FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 18687

FusionGeneSummary for KIAA1328_LIMCH1

check button Fusion gene summary
Fusion gene informationFusion gene name: KIAA1328_LIMCH1
Fusion gene ID: 18687
HgeneTgene
Gene symbol

KIAA1328

LIMCH1

Gene ID

57536

22998

Gene nameKIAA1328LIM and calponin homology domains 1
Synonyms-LIMCH1A|LMO7B
Cytomap

18q12.2

4p13

Type of geneprotein-codingprotein-coding
Descriptionprotein hinderinhinderinLIM and calponin homology domains-containing protein 1
Modification date2018051920180519
UniProtAcc

Q86T90

Q9UPQ0

Ensembl transtripts involved in fusion geneENST00000543923, ENST00000435985, 
ENST00000280020, ENST00000591619, 
ENST00000586135, ENST00000592521, 
ENST00000586501, ENST00000601437, 
ENST00000513024, ENST00000509638, 
ENST00000508501, ENST00000512946, 
ENST00000313860, ENST00000512632, 
ENST00000512820, ENST00000503057, 
ENST00000511496, ENST00000514096, 
ENST00000509277, ENST00000396595, 
ENST00000381753, ENST00000509454, 
ENST00000515785, 
Fusion gene scores* DoF score3 X 3 X 3=2710 X 10 X 6=600
# samples 310
** MAII scorelog2(3/27*10)=0.15200309344505
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(10/600*10)=-2.58496250072116
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: KIAA1328 [Title/Abstract] AND LIMCH1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLGGTCGA-DU-6407-02BKIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000543923ENST00000513024KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
5CDS-intronENST00000543923ENST00000509638KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
5CDS-intronENST00000543923ENST00000508501KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
5CDS-intronENST00000543923ENST00000512946KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
5CDS-intronENST00000543923ENST00000313860KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
5CDS-intronENST00000543923ENST00000512632KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
5CDS-intronENST00000543923ENST00000512820KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
5CDS-intronENST00000543923ENST00000503057KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
5CDS-intronENST00000543923ENST00000511496KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
5CDS-intronENST00000543923ENST00000514096KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
5CDS-intronENST00000543923ENST00000509277KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
5CDS-intronENST00000543923ENST00000396595KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
5CDS-intronENST00000543923ENST00000381753KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
5CDS-intronENST00000543923ENST00000509454KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
5CDS-intronENST00000543923ENST00000515785KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
5UTR-3CDSENST00000435985ENST00000513024KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
5UTR-intronENST00000435985ENST00000509638KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
5UTR-intronENST00000435985ENST00000508501KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
5UTR-intronENST00000435985ENST00000512946KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
5UTR-intronENST00000435985ENST00000313860KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
5UTR-intronENST00000435985ENST00000512632KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
5UTR-intronENST00000435985ENST00000512820KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
5UTR-intronENST00000435985ENST00000503057KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
5UTR-intronENST00000435985ENST00000511496KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
5UTR-intronENST00000435985ENST00000514096KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
5UTR-intronENST00000435985ENST00000509277KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
5UTR-intronENST00000435985ENST00000396595KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
5UTR-intronENST00000435985ENST00000381753KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
5UTR-intronENST00000435985ENST00000509454KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
5UTR-intronENST00000435985ENST00000515785KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
In-frameENST00000280020ENST00000513024KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
5CDS-intronENST00000280020ENST00000509638KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
5CDS-intronENST00000280020ENST00000508501KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
5CDS-intronENST00000280020ENST00000512946KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
5CDS-intronENST00000280020ENST00000313860KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
5CDS-intronENST00000280020ENST00000512632KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
5CDS-intronENST00000280020ENST00000512820KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
5CDS-intronENST00000280020ENST00000503057KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
5CDS-intronENST00000280020ENST00000511496KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
5CDS-intronENST00000280020ENST00000514096KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
5CDS-intronENST00000280020ENST00000509277KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
5CDS-intronENST00000280020ENST00000396595KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
5CDS-intronENST00000280020ENST00000381753KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
5CDS-intronENST00000280020ENST00000509454KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
5CDS-intronENST00000280020ENST00000515785KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
In-frameENST00000591619ENST00000513024KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
5CDS-intronENST00000591619ENST00000509638KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
5CDS-intronENST00000591619ENST00000508501KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
5CDS-intronENST00000591619ENST00000512946KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
5CDS-intronENST00000591619ENST00000313860KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
5CDS-intronENST00000591619ENST00000512632KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
5CDS-intronENST00000591619ENST00000512820KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
5CDS-intronENST00000591619ENST00000503057KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
5CDS-intronENST00000591619ENST00000511496KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
5CDS-intronENST00000591619ENST00000514096KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
5CDS-intronENST00000591619ENST00000509277KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
5CDS-intronENST00000591619ENST00000396595KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
5CDS-intronENST00000591619ENST00000381753KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
5CDS-intronENST00000591619ENST00000509454KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
5CDS-intronENST00000591619ENST00000515785KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
intron-3CDSENST00000586135ENST00000513024KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
intron-intronENST00000586135ENST00000509638KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
intron-intronENST00000586135ENST00000508501KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
intron-intronENST00000586135ENST00000512946KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
intron-intronENST00000586135ENST00000313860KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
intron-intronENST00000586135ENST00000512632KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
intron-intronENST00000586135ENST00000512820KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
intron-intronENST00000586135ENST00000503057KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
intron-intronENST00000586135ENST00000511496KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
intron-intronENST00000586135ENST00000514096KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
intron-intronENST00000586135ENST00000509277KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
intron-intronENST00000586135ENST00000396595KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
intron-intronENST00000586135ENST00000381753KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
intron-intronENST00000586135ENST00000509454KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
intron-intronENST00000586135ENST00000515785KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
intron-3CDSENST00000592521ENST00000513024KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
intron-intronENST00000592521ENST00000509638KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
intron-intronENST00000592521ENST00000508501KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
intron-intronENST00000592521ENST00000512946KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
intron-intronENST00000592521ENST00000313860KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
intron-intronENST00000592521ENST00000512632KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
intron-intronENST00000592521ENST00000512820KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
intron-intronENST00000592521ENST00000503057KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
intron-intronENST00000592521ENST00000511496KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
intron-intronENST00000592521ENST00000514096KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
intron-intronENST00000592521ENST00000509277KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
intron-intronENST00000592521ENST00000396595KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
intron-intronENST00000592521ENST00000381753KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
intron-intronENST00000592521ENST00000509454KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
intron-intronENST00000592521ENST00000515785KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
intron-3CDSENST00000586501ENST00000513024KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
intron-intronENST00000586501ENST00000509638KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
intron-intronENST00000586501ENST00000508501KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
intron-intronENST00000586501ENST00000512946KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
intron-intronENST00000586501ENST00000313860KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
intron-intronENST00000586501ENST00000512632KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
intron-intronENST00000586501ENST00000512820KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
intron-intronENST00000586501ENST00000503057KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
intron-intronENST00000586501ENST00000511496KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
intron-intronENST00000586501ENST00000514096KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
intron-intronENST00000586501ENST00000509277KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
intron-intronENST00000586501ENST00000396595KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
intron-intronENST00000586501ENST00000381753KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
intron-intronENST00000586501ENST00000509454KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
intron-intronENST00000586501ENST00000515785KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
intron-3CDSENST00000601437ENST00000513024KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
intron-intronENST00000601437ENST00000509638KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
intron-intronENST00000601437ENST00000508501KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
intron-intronENST00000601437ENST00000512946KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
intron-intronENST00000601437ENST00000313860KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
intron-intronENST00000601437ENST00000512632KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
intron-intronENST00000601437ENST00000512820KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
intron-intronENST00000601437ENST00000503057KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
intron-intronENST00000601437ENST00000511496KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
intron-intronENST00000601437ENST00000514096KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
intron-intronENST00000601437ENST00000509277KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
intron-intronENST00000601437ENST00000396595KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
intron-intronENST00000601437ENST00000381753KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
intron-intronENST00000601437ENST00000509454KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+
intron-intronENST00000601437ENST00000515785KIAA1328chr18

