAATCAGAAAATCAAATCCAACC
ACAATCAGCATTGAAAGTCCTTCAGCAGCAGTTGGAATCATTTCAGGCTTTGCGAATGCAGACTTTGCAGAATGTCAGCATGCCTACAGA
GAATCAAGAAGAAAACCTTTCTATGGAGAAAAGTCATCATTTTGAGGATTCCAAGACACTTCATTCAGTGGAAGAAAAATTAAGTGGTGA
TAGTGTGAACAGTCTCCCTCAAAGTGTAAATGTTCCATCCCAGATACATTCCGAGGACACATTAACTCTGAGAACTTCAACAGACAATTT
ATCTTCAAACATAATTATACACCCTTCAGAAAATTCTGACATCTTGAAGAATTATAATAACTTTTATCGTTTTCTACCTACTGCACCTCC
AAATGTGATGTCTCAAGCTGATACAGTAATTCTGGATAAATCCAAAATTACTGTGCCTTTTCTCAAGCATGGATTTTGTGAAAATTTAGA
TGACATTTGCCATTCTATCAAACAAATGAAAGAAGAGCTTCAAAAGTCACATGATGGGGAAGTGGCACTTACAAATGAACTTCAGACTTT
ACAAACTGATCCAGATGTTCACAGGAATGGTAAATATGACATGTCCCCTATTCACCAGGATAAAATGAACTTTATTAAGGAAGAAAACTT
GGACGGTAACTTAAATGAAGATATAAAATCAAAGAGAATTTCAGAATTAGAGGCATTAGTGAAGAAATTACTCCCCTTCAGGGAAACTGT
GTCAAAATTCCATGTGCATTTTTGTAGAAAATGTAAAAAGTTATCTAAGAGTGAAATGCACAGGGGAAAGAAAAATGAGAAAAACAATAA
AGAAATTCCCATCACTGGCAAAAATATTACAGATTTAAAATTCCATTCCAGAGTTCCAAGATACACACTGTCCTTCCTCGACCAAACAAA
ACATGAAATGAAAGACAAAGAAAGACAACCATTTCTAGTAAAACAAGGATCAATAATATCTGAAAATGAGAAAACTTCCAAAGTTAATTC
CGTTACTGAGCAGTGTGTTGCAAAAATTCAGTACTTACAGAATTACCTAAAAGAATCTGTGCAGATACAGAAAAAAGTAATGGAACTGGA
GAGTGAAAATCTAAACCTTAAGTCCAAAATGAAACCTCTTATCTTTACCACACAATCTCTCATACAGAAAGTTGAAACATATGAAAAGCA
ACTTAAGAATCTGGTTGAAGAAAAGAGTACTATTCAGTCTAAGTTAAGTAAAACAGAAGAATACAGCAAAGAGTGTCTTAAAGAATTTAA
AAAAATAATTAGTAAATATAATGTTCTGCAAGGCCAAAATAAAACTCTAGAGGAAAAAAATATACAACTTTCTTTAGAGAAGCAACAAAT
GATGGAAGCATTAGATCAACTAAAAAGTAAGGAACACAAAACTCAAAGTGATATGGCCATTGTAAATAATGAAAATAATCGAATGAGTAT
AGAAATGGAAGCAATGAAAACCAATATTCTGTTGATACAAGATGAAAAAGAAATGTTAGAGAAAAAAACACACCAGCTTCTAAAAGAAAA
AAGCTCACTTGGAAATGAACTAAAAGAAAGCCAGCTAGAGATAATCCAGCTAAAAGAGAAAGAAAGATTGGCAAAAACGGAACAAGAGAC
ACTTCTTCAAATAATAGAAACAGTTAAAGATGAAAAACTCAACCTTGAAACAACATTACAAGAATCTACTGCTGCCAGACAAATTATGGA
AAGAGAAATTGAGAATATTCAAACCTACCAATCTACTGCCGAAGAGAATTTTCTGCAAGAAATAAAAAATGCAAAATCAGAAGCAAGTAT
TTATAAGAATAGCTTGTCAGAAATTGGCAAGGAATGTGAAATGTTATCAAAAATGGTAATGGAAACCAAAACAGATAATCAGATTCTAAA