34539398

+LIMCH1chr4

41663437

+

Top

FusionProtFeatures for KIAA1328_LIMCH1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
KIAA1328

Q86T90

LIMCH1

Q9UPQ0

Competes with SMC1 for binding to SMC3. May affect theavailability of SMC3 to engage in the formation of multimericprotein complexes. {ECO:0000269|PubMed:15656913}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneKIAA1328chr18:34539398chr4:41663437ENST00000280020+61091_167192578Coiled coilOntology_term=ECO:0000255
HgeneKIAA1328chr18:34539398chr4:41663437ENST00000591619+61191_167188441Coiled coilOntology_term=ECO:0000255
TgeneLIMCH1chr18:34539398chr4:41663437ENST00000313860+1227782_8236271084Coiled coilOntology_term=ECO:0000255
TgeneLIMCH1chr18:34539398chr4:41663437ENST00000381753+620782_823461891Coiled coilOntology_term=ECO:0000255
TgeneLIMCH1chr18:34539398chr4:41663437ENST00000396595+721782_823473903Coiled coilOntology_term=ECO:0000255
TgeneLIMCH1chr18:34539398chr4:41663437ENST00000508501+1226782_8236271057Coiled coilOntology_term=ECO:0000255
TgeneLIMCH1chr18:34539398chr4:41663437ENST00000511496+923782_823468898Coiled coilOntology_term=ECO:0000255
TgeneLIMCH1chr18:34539398chr4:41663437ENST00000512820+1126782_8236151070Coiled coilOntology_term=ECO:0000255
TgeneLIMCH1chr18:34539398chr4:41663437ENST00000512946+1226782_8236271058Coiled coilOntology_term=ECO:0000255
TgeneLIMCH1chr18:34539398chr4:41663437ENST00000513024+1126782_823456911Coiled coilOntology_term=ECO:0000255
TgeneLIMCH1chr18:34539398chr4:41663437ENST00000313860+12271011_10776271084DomainLIM zinc-binding
TgeneLIMCH1chr18:34539398chr4:41663437ENST00000381753+6201011_1077461891DomainLIM zinc-binding
TgeneLIMCH1chr18:34539398chr4:41663437ENST00000396595+7211011_1077473903DomainLIM zinc-binding
TgeneLIMCH1chr18:34539398chr4:41663437ENST00000508501+12261011_10776271057DomainLIM zinc-binding
TgeneLIMCH1chr18:34539398chr4:41663437ENST00000511496+9231011_1077468898DomainLIM zinc-binding
TgeneLIMCH1chr18:34539398chr4:41663437ENST00000512820+11261011_10776151070DomainLIM zinc-binding
TgeneLIMCH1chr18:34539398chr4:41663437ENST00000512946+12261011_10776271058DomainLIM zinc-binding
TgeneLIMCH1chr18:34539398chr4:41663437ENST00000513024+11261011_1077456911DomainLIM zinc-binding

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneKIAA1328chr18:34539398chr4:41663437ENST00000280020+610358_402192578Coiled coilOntology_term=ECO:0000255
HgeneKIAA1328chr18:34539398chr4:41663437ENST00000435985+611358_402-92280Coiled coilOntology_term=ECO:0000255
HgeneKIAA1328chr18:34539398chr4:41663437ENST00000435985+61191_167-92280Coiled coilOntology_term=ECO:0000255
HgeneKIAA1328chr18:34539398chr4:41663437ENST00000586135+19358_402-232369Coiled coilOntology_term=ECO:0000255
HgeneKIAA1328chr18:34539398chr4:41663437ENST00000586135+1991_167-232369Coiled coilOntology_term=ECO:0000255
HgeneKIAA1328chr18:34539398chr4:41663437ENST00000586501+12358_402-100130Coiled coilOntology_term=ECO:0000255
HgeneKIAA1328chr18:34539398chr4:41663437ENST00000586501+1291_167-100130Coiled coilOntology_term=ECO:0000255
HgeneKIAA1328chr18:34539398chr4:41663437ENST00000591619+611358_402188441Coiled coilOntology_term=ECO:0000255
TgeneLIMCH1chr18:34539398chr4:41663437ENST00000313860+1227354_4396271084Coiled coilOntology_term=ECO:0000255
TgeneLIMCH1chr18:34539398chr4:41663437ENST00000381753+620354_439461891Coiled coilOntology_term=ECO:0000255
TgeneLIMCH1chr18:34539398chr4:41663437ENST00000396595+721354_439473903Coiled coilOntology_term=ECO:0000255
TgeneLIMCH1chr18:34539398chr4:41663437ENST00000508501+1226354_4396271057Coiled coilOntology_term=ECO:0000255
TgeneLIMCH1chr18:34539398chr4:41663437ENST00000511496+923354_439468898Coiled coilOntology_term=ECO:0000255
TgeneLIMCH1chr18:34539398chr4:41663437ENST00000512820+1126354_4396151070Coiled coilOntology_term=ECO:0000255
TgeneLIMCH1chr18:34539398chr4:41663437ENST00000512946+1226354_4396271058Coiled coilOntology_term=ECO:0000255
TgeneLIMCH1chr18:34539398chr4:41663437ENST00000513024+1126354_439456911Coiled coilOntology_term=ECO:0000255
TgeneLIMCH1chr18:34539398chr4:41663437ENST00000313860+122721_1256271084DomainCalponin-homology (CH)
TgeneLIMCH1chr18:34539398chr4:41663437ENST00000381753+62021_125461891DomainCalponin-homology (CH)
TgeneLIMCH1chr18:34539398chr4:41663437ENST00000396595+72121_125473903DomainCalponin-homology (CH)
TgeneLIMCH1chr18:34539398chr4:41663437ENST00000508501+122621_1256271057DomainCalponin-homology (CH)
TgeneLIMCH1chr18:34539398chr4:41663437ENST00000511496+92321_125468898DomainCalponin-homology (CH)
TgeneLIMCH1chr18:34539398chr4:41663437ENST00000512820+112621_1256151070DomainCalponin-homology (CH)
TgeneLIMCH1chr18:34539398chr4:41663437ENST00000512946+122621_1256271058DomainCalponin-homology (CH)
TgeneLIMCH1chr18:34539398chr4:41663437ENST00000513024+112621_125456911DomainCalponin-homology (CH)