AGAAGAACTAAAGAAACATAGTCAAGAAAATATAAAATTTGAAAACAGCATCAGTAGACTTACTGAAGACAAAATACTTTTAGAAAATTA
CGTAAGAAGCATAGAAAATGAAAGGGATACCTTGGAATTTGAGATGCGGCATCTTCAACGAGAATATTTAAGTTTAAGTGATAAAATTTG
TAATCAGCATAATGACCCTTCAAAAACAACTTACATTTCAAGAAGAGAGAAATTCCATTTTGACAACTATACTCACGAAGATACTTCTAG
TCCTCAGAGTAGGCCTTTGGCTTCGGATTTGAAAGGTTATTTCAAAGTTAAAGACAGAACTCTCAAGCATCATTAGGATTCCTCAAGATT
GCTAAGAAACTCCCTTCGAGAAATAGCCAATGTTAATTGTACTGCTAACTGAACTATGCATATCTAACTCATCTCAAATGACTCATAATG
AGGCGCTATATATTTGCTTTAAAAATTATGCACAGAATGGTTTGGTGCAGATAACTTAAGCTTTCTCAGCTGGGAATTTCAGAAGATGGG
GGAGAACTTCTACAAGGGAGGGCAGGTACCTGTACATGGAAGGAGCTGAGATGTCTAAAGTCACCCACATTTGTCATTTAAAAAAGTATA

>In-frame_KIAA1430_ENST00000514798_chr4_186096940_-_CCDC110_ENST00000307588_chr4_186384203_-_4287nt
CACGCCGCCCCTCCTTTCCCTTTCCGCTCTCTCCGCCTCCGGAAGCGCGGGCGCGCGGCGCCGGGAGCCCGTTCAGGGCCGCGGGAGTGC
GCCAGCGCCGCGCGTGGGGCTGTGGTGGCCGCGGCTCTCAGGTGAGGGGCGCGCGAGCGGCTCCTGGCTCCCTGCTCGCGGGGCGCCCGC
CACGCTCCTTTCCGTTCGCATCCGTCTCCCCGCTCCGGAGCCCAGGCGGCGGCGAGTACTCGGGATATATTTTTGCCATCATGGATCAGT
TTGGAGATATATTAGAAGGTGAAGTGGACCATTCTTTCTTTGACAGTGACTTTGAAGAAGGAAAGAAATGTGAAACTAACTCAGTTTTTG
ACAAGCAAAATGATGACCCAAAGGAAAGAATAGATAAAGATACAAAAAATGTAAATTCGAACACTGGAATGCAAACAACAGAAAATTATC
TTACTGAGAAGGGAAATGAAAGAAACGTGAAATTTCCCCCAGAACACCCCGTAGAGAATGATGTTACACAAACTGTAAGTTCTTTCTCAT
TGCCAGCCTCTTCAAGATCAAAAAAATTGTGTGATGTTACAACAGGACTTAAAATACACGTGTCCATTCCAAATAGAATTCCCAAAATTG
TAAAAGAAGGTGAAGATGATTACTACACAGATGGAGAGGAAAGCAGTGATGATGGGAAGAAATACCATGTGAAGTCCAAGTCCGCTAAAC
CATCTACTAACGTTAAAAAAAGCATAAGGAAAAAGTATTGCAAAGTTAGCTCCTCTTCCTCCTCCTCTTTATCTTCCTCATCTTCAGGTT
CAGGTACAGATTGTTTAGATGCAGGGTCTGATAGCCATCTATCTGATTCGTCTCCGTCATCTAAGTCATCTAAGAAACATGTATCTGGTA
TAACCCTCCTGTCACCAAAACACAAGTATAAATCAGGAATAAAATCGACAGAAACACAGCCTTCAAGTACTACACCAAAATGTGGCCACT
ACCCTGAGGAGTCTGAAGATACTGTGACTGACGTAAGTCCCTTATCAACTCCAGACATTAGCCCTCTTCAGTCTTTTGAACTGGGCATAG
CAAATGATCAAAAAGTGAAAATTAAAAAGCAAGAAAATGTGAGCCAAGAAATATATGAAGATGTTGAGGATTTGAAAAATAATTCAAAAT
ATTTGAAAGCAGCCAAAAAAGGGAAAGAAAAACATGAGCCTGATGTCTCCTCAAAGTCGTCTTCAGTGTTAGACTCCAGTTTAGACCACA
GACATAAACAGAAAGTCTTACATGACACAATGGATCTGAATCATCTCTTGAAAGCTTTTCTGCAATTAGATAAAAAAGGACCACAAAAAC
ATCACTTTGATCAGCCTTCAGTAGCACCCGGGAAAAACTACTCTTTCACAAGAGAAGAGGTGAGACAGATCGATCGGGAAAATCAGAGGC
TTTTGAAAGAACTGTCAAGACAGGCGGAAAAGCCGGGAAGCAAAAGTACAATTCCTAGATCGGCTGATCATCCCCCAAAGTTATATCACA
GTGCTCTCAACAGACAGAAGGAACAACAAAGGATTGAGAGAGAAAACTTGAATATGGCTGCATAGCAGAATCAGAAAATCAAATCCAACC
ACAATCAGCATTGAAAGTCCTTCAGCAGCAGTTGGAATCATTTCAGGCTTTGCGAATGCAGACTTTGCAGAATGTCAGCATGGTACAGTC
GGAAATCAGTGAAATATTGAACAAAAGTATTATTGAAGTAGAAAACCCACAATTTAGCTCAGAAAAAAATCTGGTGTTTGGCACGCGCAT
TGAAAAGGATTTGCCTACAGAGAATCAAGAAGAAAACCTTTCTATGGAGAAAAGTCATCATTTTGAGGATTCCAAGACACTTCATTCAGT
GGAAGAAAAATTAAGTGGTGATAGTGTGAACAGTCTCCCTCAAAGTGTAAATGTTCCATCCCAGATACATTCCGAGGACACATTAACTCT
GAGAACTTCAACAGACAATTTATCTTCAAACATAATTATACACCCTTCAGAAAATTCTGACATCTTGAAGAATTATAATAACTTTTATCG
TTTTCTACCTACTGCACCTCCAAATGTGATGTCTCAAGCTGATACAGTAATTCTGGATAAATCCAAAATTACTGTGCCTTTTCTCAAGCA
TGGATTTTGTGAAAATTTAGATGACATTTGCCATTCTATCAAACAAATGAAAGAAGAGCTTCAAAAGTCACATGATGGGGAAGTGGCACT
TACAAATGAACTTCAGACTTTACAAACTGATCCAGATGTTCACAGGAATGGTAAATATGACATGTCCCCTATTCACCAGGATAAAATGAA
CTTTATTAAGGAAGAAAACTTGGACGGTAACTTAAATGAAGATATAAAATCAAAGAGAATTTCAGAATTAGAGGCATTAGTGAAGAAATT
ACTCCCCTTCAGGGAAACTGTGTCAAAATTCCATGTGCATTTTTGTAGAAAATGTAAAAAGTTATCTAAGAGTGAAATGCACAGGGGAAA
GAAAAATGAGAAAAACAATAAAGAAATTCCCATCACTGGCAAAAATATTACAGATTTAAAATTCCATTCCAGAGTTCCAAGATACACACT
GTCCTTCCTCGACCAAACAAAACATGAAATGAAAGACAAAGAAAGACAACCATTTCTAGTAAAACAAGGATCAATAATATCTGAAAATGA
GAAAACTTCCAAAGTTAATTCCGTTACTGAGCAGTGTGTTGCAAAAATTCAGTACTTACAGAATTACCTAAAAGAATCTGTGCAGATACA
GAAAAAAGTAATGGAACTGGAGAGTGAAAATCTAAACCTTAAGTCCAAAATGAAACCTCTTATCTTTACCACACAATCTCTCATACAGAA
AGTTGAAACATATGAAAAGCAACTTAAGAATCTGGTTGAAGAAAAGAGTACTATTCAGTCTAAGTTAAGTAAAACAGAAGAATACAGCAA