Top

FusionGeneSequence for KIAA1328_LIMCH1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_KIAA1328_ENST00000543923_chr18_34539398_+_LIMCH1_ENST00000513024_chr4_41663437_+_539aa
MNRVSEEKEVTEERLKAEQESFEKKIRQLEEQNELIIKEREALQLQTRECQELLSLTQKTLSEQQEKLTMSLSELGAARMQEQQATTEKT
EPNSQEDKNDGGKSRKGNIELASSEPQHFTTTVTRCSPTVAFVEFPSSPQLKNDVSEEKDQKKPENEMSGKVELVLSQKVVKPKSPEPEA
TLTFPFLDKMPEANQLHLPNLNSQESPGTASVPLRVQNSWRRSQFFSQSVDSPSSEKSPVMTPFKFWAWDPEEERRRQEKWQQEQERLLQ
ERYQKEQDKLKEEWEKAQKEVEEEERRYTEEERKIIEDTVVPFTVSSSSADQLSTSSSMTEGSGTMNKIDLGNCQDEKQDRRWKKSFQGD
DSDLLLKTRESDRLEEKGSLTEGALAHSGNPVSKGVHEDHQLDTEAGAPHCGTNPQLAQDPSQNQQTSNPTHSSEDVKPKTLPLDKSINH

>In-frame_KIAA1328_ENST00000280020_chr18_34539398_+_LIMCH1_ENST00000513024_chr4_41663437_+_647aa
MADVAGPSRPSAAAFWSRDFSDEEQSVVYVPGISAEGNVRSRHKLMSPKADVKLKTSRVTDASISMESLKGTGDSVDEQNSCRGEIKSAS
LKDLCLEDKRRIANLIKELARVSEEKEVTEERLKAEQESFEKKIRQLEEQNELIIKEREALQLQTRECQELLSLTQKTLSEQQEKLTMSL
SELGAARMQEQQATTEKTEPNSQEDKNDGGKSRKGNIELASSEPQHFTTTVTRCSPTVAFVEFPSSPQLKNDVSEEKDQKKPENEMSGKV
ELVLSQKVVKPKSPEPEATLTFPFLDKMPEANQLHLPNLNSQESPGTASVPLRVQNSWRRSQFFSQSVDSPSSEKSPVMTPFKFWAWDPE
EERRRQEKWQQEQERLLQERYQKEQDKLKEEWEKAQKEVEEEERRYTEEERKIIEDTVVPFTVSSSSADQLSTSSSMTEGSGTMNKIDLG
NCQDEKQDRRWKKSFQGDDSDLLLKTRESDRLEEKGSLTEGALAHSGNPVSKGVHEDHQLDTEAGAPHCGTNPQLAQDPSQNQQTSNPTH
SSEDVKPKTLPLDKSINHQIESPSERRKSISGKKLCSSCGLPLGKGAAMIIETLNLTFHIQCFRCGICKGQLGDAVSGTDVRIRNGLLNC

>In-frame_KIAA1328_ENST00000591619_chr18_34539398_+_LIMCH1_ENST00000513024_chr4_41663437_+_643aa
MPDNIIVFSFMFSCVVSDEEQSVVYVPGISAEGNVRSRHKLMSPKADVKLKTSRVTDASISMESLKGTGDSVDEQNSCRGEIKSASLKDL
CLEDKRRIANLIKELARVSEEKEVTEERLKAEQESFEKKIRQLEEQNELIIKEREALQLQTRECQELLSLTQKTLSEQQEKLTMSLSELG
AARMQEQQATTEKTEPNSQEDKNDGGKSRKGNIELASSEPQHFTTTVTRCSPTVAFVEFPSSPQLKNDVSEEKDQKKPENEMSGKVELVL
SQKVVKPKSPEPEATLTFPFLDKMPEANQLHLPNLNSQESPGTASVPLRVQNSWRRSQFFSQSVDSPSSEKSPVMTPFKFWAWDPEEERR
RQEKWQQEQERLLQERYQKEQDKLKEEWEKAQKEVEEEERRYTEEERKIIEDTVVPFTVSSSSADQLSTSSSMTEGSGTMNKIDLGNCQD
EKQDRRWKKSFQGDDSDLLLKTRESDRLEEKGSLTEGALAHSGNPVSKGVHEDHQLDTEAGAPHCGTNPQLAQDPSQNQQTSNPTHSSED
VKPKTLPLDKSINHQIESPSERRKSISGKKLCSSCGLPLGKGAAMIIETLNLTFHIQCFRCGICKGQLGDAVSGTDVRIRNGLLNCNDCY


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_KIAA1328_ENST00000543923_chr18_34539398_+_LIMCH1_ENST00000513024_chr4_41663437_+_1617nt
ATGAACAGAGTAAGTGAGGAAAAGGAAGTGACAGAGGAAAGACTGAAAGCTGAGCAGGAGTCATTTGAGAAGAAGATCAGGCAGTTGGAA
GAACAGAATGAACTGATCATCAAAGAAAGGGAAGCTCTTCAGCTACAGTATAGAGAATGCCAAGAACTTCTAAGCCTGTATCAGAAATAT
TTATCAGAACAACAGGAGAAGCTCACCATGTCTCTCTCAGAACTTGGTGCTGCTAGAATGCAGGAACAGCAGGCAACCACTGAGAAAACG
GAACCGAATAGTCAAGAGGACAAGAATGATGGTGGAAAATCAAGAAAAGGGAATATAGAACTTGCCTCATCAGAACCACAGCATTTTACA
ACAACTGTGACTCGATGCAGCCCGACCGTGGCCTTTGTGGAATTTCCCTCCAGCCCCCAGCTGAAGAATGATGTGTCGGAAGAAAAAGAC
CAGAAGAAACCAGAAAATGAAATGAGTGGAAAGGTGGAGTTGGTGCTGTCACAAAAGGTGGTAAAGCCAAAATCTCCAGAACCCGAAGCA
ACGCTGACATTTCCATTTCTGGACAAAATGCCTGAAGCCAACCAACTACATTTGCCAAATCTCAATTCTCAAGAGTCGCCTGGCACTGCC
AGTGTTCCGCTTAGAGTTCAGAACTCTTGGCGACGATCCCAGTTTTTCTCCCAGTCAGTGGATTCTCCAAGCAGTGAGAAGTCACCTGTT
ATGACACCTTTTAAGTTCTGGGCATGGGACCCAGAAGAGGAGCGCAGGCGACAGGAAAAATGGCAACAGGAACAGGAACGTTTGCTCCAG
GAGAGATACCAGAAGGAGCAGGACAAGCTGAAAGAAGAGTGGGAAAAGGCCCAAAAGGAGGTGGAAGAGGAAGAACGCAGATACTATGAG
GAGGAGCGTAAGATAATTGAAGACACTGTGGTTCCATTTACTGTTTCTTCAAGTTCCGCTGACCAGCTGTCTACCTCTTCCTCCATGACT
GAAGGCAGTGGGACAATGAATAAGATAGACCTGGGAAACTGTCAAGATGAAAAACAAGACAGAAGATGGAAGAAATCATTCCAGGGAGAT
GACAGTGACTTATTGCTGAAGACTAGGGAAAGTGATCGACTGGAGGAGAAGGGCAGCCTAACTGAAGGGGCCTTGGCTCATTCTGGGAAC
CCTGTATCAAAAGGAGTCCATGAAGACCATCAGCTGGATACCGAGGCTGGGGCCCCACACTGTGGAACAAACCCACAGCTTGCTCAGGAT
CCATCCCAGAATCAGCAGACATCAAATCCAACGCACAGTTCAGAAGATGTGAAGCCAAAAACCCTCCCGCTGGATAAAAGCATTAACCAT
CAGATCGAGTCTCCCAGTGAAAGGCGGAAGTCTATAAGTGGAAAGAAGCTGTGCTCTTCCTGTGGGCTTCCTTTGGGTAAAGGAGCTGCA
ATGATCATCGAGACCCTCAATCTCTATTTTCACATCCAGTGTTTCAGGTGTGGAATTTGTAAAGGCCAGCTTGGAGATGCAGTGAGTGGG

>In-frame_KIAA1328_ENST00000280020_chr18_34539398_+_LIMCH1_ENST00000513024_chr4_41663437_+_1941nt
ATGGCGGACGTGGCGGGCCCCTCCCGCCCCAGTGCCGCGGCGTTCTGGAGCCGGGACTTTTCTGATGAAGAACAATCAGTAGTATACGTT
CCAGGAATTTCTGCTGAAGGAAATGTCAGATCAAGACACAAGCTGATGAGTCCAAAAGCTGATGTTAAACTTAAGACTTCCAGGGTGACT
GATGCTTCAATCTCCATGGAGTCCTTAAAAGGCACAGGAGATTCAGTAGATGAACAGAATTCCTGCAGGGGAGAAATAAAGAGTGCATCA
TTGAAGGATTTATGTCTTGAAGACAAAAGACGCATTGCAAACTTAATTAAAGAACTGGCCAGAGTAAGTGAGGAAAAGGAAGTGACAGAG
GAAAGACTGAAAGCTGAGCAGGAGTCATTTGAGAAGAAGATCAGGCAGTTGGAAGAACAGAATGAACTGATCATCAAAGAAAGGGAAGCT
CTTCAGCTACAGTATAGAGAATGCCAAGAACTTCTAAGCCTGTATCAGAAATATTTATCAGAACAACAGGAGAAGCTCACCATGTCTCTC
TCAGAACTTGGTGCTGCTAGAATGCAGGAACAGCAGGCAACCACTGAGAAAACGGAACCGAATAGTCAAGAGGACAAGAATGATGGTGGA
AAATCAAGAAAAGGGAATATAGAACTTGCCTCATCAGAACCACAGCATTTTACAACAACTGTGACTCGATGCAGCCCGACCGTGGCCTTT
GTGGAATTTCCCTCCAGCCCCCAGCTGAAGAATGATGTGTCGGAAGAAAAAGACCAGAAGAAACCAGAAAATGAAATGAGTGGAAAGGTG
GAGTTGGTGCTGTCACAAAAGGTGGTAAAGCCAAAATCTCCAGAACCCGAAGCAACGCTGACATTTCCATTTCTGGACAAAATGCCTGAA
GCCAACCAACTACATTTGCCAAATCTCAATTCTCAAGAGTCGCCTGGCACTGCCAGTGTTCCGCTTAGAGTTCAGAACTCTTGGCGACGA
TCCCAGTTTTTCTCCCAGTCAGTGGATTCTCCAAGCAGTGAGAAGTCACCTGTTATGACACCTTTTAAGTTCTGGGCATGGGACCCAGAA
GAGGAGCGCAGGCGACAGGAAAAATGGCAACAGGAACAGGAACGTTTGCTCCAGGAGAGATACCAGAAGGAGCAGGACAAGCTGAAAGAA
GAGTGGGAAAAGGCCCAAAAGGAGGTGGAAGAGGAAGAACGCAGATACTATGAGGAGGAGCGTAAGATAATTGAAGACACTGTGGTTCCA
TTTACTGTTTCTTCAAGTTCCGCTGACCAGCTGTCTACCTCTTCCTCCATGACTGAAGGCAGTGGGACAATGAATAAGATAGACCTGGGA
AACTGTCAAGATGAAAAACAAGACAGAAGATGGAAGAAATCATTCCAGGGAGATGACAGTGACTTATTGCTGAAGACTAGGGAAAGTGAT
CGACTGGAGGAGAAGGGCAGCCTAACTGAAGGGGCCTTGGCTCATTCTGGGAACCCTGTATCAAAAGGAGTCCATGAAGACCATCAGCTG
GATACCGAGGCTGGGGCCCCACACTGTGGAACAAACCCACAGCTTGCTCAGGATCCATCCCAGAATCAGCAGACATCAAATCCAACGCAC
AGTTCAGAAGATGTGAAGCCAAAAACCCTCCCGCTGGATAAAAGCATTAACCATCAGATCGAGTCTCCCAGTGAAAGGCGGAAGTCTATA
AGTGGAAAGAAGCTGTGCTCTTCCTGTGGGCTTCCTTTGGGTAAAGGAGCTGCAATGATCATCGAGACCCTCAATCTCTATTTTCACATC
CAGTGTTTCAGGTGTGGAATTTGTAAAGGCCAGCTTGGAGATGCAGTGAGTGGGACGGATGTTAGGATTCGAAATGGTCTCCTGAACTGT

>In-frame_KIAA1328_ENST00000591619_chr18_34539398_+_LIMCH1_ENST00000513024_chr4_41663437_+_1929nt
ATGCCGGATAATATTATTGTATTTTCCTTCATGTTCTCCTGCGTAGTTTCTGATGAAGAACAATCAGTAGTATACGTTCCAGGAATTTCT
GCTGAAGGAAATGTCAGATCAAGACACAAGCTGATGAGTCCAAAAGCTGATGTTAAACTTAAGACTTCCAGGGTGACTGATGCTTCAATC
TCCATGGAGTCCTTAAAAGGCACAGGAGATTCAGTAGATGAACAGAATTCCTGCAGGGGAGAAATAAAGAGTGCATCATTGAAGGATTTA
TGTCTTGAAGACAAAAGACGCATTGCAAACTTAATTAAAGAACTGGCCAGAGTAAGTGAGGAAAAGGAAGTGACAGAGGAAAGACTGAAA
GCTGAGCAGGAGTCATTTGAGAAGAAGATCAGGCAGTTGGAAGAACAGAATGAACTGATCATCAAAGAAAGGGAAGCTCTTCAGCTACAG
TATAGAGAATGCCAAGAACTTCTAAGCCTGTATCAGAAATATTTATCAGAACAACAGGAGAAGCTCACCATGTCTCTCTCAGAACTTGGT
GCTGCTAGAATGCAGGAACAGCAGGCAACCACTGAGAAAACGGAACCGAATAGTCAAGAGGACAAGAATGATGGTGGAAAATCAAGAAAA
GGGAATATAGAACTTGCCTCATCAGAACCACAGCATTTTACAACAACTGTGACTCGATGCAGCCCGACCGTGGCCTTTGTGGAATTTCCC
TCCAGCCCCCAGCTGAAGAATGATGTGTCGGAAGAAAAAGACCAGAAGAAACCAGAAAATGAAATGAGTGGAAAGGTGGAGTTGGTGCTG
TCACAAAAGGTGGTAAAGCCAAAATCTCCAGAACCCGAAGCAACGCTGACATTTCCATTTCTGGACAAAATGCCTGAAGCCAACCAACTA
CATTTGCCAAATCTCAATTCTCAAGAGTCGCCTGGCACTGCCAGTGTTCCGCTTAGAGTTCAGAACTCTTGGCGACGATCCCAGTTTTTC
TCCCAGTCAGTGGATTCTCCAAGCAGTGAGAAGTCACCTGTTATGACACCTTTTAAGTTCTGGGCATGGGACCCAGAAGAGGAGCGCAGG
CGACAGGAAAAATGGCAACAGGAACAGGAACGTTTGCTCCAGGAGAGATACCAGAAGGAGCAGGACAAGCTGAAAGAAGAGTGGGAAAAG
GCCCAAAAGGAGGTGGAAGAGGAAGAACGCAGATACTATGAGGAGGAGCGTAAGATAATTGAAGACACTGTGGTTCCATTTACTGTTTCT
TCAAGTTCCGCTGACCAGCTGTCTACCTCTTCCTCCATGACTGAAGGCAGTGGGACAATGAATAAGATAGACCTGGGAAACTGTCAAGAT
GAAAAACAAGACAGAAGATGGAAGAAATCATTCCAGGGAGATGACAGTGACTTATTGCTGAAGACTAGGGAAAGTGATCGACTGGAGGAG
AAGGGCAGCCTAACTGAAGGGGCCTTGGCTCATTCTGGGAACCCTGTATCAAAAGGAGTCCATGAAGACCATCAGCTGGATACCGAGGCT
GGGGCCCCACACTGTGGAACAAACCCACAGCTTGCTCAGGATCCATCCCAGAATCAGCAGACATCAAATCCAACGCACAGTTCAGAAGAT
GTGAAGCCAAAAACCCTCCCGCTGGATAAAAGCATTAACCATCAGATCGAGTCTCCCAGTGAAAGGCGGAAGTCTATAAGTGGAAAGAAG
CTGTGCTCTTCCTGTGGGCTTCCTTTGGGTAAAGGAGCTGCAATGATCATCGAGACCCTCAATCTCTATTTTCACATCCAGTGTTTCAGG
TGTGGAATTTGTAAAGGCCAGCTTGGAGATGCAGTGAGTGGGACGGATGTTAGGATTCGAAATGGTCTCCTGAACTGTAATGATTGCTAC