AGAGTGTCTTAAAGAATTTAAAAAAATAATTAGTAAATATAATGTTCTGCAAGGCCAAAATAAAACTCTAGAGGAAAAAAATATACAACT
TTCTTTAGAGAAGCAACAAATGATGGAAGCATTAGATCAACTAAAAAGTAAGGAACACAAAACTCAAAGTGATATGGCCATTGTAAATAA
TGAAAATAATCGAATGAGTATAGAAATGGAAGCAATGAAAACCAATATTCTGTTGATACAAGATGAAAAAGAAATGTTAGAGAAAAAAAC
ACACCAGCTTCTAAAAGAAAAAAGCTCACTTGGAAATGAACTAAAAGAAAGCCAGCTAGAGATAATCCAGCTAAAAGAGAAAGAAAGATT
GGCAAAAACGGAACAAGAGACACTTCTTCAAATAATAGAAACAGTTAAAGATGAAAAACTCAACCTTGAAACAACATTACAAGAATCTAC
TGCTGCCAGACAAATTATGGAAAGAGAAATTGAGAATATTCAAACCTACCAATCTACTGCCGAAGAGAATTTTCTGCAAGAAATAAAAAA
TGCAAAATCAGAAGCAAGTATTTATAAGAATAGCTTGTCAGAAATTGGCAAGGAATGTGAAATGTTATCAAAAATGGTAATGGAAACCAA
AACAGATAATCAGATTCTAAAAGAAGAACTAAAGAAACATAGTCAAGAAAATATAAAATTTGAAAACAGCATCAGTAGACTTACTGAAGA
CAAAATACTTTTAGAAAATTACGTAAGAAGCATAGAAAATGAAAGGGATACCTTGGAATTTGAGATGCGGCATCTTCAACGAGAATATTT
AAGTTTAAGTGATAAAATTTGTAATCAGCATAATGACCCTTCAAAAACAACTTACATTTCAAGAAGAGAGAAATTCCATTTTGACAACTA
TACTCACGAAGATACTTCTAGTCCTCAGAGTAGGCCTTTGGCTTCGGATTTGAAAGGTTATTTCAAAGTTAAAGACAGAACTCTCAAGCA
TCATTAGGATTCCTCAAGATTGCTAAGAAACTCCCTTCGAGAAATAGCCAATGTTAATTGTACTGCTAACTGAACTATGCATATCTAACT
CATCTCAAATGACTCATAATGAGGCGCTATATATTTGCTTTAAAAATTATGCACAGAATGGTTTGGTGCAGATAACTTAAGCTTTCTCAG
CTGGGAATTTCAGAAGATGGGGGAGAACTTCTACAAGGGAGGGCAGGTACCTGTACATGGAAGGAGCTGAGATGTCTAAAGTCACCCACA

>In-frame_KIAA1430_ENST00000514798_chr4_186096940_-_CCDC110_ENST00000510617_chr4_186384203_-_3996nt
CACGCCGCCCCTCCTTTCCCTTTCCGCTCTCTCCGCCTCCGGAAGCGCGGGCGCGCGGCGCCGGGAGCCCGTTCAGGGCCGCGGGAGTGC
GCCAGCGCCGCGCGTGGGGCTGTGGTGGCCGCGGCTCTCAGGTGAGGGGCGCGCGAGCGGCTCCTGGCTCCCTGCTCGCGGGGCGCCCGC
CACGCTCCTTTCCGTTCGCATCCGTCTCCCCGCTCCGGAGCCCAGGCGGCGGCGAGTACTCGGGATATATTTTTGCCATCATGGATCAGT
TTGGAGATATATTAGAAGGTGAAGTGGACCATTCTTTCTTTGACAGTGACTTTGAAGAAGGAAAGAAATGTGAAACTAACTCAGTTTTTG
ACAAGCAAAATGATGACCCAAAGGAAAGAATAGATAAAGATACAAAAAATGTAAATTCGAACACTGGAATGCAAACAACAGAAAATTATC
TTACTGAGAAGGGAAATGAAAGAAACGTGAAATTTCCCCCAGAACACCCCGTAGAGAATGATGTTACACAAACTGTAAGTTCTTTCTCAT