* Fusion transcript sequences (Full-length transcript).
>In-frame_KIAA1328_ENST00000543923_chr18_34539398_+_LIMCH1_ENST00000513024_chr4_41663437_+_3697nt
AGGCGCGACGCCCCGAGTGGCGGTTGTTTCAAGATGGCGGACGTGGCGGGCCCCTCCCGCCCCAGTGCCGCGGCGTTCTGGAGCCGGGAC
TTTTCTGATGAAGAACAATCAGTAGTATACGTTCCAGGAATTTCTGCTGAAGGAAATGTCAGATCAAGACACAAGCTGATGAGTCCAAAA
GCTGATGTTAAACTTAAGACTTCCAGGGTGACTGATGCTTCAATCTCCATGGAGTCCTTAAAAGGCACAGGAGATTCAGTAGATGAACAG
AGTAAGTGAGGAAAAGGAAGTGACAGAGGAAAGACTGAAAGCTGAGCAGGAGTCATTTGAGAAGAAGATCAGGCAGTTGGAAGAACAGAA
TGAACTGATCATCAAAGAAAGGGAAGCTCTTCAGCTACAGTATAGAGAATGCCAAGAACTTCTAAGCCTGTATCAGAAATATTTATCAGA
ACAACAGGAGAAGCTCACCATGTCTCTCTCAGAACTTGGTGCTGCTAGAATGCAGGAACAGCAGGCAACCACTGAGAAAACGGAACCGAA
TAGTCAAGAGGACAAGAATGATGGTGGAAAATCAAGAAAAGGGAATATAGAACTTGCCTCATCAGAACCACAGCATTTTACAACAACTGT
GACTCGATGCAGCCCGACCGTGGCCTTTGTGGAATTTCCCTCCAGCCCCCAGCTGAAGAATGATGTGTCGGAAGAAAAAGACCAGAAGAA
ACCAGAAAATGAAATGAGTGGAAAGGTGGAGTTGGTGCTGTCACAAAAGGTGGTAAAGCCAAAATCTCCAGAACCCGAAGCAACGCTGAC
ATTTCCATTTCTGGACAAAATGCCTGAAGCCAACCAACTACATTTGCCAAATCTCAATTCTCAAGAGTCGCCTGGCACTGCCAGTGTTCC
GCTTAGAGTTCAGAACTCTTGGCGACGATCCCAGTTTTTCTCCCAGTCAGTGGATTCTCCAAGCAGTGAGAAGTCACCTGTTATGACACC
TTTTAAGTTCTGGGCATGGGACCCAGAAGAGGAGCGCAGGCGACAGGAAAAATGGCAACAGGAACAGGAACGTTTGCTCCAGGAGAGATA
CCAGAAGGAGCAGGACAAGCTGAAAGAAGAGTGGGAAAAGGCCCAAAAGGAGGTGGAAGAGGAAGAACGCAGATACTATGAGGAGGAGCG
TAAGATAATTGAAGACACTGTGGTTCCATTTACTGTTTCTTCAAGTTCCGCTGACCAGCTGTCTACCTCTTCCTCCATGACTGAAGGCAG
TGGGACAATGAATAAGATAGACCTGGGAAACTGTCAAGATGAAAAACAAGACAGAAGATGGAAGAAATCATTCCAGGGAGATGACAGTGA
CTTATTGCTGAAGACTAGGGAAAGTGATCGACTGGAGGAGAAGGGCAGCCTAACTGAAGGGGCCTTGGCTCATTCTGGGAACCCTGTATC
AAAAGGAGTCCATGAAGACCATCAGCTGGATACCGAGGCTGGGGCCCCACACTGTGGAACAAACCCACAGCTTGCTCAGGATCCATCCCA
GAATCAGCAGACATCAAATCCAACGCACAGTTCAGAAGATGTGAAGCCAAAAACCCTCCCGCTGGATAAAAGCATTAACCATCAGATCGA
GTCTCCCAGTGAAAGGCGGAAGTCTATAAGTGGAAAGAAGCTGTGCTCTTCCTGTGGGCTTCCTTTGGGTAAAGGAGCTGCAATGATCAT
CGAGACCCTCAATCTCTATTTTCACATCCAGTGTTTCAGGTGTGGAATTTGTAAAGGCCAGCTTGGAGATGCAGTGAGTGGGACGGATGT
TAGGATTCGAAATGGTCTCCTGAACTGTAATGATTGCTACATGCGATCCAGAAGTGCCGGGCAGCCTACAACATTGTGACACGGCTTTCA
AGCTTCCGGATCACTCACCATTTCTTTACTGAGAGTGTCCCCTGGCAACTGCTTAACAAAATCCCAAGCTCAGGGGCTTCTCAGCATTTA
CCTAATTTCTGAAAGGCTCTTCTGAAAGGTGGTATCTGTTCTTTCGTAGCACAGTGTTTATGTTTTTCCTGTTTATTGTTTTGGTTTTTT
TTTTTTTTTTGCATTTGCACAGTATACACAAAAGAATATGGGGTTGTAATGATCCTGAATAGCTCAAAAAAGGTTTTAGCATGGTCAAAC
AGGCTTATGGTTTAAAATGTGTTATTCTCTTCTTTGGGAATTAGCTAAATGATGCAATAAACCTGTTTTGTTTTAGAATGTCTAGGAATT
AAACACTTTATGTTTACAGAATTGAGCTGCAGAAAGTGCAAGACATGCCAATTTGAGACACACGGTCTTCTAAGACTGAAGGATAAATTT
AATGCATTTCAGAAACTAAACATCACAGCAAGCTCTATCTCTGAGCTATAATTTGTTTTTAATGCAAAGACACTAGTTTGATAATATATA
CTGTAATCCTGAAACATTTGTGTTACTTACCTTTGGAGGTAGAAATTATACCAATAAATTATTGCACCGTTAGTATTAGATTCTGTGTAC
CTTGGAAGTTATGTCATTAATATAGGCTGGTTCATCAAATAAAGCAAAACCTTGCAATATCAGCTAGATTTACACTCCGGGACGTTGCCC
AAAGGTAGGAAGAAAGCAGAGGGAAATATTTCAGTCATCATTTCCAAAGTCATTATCAAAATCTGTGAGGAAGTTTAATCTTCCAAAGAG
TCAATGTCAGACATCAGGCCTCTGTTGCCTGCTTCTCTCGAGGCACTAGATTAGGAGTCTTCAATAAGAGACTTAACATGAGGTATATGG
AAGATGAGGCACCGAGATAAGTTCATCATTAGGTGTGAGCACTGCTCACCCTTGCTGGCAAGTTCTCCTTAAGGGCCTGAAGCACAGGTG
TCCAAAGAAAAGCGTTAAGTCCATCTTAATAGAATCTATGTGGTATATGATGTGGTCAGCCCCTGGTCTGTGATCAGCAAGAACCTACAG
CACAGATTATGCCCTGCCCACTTCAATGAATACCTACTCTCCTCCATTCTCCATCACTTTTTTTGCTATCAAGAACTCCGGACCTTGCCC
ATGGAGAAGTTTAGAGAGGAACTCTTGTGGAGAGCTGGTTTATTTTCTGCCCTGTGCGACGAGTTTCAGCTGGCCAAGAAAGGAGTCAAG
TTATTAAAAAGCATCACAATGTAGATCTCCAGGCTGGTTTTTTGTTTTTTGTTGTTAAGACTGGGGAAAGGGGGACTATTTATTCTGCCT
TAAATCAATGGCAAATAAGTCAAGATGACATTTTGTGAATGTAGACTATGGATACACTCCTAATAGATTGATGTAGTCATAAAAGGGGGT
CAAGTAGATGTTTTTCTGTTATGTAAGCAATAATTTTTCCGTGTCTTATTGAGTATGGCTAGCGATTATTTATTACATGCTAGATGGGTT
CTTTGCATGTGGGTTCCATATAGGTGCAGAAATTTCCTCAGCCACTGGAGGGATTTCGACCATATTTGTCATTTGGATGAGCTGTTATTA
GATTGAAATCTACACATCATTTCATTAAAAATTGTGCCTTAGAAAACGCAAAGCTGTTGCACATGGCGATAAATTATGGATGCAGTACAT
TGAAGAGAGATGAAGTCACTTCCAAGTTTCCAAGACTTCTCATGGAGGTGTTTGCTGTTTTACAGGAAAAAATAAAAATAAAAAAAGAAA

>In-frame_KIAA1328_ENST00000280020_chr18_34539398_+_LIMCH1_ENST00000513024_chr4_41663437_+_3781nt
CCCGAGTGGCGGTTGTTTCAAGATGGCGGACGTGGCGGGCCCCTCCCGCCCCAGTGCCGCGGCGTTCTGGAGCCGGGACTTTTCTGATGA
AGAACAATCAGTAGTATACGTTCCAGGAATTTCTGCTGAAGGAAATGTCAGATCAAGACACAAGCTGATGAGTCCAAAAGCTGATGTTAA
ACTTAAGACTTCCAGGGTGACTGATGCTTCAATCTCCATGGAGTCCTTAAAAGGCACAGGAGATTCAGTAGATGAACAGAATTCCTGCAG
GGGAGAAATAAAGAGTGCATCATTGAAGGATTTATGTCTTGAAGACAAAAGACGCATTGCAAACTTAATTAAAGAACTGGCCAGAGTAAG
TGAGGAAAAGGAAGTGACAGAGGAAAGACTGAAAGCTGAGCAGGAGTCATTTGAGAAGAAGATCAGGCAGTTGGAAGAACAGAATGAACT
GATCATCAAAGAAAGGGAAGCTCTTCAGCTACAGTATAGAGAATGCCAAGAACTTCTAAGCCTGTATCAGAAATATTTATCAGAACAACA
GGAGAAGCTCACCATGTCTCTCTCAGAACTTGGTGCTGCTAGAATGCAGGAACAGCAGGCAACCACTGAGAAAACGGAACCGAATAGTCA
AGAGGACAAGAATGATGGTGGAAAATCAAGAAAAGGGAATATAGAACTTGCCTCATCAGAACCACAGCATTTTACAACAACTGTGACTCG
ATGCAGCCCGACCGTGGCCTTTGTGGAATTTCCCTCCAGCCCCCAGCTGAAGAATGATGTGTCGGAAGAAAAAGACCAGAAGAAACCAGA
AAATGAAATGAGTGGAAAGGTGGAGTTGGTGCTGTCACAAAAGGTGGTAAAGCCAAAATCTCCAGAACCCGAAGCAACGCTGACATTTCC
ATTTCTGGACAAAATGCCTGAAGCCAACCAACTACATTTGCCAAATCTCAATTCTCAAGAGTCGCCTGGCACTGCCAGTGTTCCGCTTAG
AGTTCAGAACTCTTGGCGACGATCCCAGTTTTTCTCCCAGTCAGTGGATTCTCCAAGCAGTGAGAAGTCACCTGTTATGACACCTTTTAA
GTTCTGGGCATGGGACCCAGAAGAGGAGCGCAGGCGACAGGAAAAATGGCAACAGGAACAGGAACGTTTGCTCCAGGAGAGATACCAGAA
GGAGCAGGACAAGCTGAAAGAAGAGTGGGAAAAGGCCCAAAAGGAGGTGGAAGAGGAAGAACGCAGATACTATGAGGAGGAGCGTAAGAT
AATTGAAGACACTGTGGTTCCATTTACTGTTTCTTCAAGTTCCGCTGACCAGCTGTCTACCTCTTCCTCCATGACTGAAGGCAGTGGGAC
AATGAATAAGATAGACCTGGGAAACTGTCAAGATGAAAAACAAGACAGAAGATGGAAGAAATCATTCCAGGGAGATGACAGTGACTTATT
GCTGAAGACTAGGGAAAGTGATCGACTGGAGGAGAAGGGCAGCCTAACTGAAGGGGCCTTGGCTCATTCTGGGAACCCTGTATCAAAAGG
AGTCCATGAAGACCATCAGCTGGATACCGAGGCTGGGGCCCCACACTGTGGAACAAACCCACAGCTTGCTCAGGATCCATCCCAGAATCA
GCAGACATCAAATCCAACGCACAGTTCAGAAGATGTGAAGCCAAAAACCCTCCCGCTGGATAAAAGCATTAACCATCAGATCGAGTCTCC
CAGTGAAAGGCGGAAGTCTATAAGTGGAAAGAAGCTGTGCTCTTCCTGTGGGCTTCCTTTGGGTAAAGGAGCTGCAATGATCATCGAGAC
CCTCAATCTCTATTTTCACATCCAGTGTTTCAGGTGTGGAATTTGTAAAGGCCAGCTTGGAGATGCAGTGAGTGGGACGGATGTTAGGAT
TCGAAATGGTCTCCTGAACTGTAATGATTGCTACATGCGATCCAGAAGTGCCGGGCAGCCTACAACATTGTGACACGGCTTTCAAGCTTC
CGGATCACTCACCATTTCTTTACTGAGAGTGTCCCCTGGCAACTGCTTAACAAAATCCCAAGCTCAGGGGCTTCTCAGCATTTACCTAAT
TTCTGAAAGGCTCTTCTGAAAGGTGGTATCTGTTCTTTCGTAGCACAGTGTTTATGTTTTTCCTGTTTATTGTTTTGGTTTTTTTTTTTT
TTTTGCATTTGCACAGTATACACAAAAGAATATGGGGTTGTAATGATCCTGAATAGCTCAAAAAAGGTTTTAGCATGGTCAAACAGGCTT
ATGGTTTAAAATGTGTTATTCTCTTCTTTGGGAATTAGCTAAATGATGCAATAAACCTGTTTTGTTTTAGAATGTCTAGGAATTAAACAC
TTTATGTTTACAGAATTGAGCTGCAGAAAGTGCAAGACATGCCAATTTGAGACACACGGTCTTCTAAGACTGAAGGATAAATTTAATGCA
TTTCAGAAACTAAACATCACAGCAAGCTCTATCTCTGAGCTATAATTTGTTTTTAATGCAAAGACACTAGTTTGATAATATATACTGTAA
TCCTGAAACATTTGTGTTACTTACCTTTGGAGGTAGAAATTATACCAATAAATTATTGCACCGTTAGTATTAGATTCTGTGTACCTTGGA
AGTTATGTCATTAATATAGGCTGGTTCATCAAATAAAGCAAAACCTTGCAATATCAGCTAGATTTACACTCCGGGACGTTGCCCAAAGGT
AGGAAGAAAGCAGAGGGAAATATTTCAGTCATCATTTCCAAAGTCATTATCAAAATCTGTGAGGAAGTTTAATCTTCCAAAGAGTCAATG
TCAGACATCAGGCCTCTGTTGCCTGCTTCTCTCGAGGCACTAGATTAGGAGTCTTCAATAAGAGACTTAACATGAGGTATATGGAAGATG
AGGCACCGAGATAAGTTCATCATTAGGTGTGAGCACTGCTCACCCTTGCTGGCAAGTTCTCCTTAAGGGCCTGAAGCACAGGTGTCCAAA
GAAAAGCGTTAAGTCCATCTTAATAGAATCTATGTGGTATATGATGTGGTCAGCCCCTGGTCTGTGATCAGCAAGAACCTACAGCACAGA
TTATGCCCTGCCCACTTCAATGAATACCTACTCTCCTCCATTCTCCATCACTTTTTTTGCTATCAAGAACTCCGGACCTTGCCCATGGAG
AAGTTTAGAGAGGAACTCTTGTGGAGAGCTGGTTTATTTTCTGCCCTGTGCGACGAGTTTCAGCTGGCCAAGAAAGGAGTCAAGTTATTA
AAAAGCATCACAATGTAGATCTCCAGGCTGGTTTTTTGTTTTTTGTTGTTAAGACTGGGGAAAGGGGGACTATTTATTCTGCCTTAAATC
AATGGCAAATAAGTCAAGATGACATTTTGTGAATGTAGACTATGGATACACTCCTAATAGATTGATGTAGTCATAAAAGGGGGTCAAGTA
GATGTTTTTCTGTTATGTAAGCAATAATTTTTCCGTGTCTTATTGAGTATGGCTAGCGATTATTTATTACATGCTAGATGGGTTCTTTGC
ATGTGGGTTCCATATAGGTGCAGAAATTTCCTCAGCCACTGGAGGGATTTCGACCATATTTGTCATTTGGATGAGCTGTTATTAGATTGA
AATCTACACATCATTTCATTAAAAATTGTGCCTTAGAAAACGCAAAGCTGTTGCACATGGCGATAAATTATGGATGCAGTACATTGAAGA
GAGATGAAGTCACTTCCAAGTTTCCAAGACTTCTCATGGAGGTGTTTGCTGTTTTACAGGAAAAAATAAAAATAAAAAAAGAAAAAAAGA