TGCCAGCCTCTTCAAGATCAAAAAAATTGTGTGATGTTACAACAGGACTTAAAATACACGTGTCCATTCCAAATAGAATTCCCAAAATTG
TAAAAGAAGGTGAAGATGATTACTACACAGATGGAGAGGAAAGCAGTGATGATGGGAAGAAATACCATGTGAAGTCCAAGTCCGCTAAAC
CATCTACTAACGTTAAAAAAAGCATAAGGAAAAAGTATTGCAAAGTTAGCTCCTCTTCCTCCTCCTCTTTATCTTCCTCATCTTCAGGTT
CAGGTACAGATTGTTTAGATGCAGGGTCTGATAGCCATCTATCTGATTCGTCTCCGTCATCTAAGTCATCTAAGAAACATGTATCTGGTA
TAACCCTCCTGTCACCAAAACACAAGTATAAATCAGGAATAAAATCGACAGAAACACAGCCTTCAAGTACTACACCAAAATGTGGCCACT
ACCCTGAGGAGTCTGAAGATACTGTGACTGACGTAAGTCCCTTATCAACTCCAGACATTAGCCCTCTTCAGTCTTTTGAACTGGGCATAG
CAAATGATCAAAAAGTGAAAATTAAAAAGCAAGAAAATGTGAGCCAAGAAATATATGAAGATGTTGAGGATTTGAAAAATAATTCAAAAT
ATTTGAAAGCAGCCAAAAAAGGGAAAGAAAAACATGAGCCTGATGTCTCCTCAAAGTCGTCTTCAGTGTTAGACTCCAGTTTAGACCACA
GACATAAACAGAAAGTCTTACATGACACAATGGATCTGAATCATCTCTTGAAAGCTTTTCTGCAATTAGATAAAAAAGGACCACAAAAAC
ATCACTTTGATCAGCCTTCAGTAGCACCCGGGAAAAACTACTCTTTCACAAGAGAAGAGGTGAGACAGATCGATCGGGAAAATCAGAGGC
TTTTGAAAGAACTGTCAAGACAGGCGGAAAAGCCGGGAAGCAAAAGTACAATTCCTAGATCGGCTGATCATCCCCCAAAGTTATATCACA
GTGCTCTCAACAGACAGAAGGAACAACAAAGGATTGAGAGAGAAAACTTGAATATGGCTGCATAGCAGAATCAGAAAATCAAATCCAACC
ACAATCAGCATTGAAAGTCCTTCAGCAGCAGTTGGAATCATTTCAGGCTTTGCGAATGCAGACTTTGCAGAATGTCAGCATGGTACAGTC
GGAAATCAGTGAAATATTGAACAAAAGTATTATTGAAGTAGAAAACCCACAATTTAGCTCAGAAAAAAATCTGGTGTTTGGCACGCGCAT
TGAAAAGGATTTGCCTACAGAGAATCAAGAAGAAAACCTTTCTATGGAGAAAAGTCATCATTTTGAGGATTCCAAGACACTTCATTCAGT
GGAAGAAAAATTAAGTGGTGATAGTGTGAACAGTCTCCCTCAAAGTGTAAATGTTCCATCCCAGATACATTCCGAGGACACATTAACTCT
GAGAACTTCAACAGACAATTTATCTTCAAACATAATTATACACCCTTCAGAAAATTCTGACATCTTGAAGAATTATAATAACTTTTATCG
TTTTCTACCTACTGCACCTCCAAATGTGATGTCTCAAGCTGATACAGTAATTCTGGATAAATCCAAAATTACTGTGCCTTTTCTCAAGCA
TGGATTTTGTGAAAATTTAGATGACATTTGCCATTCTATCAAACAAATGAAAGAAGAGCTTCAAAAGTCACATGATGGGGAAGTGGCACT
TACAAATGAACTTCAGACTTTACAAACTGATCCAGATGTTCACAGGAATGGTAAATATGACATGTCCCCTATTCACCAGGATAAAATGAA
CTTTATTAAGGAAGAAAACTTGGACGGTAACTTAAATGAAGATATAAAATCAAAGAGAATTTCAGAATTAGAGGCATTAGTGAAGAAATT