>In-frame_KIAA1328_ENST00000591619_chr18_34539398_+_LIMCH1_ENST00000513024_chr4_41663437_+_4533nt
TTAAATCAATACCAATTTTATTCTTTCATAGATGGAGCCAGACATTCTTTTATGTTTGAGGGTACAACACTGAACAAAATAAAACAAAAA
TCATTACCCTCTTGGTGCCTACATTTTAGTGAGATGAGATCAGGTCATGAATAAGGAAAATATATGTTCAATGATTTTTTTTTTTTTTTT
TGAGTCAGAGTCTCGGTCTGTTGCCCAGGCTGGAGTGCAGTGGTGCCATCTCAGCTCACTGCAAGCTCCGCCTTCTGGGTTCACACCATT
CTCCTGCCTCAACCTCTGGAGTAGCTGGGACTACAGGCACCCGCCACCATGCCCGGCTAATTTTTTTTTTTTACATTTTTAGTAGAGACA
GGGTTTCACCGTGTTAGCCAGGATGATCTCGATTTTCTGACCTCGTGATATGCCCACCTCGGCCTCCCAAAGTGCTGGGATTACAGACGT
GAGCCACTGCACCTGGCCTATGTTCAATGATATTGGTGCTGTGGAGAAAAAATAAAGCAGGAAAGAGGCAGATAGTAGCGGGAGGTAGGT
AGGTTGTGGGAAGAGAGAGTTTTGCAATTTCAAGTACCTATATGGTTAGGAAGTGAAAGCTTCAATCAGAAGGTGACATGACATGACATA
TGACATAAGTCCTAAAGTGAGCCATGAAGATATTTGAGGAAAGAGCTTCCTGGGTAGAAGAAATCATACCTGCAGAAGCTATAAGTTAGT
TACAAATTCCCAGGTCAAAAGAAATTATGAATTATAAGAGGTATACAGAACAGAAGCAGCATTTGGATGCCGGATAATATTATTGTATTT
TCCTTCATGTTCTCCTGCGTAGTTTCTGATGAAGAACAATCAGTAGTATACGTTCCAGGAATTTCTGCTGAAGGAAATGTCAGATCAAGA
CACAAGCTGATGAGTCCAAAAGCTGATGTTAAACTTAAGACTTCCAGGGTGACTGATGCTTCAATCTCCATGGAGTCCTTAAAAGGCACA
GGAGATTCAGTAGATGAACAGAATTCCTGCAGGGGAGAAATAAAGAGTGCATCATTGAAGGATTTATGTCTTGAAGACAAAAGACGCATT
GCAAACTTAATTAAAGAACTGGCCAGAGTAAGTGAGGAAAAGGAAGTGACAGAGGAAAGACTGAAAGCTGAGCAGGAGTCATTTGAGAAG
AAGATCAGGCAGTTGGAAGAACAGAATGAACTGATCATCAAAGAAAGGGAAGCTCTTCAGCTACAGTATAGAGAATGCCAAGAACTTCTA
AGCCTGTATCAGAAATATTTATCAGAACAACAGGAGAAGCTCACCATGTCTCTCTCAGAACTTGGTGCTGCTAGAATGCAGGAACAGCAG
GCAACCACTGAGAAAACGGAACCGAATAGTCAAGAGGACAAGAATGATGGTGGAAAATCAAGAAAAGGGAATATAGAACTTGCCTCATCA
GAACCACAGCATTTTACAACAACTGTGACTCGATGCAGCCCGACCGTGGCCTTTGTGGAATTTCCCTCCAGCCCCCAGCTGAAGAATGAT
GTGTCGGAAGAAAAAGACCAGAAGAAACCAGAAAATGAAATGAGTGGAAAGGTGGAGTTGGTGCTGTCACAAAAGGTGGTAAAGCCAAAA
TCTCCAGAACCCGAAGCAACGCTGACATTTCCATTTCTGGACAAAATGCCTGAAGCCAACCAACTACATTTGCCAAATCTCAATTCTCAA
GAGTCGCCTGGCACTGCCAGTGTTCCGCTTAGAGTTCAGAACTCTTGGCGACGATCCCAGTTTTTCTCCCAGTCAGTGGATTCTCCAAGC
AGTGAGAAGTCACCTGTTATGACACCTTTTAAGTTCTGGGCATGGGACCCAGAAGAGGAGCGCAGGCGACAGGAAAAATGGCAACAGGAA
CAGGAACGTTTGCTCCAGGAGAGATACCAGAAGGAGCAGGACAAGCTGAAAGAAGAGTGGGAAAAGGCCCAAAAGGAGGTGGAAGAGGAA
GAACGCAGATACTATGAGGAGGAGCGTAAGATAATTGAAGACACTGTGGTTCCATTTACTGTTTCTTCAAGTTCCGCTGACCAGCTGTCT
ACCTCTTCCTCCATGACTGAAGGCAGTGGGACAATGAATAAGATAGACCTGGGAAACTGTCAAGATGAAAAACAAGACAGAAGATGGAAG
AAATCATTCCAGGGAGATGACAGTGACTTATTGCTGAAGACTAGGGAAAGTGATCGACTGGAGGAGAAGGGCAGCCTAACTGAAGGGGCC
TTGGCTCATTCTGGGAACCCTGTATCAAAAGGAGTCCATGAAGACCATCAGCTGGATACCGAGGCTGGGGCCCCACACTGTGGAACAAAC
CCACAGCTTGCTCAGGATCCATCCCAGAATCAGCAGACATCAAATCCAACGCACAGTTCAGAAGATGTGAAGCCAAAAACCCTCCCGCTG
GATAAAAGCATTAACCATCAGATCGAGTCTCCCAGTGAAAGGCGGAAGTCTATAAGTGGAAAGAAGCTGTGCTCTTCCTGTGGGCTTCCT
TTGGGTAAAGGAGCTGCAATGATCATCGAGACCCTCAATCTCTATTTTCACATCCAGTGTTTCAGGTGTGGAATTTGTAAAGGCCAGCTT
GGAGATGCAGTGAGTGGGACGGATGTTAGGATTCGAAATGGTCTCCTGAACTGTAATGATTGCTACATGCGATCCAGAAGTGCCGGGCAG
CCTACAACATTGTGACACGGCTTTCAAGCTTCCGGATCACTCACCATTTCTTTACTGAGAGTGTCCCCTGGCAACTGCTTAACAAAATCC
CAAGCTCAGGGGCTTCTCAGCATTTACCTAATTTCTGAAAGGCTCTTCTGAAAGGTGGTATCTGTTCTTTCGTAGCACAGTGTTTATGTT
TTTCCTGTTTATTGTTTTGGTTTTTTTTTTTTTTTTGCATTTGCACAGTATACACAAAAGAATATGGGGTTGTAATGATCCTGAATAGCT
CAAAAAAGGTTTTAGCATGGTCAAACAGGCTTATGGTTTAAAATGTGTTATTCTCTTCTTTGGGAATTAGCTAAATGATGCAATAAACCT
GTTTTGTTTTAGAATGTCTAGGAATTAAACACTTTATGTTTACAGAATTGAGCTGCAGAAAGTGCAAGACATGCCAATTTGAGACACACG
GTCTTCTAAGACTGAAGGATAAATTTAATGCATTTCAGAAACTAAACATCACAGCAAGCTCTATCTCTGAGCTATAATTTGTTTTTAATG
CAAAGACACTAGTTTGATAATATATACTGTAATCCTGAAACATTTGTGTTACTTACCTTTGGAGGTAGAAATTATACCAATAAATTATTG
CACCGTTAGTATTAGATTCTGTGTACCTTGGAAGTTATGTCATTAATATAGGCTGGTTCATCAAATAAAGCAAAACCTTGCAATATCAGC
TAGATTTACACTCCGGGACGTTGCCCAAAGGTAGGAAGAAAGCAGAGGGAAATATTTCAGTCATCATTTCCAAAGTCATTATCAAAATCT
GTGAGGAAGTTTAATCTTCCAAAGAGTCAATGTCAGACATCAGGCCTCTGTTGCCTGCTTCTCTCGAGGCACTAGATTAGGAGTCTTCAA
TAAGAGACTTAACATGAGGTATATGGAAGATGAGGCACCGAGATAAGTTCATCATTAGGTGTGAGCACTGCTCACCCTTGCTGGCAAGTT
CTCCTTAAGGGCCTGAAGCACAGGTGTCCAAAGAAAAGCGTTAAGTCCATCTTAATAGAATCTATGTGGTATATGATGTGGTCAGCCCCT
GGTCTGTGATCAGCAAGAACCTACAGCACAGATTATGCCCTGCCCACTTCAATGAATACCTACTCTCCTCCATTCTCCATCACTTTTTTT
GCTATCAAGAACTCCGGACCTTGCCCATGGAGAAGTTTAGAGAGGAACTCTTGTGGAGAGCTGGTTTATTTTCTGCCCTGTGCGACGAGT
TTCAGCTGGCCAAGAAAGGAGTCAAGTTATTAAAAAGCATCACAATGTAGATCTCCAGGCTGGTTTTTTGTTTTTTGTTGTTAAGACTGG
GGAAAGGGGGACTATTTATTCTGCCTTAAATCAATGGCAAATAAGTCAAGATGACATTTTGTGAATGTAGACTATGGATACACTCCTAAT
AGATTGATGTAGTCATAAAAGGGGGTCAAGTAGATGTTTTTCTGTTATGTAAGCAATAATTTTTCCGTGTCTTATTGAGTATGGCTAGCG
ATTATTTATTACATGCTAGATGGGTTCTTTGCATGTGGGTTCCATATAGGTGCAGAAATTTCCTCAGCCACTGGAGGGATTTCGACCATA
TTTGTCATTTGGATGAGCTGTTATTAGATTGAAATCTACACATCATTTCATTAAAAATTGTGCCTTAGAAAACGCAAAGCTGTTGCACAT
GGCGATAAATTATGGATGCAGTACATTGAAGAGAGATGAAGTCACTTCCAAGTTTCCAAGACTTCTCATGGAGGTGTTTGCTGTTTTACA


Top

FusionGenePPI for KIAA1328_LIMCH1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
KIAA1328APC, PCM1, OFD1, CEP135, FGFR1OP, CCDC14, CDC14ALIMCH1ELAVL1, SH3KBP1, APP, HUWE1, CUTC, DIABLO, GABPA, KPNA1, NPM1, TRMT61A, RPA3, RPA2, RPA1, OTUD6B, KLHL15, RFC2, YES1, NAGK, GNB4, UNK, NTRK1, CEP120, ODF2, XPO1, CAPZA2, CDK2, MYH9, PPP1CB, IQGAP1, ANLN, MYO19, MYO18A, CDH1, TRIM25


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for KIAA1328_LIMCH1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for KIAA1328_LIMCH1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneLIMCH1C0236969Substance-Related Disorders1CTD_human
TgeneLIMCH1C0345967Malignant mesothelioma1CTD_human