ACTCCCCTTCAGGGAAACTGTGTCAAAATTCCATGTGCATTTTTGTAGAAAATGTAAAAAGTTATCTAAGAGTGAAATGCACAGGGGAAA
GAAAAATGAGAAAAACAATAAAGAAATTCCCATCACTGGCAAAAATATTACAGATTTAAAATTCCATTCCAGAGTTCCAAGATACACACT
GTCCTTCCTCGACCAAACAAAACATGAAATGAAAGACAAAGAAAGACAACCATTTCTAGTAAAACAAGGATCAATAATATCTGAAAATGA
GAAAACTTCCAAAGTTAATTCCGTTACTGAGCAGTGTGTTGCAAAAATTCAGTACTTACAGAATTACCTAAAAGAATCTGTGCAGATACA
GAAAAAAGTAATGGAACTGGAGAGTGAAAATCTAAACCTTAAGTCCAAAATGAAACCTCTTATCTTTACCACACAATCTCTCATACAGAA
AGTTGAAACATATGAAAAGCAACTTAAGAATCTGGTTGAAGAAAAGAGTACTATTCAGTCTAAGTTAAGTAAAACAGAAGAATACAGCAA
AGAGTGTCTTAAAGAATTTAAAAAAATAATTAGTAAATATAATGTTCTGCAAGGCCAAAATAAAACTCTAGAGGAAAAAAATATACAACT
TTCTTTAGAGAAGCAACAAATGATGGAAGCATTAGATCAACTAAAAAGTAAGGAACACAAAACTCAAAGTGATATGGCCATTGTAAATAA
TGAAAATAATCGAATGAGTATAGAAATGGAAGCAATGAAAACCAATATTCTGTTGATACAAGATGAAAAAGAAATGTTAGAGAAAAAAAC
ACACCAGCTTCTAAAAGAAAAAAGCTCACTTGGAAATGAACTAAAAGAAAGCCAGCTAGAGATAATCCAGCTAAAAGAGAAAGAAAGATT
GGCAAAAACGGAACAAGAGACACTTCTTCAAATAATAGAAACAGTTAAAGATGAAAAACTCAACCTTGAAACAACATTACAAGAATCTAC
TGCTGCCAGACAAATTATGGAAAGAGAAATTGAGAATATTCAAACCTACCAATCTACTGCCGAAGAGAATTTTCTGCAAGAAATAAAAAA
TGCAAAATCAGAAGCAAGTATTTATAAGAATAGCTTGTCAGAAATTGGCAAGGAATGTGAAATGTTATCAAAAATGGTAATGGAAACCAA
AACAGATAATCAGATTCTAAAAGAAGAACTAAAGAAACATAGTCAAGAAAATATAAAATTTGAAAACAGCATCAGTAGACTTACTGAAGA
CAAAATACTTTTAGAAAATTACGTAAGAAGCATAGAAAATGAAAGGGATACCTTGGAATTTGAGATGCGGCATCTTCAACGAGAATATTT
AAGTTTAAGTGATAAAATTTGTAATCAGCATAATGACCCTTCAAAAACAACTTACATTTCAAGAAGAGAGAAATTCCATTTTGACAACTA
TACTCACGAAGATACTTCTAGTCCTCAGAGTAGGCCTTTGGCTTCGGATTTGAAAGGAATTCCAAGTAAACTGTATCATTTGCTTCCATC


Top

FusionGenePPI for KIAA1430_CCDC110


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
KIAA1430CCDC110CUL3, CAND1, DEPTOR, XDH


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for KIAA1430_CCDC110


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for KIAA1430_CCDC110


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource