FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 18642

FusionGeneSummary for KIAA1033_PCDH9

check button Fusion gene summary
Fusion gene informationFusion gene name: KIAA1033_PCDH9
Fusion gene ID: 18642
HgeneTgene
Gene symbol

KIAA1033

PCDH9

Gene ID

23325

5101

Gene nameWASH complex subunit 4protocadherin 9
SynonymsKIAA1033|MRT43|SWIP-
Cytomap

12q23.3

13q21.32

Type of geneprotein-codingprotein-coding
DescriptionWASH complex subunit 4WASH complex subunit 7WASH complex subunit SWIPstrumpellin and WASH-interacting proteinprotocadherin-9cadherin superfamily protein VR4-11
Modification date2018052320180527
UniProtAcc

Q9HC56

Ensembl transtripts involved in fusion geneENST00000332180, ENST00000547171, 
ENST00000544246, ENST00000377865, 
ENST00000456367, ENST00000328454, 
ENST00000377861, 
Fusion gene scores* DoF score5 X 5 X 5=1257 X 5 X 4=140
# samples 67
** MAII scorelog2(6/125*10)=-1.05889368905357
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(7/140*10)=-1
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: KIAA1033 [Title/Abstract] AND PCDH9 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLUSCTCGA-46-6025-01AKIAA1033chr12

105534179

+PCDH9chr13

67477737

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000332180ENST00000544246KIAA1033chr12

105534179

+PCDH9chr13

67477737

-
In-frameENST00000332180ENST00000377865KIAA1033chr12

105534179

+PCDH9chr13

67477737

-
5CDS-intronENST00000332180ENST00000456367KIAA1033chr12

105534179

+PCDH9chr13

67477737

-
5CDS-intronENST00000332180ENST00000328454KIAA1033chr12

105534179

+PCDH9chr13

67477737

-
5CDS-intronENST00000332180ENST00000377861KIAA1033chr12

105534179

+PCDH9chr13

67477737

-
intron-3CDSENST00000547171ENST00000544246KIAA1033chr12

105534179

+PCDH9chr13

67477737

-
intron-3CDSENST00000547171ENST00000377865KIAA1033chr12

105534179

+PCDH9chr13

67477737

-
intron-intronENST00000547171ENST00000456367KIAA1033chr12

105534179

+PCDH9chr13

67477737

-
intron-intronENST00000547171ENST00000328454KIAA1033chr12

105534179

+PCDH9chr13

67477737

-
intron-intronENST00000547171ENST00000377861KIAA1033chr12

105534179

+PCDH9chr13

67477737

-

Top

FusionProtFeatures for KIAA1033_PCDH9


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
KIAA1033

PCDH9

Q9HC56

Lectin that binds to various sugars: galactose > mannose= fucose > N-acetylglucosamine > N-acetylgalactosamine(PubMed:10224141). Acts as a chemoattractant, probably involved inthe regulation of cell migration (PubMed:28301481).{ECO:0000269|PubMed:10224141, ECO:0000269|PubMed:28301481}. Potential calcium-dependent cell-adhesion protein.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgenePCDH9chr12:105534179chr13:67477737ENST00000328454-03143_25201204DomainCadherin 2
TgenePCDH9chr12:105534179chr13:67477737ENST00000328454-03253_35801204DomainCadherin 3
TgenePCDH9chr12:105534179chr13:67477737ENST00000328454-0326_14201204DomainCadherin 1
TgenePCDH9chr12:105534179chr13:67477737ENST00000328454-03365_46901204DomainCadherin 4
TgenePCDH9chr12:105534179chr13:67477737ENST00000328454-03470_57201204DomainCadherin 5
TgenePCDH9chr12:105534179chr13:67477737ENST00000328454-03573_67501204DomainCadherin 6
TgenePCDH9chr12:105534179chr13:67477737ENST00000328454-03679_78401204DomainCadherin 7
TgenePCDH9chr12:105534179chr13:67477737ENST00000456367-04143_252-2291204DomainCadherin 2
TgenePCDH9chr12:105534179chr13:67477737ENST00000456367-04253_358-2291204DomainCadherin 3
TgenePCDH9chr12:105534179chr13:67477737ENST00000456367-0426_142-2291204DomainCadherin 1
TgenePCDH9chr12:105534179chr13:67477737ENST00000456367-04365_469-2291204DomainCadherin 4
TgenePCDH9chr12:105534179chr13:67477737ENST00000456367-04470_572-2291204DomainCadherin 5
TgenePCDH9chr12:105534179chr13:67477737ENST00000456367-04573_675-2291204DomainCadherin 6
TgenePCDH9chr12:105534179chr13:67477737ENST00000456367-04679_784-2291204DomainCadherin 7
TgenePCDH9chr12:105534179chr13:67477737ENST00000328454-0324_81401204Topological domainExtracellular
TgenePCDH9chr12:105534179chr13:67477737ENST00000328454-03836_123701204Topological domainCytoplasmic
TgenePCDH9chr12:105534179chr13:67477737ENST00000456367-0424_814-2291204Topological domainExtracellular
TgenePCDH9chr12:105534179chr13:67477737ENST00000456367-04836_1237-2291204Topological domainCytoplasmic
TgenePCDH9chr12:105534179chr13:67477737ENST00000328454-03815_83501204TransmembraneHelical
TgenePCDH9chr12:105534179chr13:67477737ENST00000456367-04815_835-2291204TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneKIAA1033chr12:105534179chr13:67477737ENST00000332180+16331135_11615201174Coiled coilOntology_term=ECO:0000255
TgenePCDH9chr12:105534179chr13:67477737ENST00000377865-04143_25210121238DomainCadherin 2
TgenePCDH9chr12:105534179chr13:67477737ENST00000377865-04253_35810121238DomainCadherin 3
TgenePCDH9chr12:105534179chr13:67477737ENST00000377865-0426_14210121238DomainCadherin 1
TgenePCDH9chr12:105534179chr13:67477737ENST00000377865-04365_46910121238DomainCadherin 4
TgenePCDH9chr12:105534179chr13:67477737ENST00000377865-04470_57210121238DomainCadherin 5
TgenePCDH9chr12:105534179chr13:67477737ENST00000377865-04573_67510121238DomainCadherin 6
TgenePCDH9chr12:105534179chr13:67477737ENST00000377865-04679_78410121238DomainCadherin 7
TgenePCDH9chr12:105534179chr13:67477737ENST00000544246-15143_25210121238DomainCadherin 2
TgenePCDH9chr12:105534179chr13:67477737ENST00000544246-15253_35810121238DomainCadherin 3
TgenePCDH9chr12:105534179chr13:67477737ENST00000544246-1526_14210121238DomainCadherin 1
TgenePCDH9chr12:105534179chr13:67477737ENST00000544246-15365_46910121238DomainCadherin 4
TgenePCDH9chr12:105534179chr13:67477737ENST00000544246-15470_57210121238DomainCadherin 5
TgenePCDH9chr12:105534179chr13:67477737ENST00000544246-15573_67510121238DomainCadherin 6
TgenePCDH9chr12:105534179chr13:67477737ENST00000544246-15679_78410121238DomainCadherin 7
TgenePCDH9chr12:105534179chr13:67477737ENST00000377865-0424_81410121238Topological domainExtracellular
TgenePCDH9chr12:105534179chr13:67477737ENST00000377865-04836_123710121238Topological domainCytoplasmic
TgenePCDH9chr12:105534179chr13:67477737ENST00000544246-1524_81410121238Topological domainExtracellular
TgenePCDH9chr12:105534179chr13:67477737ENST00000544246-15836_123710121238Topological domainCytoplasmic
TgenePCDH9chr12:105534179chr13:67477737ENST00000377865-04815_83510121238TransmembraneHelical
TgenePCDH9chr12:105534179chr13:67477737ENST00000544246-15815_83510121238TransmembraneHelical


Top

FusionGeneSequence for KIAA1033_PCDH9


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_KIAA1033_ENST00000332180_chr12_105534179_+_PCDH9_ENST00000544246_chr13_67477737_-_746aa
MAVETLSPDWEFDRVDDGSQKIHAEVQLKNYGKFLEEYTSQLRRIEDALDDSIGDVWDFNLDPIALKLLPYEQSSLLELIKTENKVLNKV
ITVYAALCCEIKKLKYEAETKFYNGLLFYGEGATDASMVEGDCQIQMGRFISFLQELSCFVTRCYEVVMNVVHQLAALYISNKIAPKIIE
TTGVHFQTMYEHLGELLTVLLTLDEIIDNHITLKDHWTMYKRLLKSVHHNPSKFGIQEEKLKPFEKFLLKLEGQLLDGMIFQACIEQQFD
SLNGGVSVSKNSTFAEEFAHSIRSIFANVEAKLGEPSEIDQRDKYVGICGLFVLHFQIFRTIDKKFYKSLLDICKKVPAITLTANIIWFP
DNFLIQKIPAAAKLLDRKSLQAIKIHRDTFLQQKAQSLTKDVQSYYVFVSSWMMKMESILSKEQRMDKFAEDLTNRCNVFIQGFLYAYSI
STIIKTTMNLYMSMQKPMTKTSVKALCRLVELLKAIEHMFYRRSMVVADSVSHITQHLQHQALHSISVAKCNSHSKSDNIPVTPQKCPSS
TGFHIQENEESHYESQRRVTFHLPDGSQESCSDSGLGDHEPVGSGTLISHPLPLVQPQDEFYDQASPDKRTEADGNSDPNSDGPLGPRGL
AEATEMCTQECLVLGHSDNCWMPPGLGPYQHPKSPLSTFAPQKEWVKKDKLVNGHTLTRAWKEDSNRNQFNDRKQYGSNEGHFNNGSHMT

>In-frame_KIAA1033_ENST00000332180_chr12_105534179_+_PCDH9_ENST00000377865_chr13_67477737_-_746aa
MAVETLSPDWEFDRVDDGSQKIHAEVQLKNYGKFLEEYTSQLRRIEDALDDSIGDVWDFNLDPIALKLLPYEQSSLLELIKTENKVLNKV
ITVYAALCCEIKKLKYEAETKFYNGLLFYGEGATDASMVEGDCQIQMGRFISFLQELSCFVTRCYEVVMNVVHQLAALYISNKIAPKIIE
TTGVHFQTMYEHLGELLTVLLTLDEIIDNHITLKDHWTMYKRLLKSVHHNPSKFGIQEEKLKPFEKFLLKLEGQLLDGMIFQACIEQQFD
SLNGGVSVSKNSTFAEEFAHSIRSIFANVEAKLGEPSEIDQRDKYVGICGLFVLHFQIFRTIDKKFYKSLLDICKKVPAITLTANIIWFP
DNFLIQKIPAAAKLLDRKSLQAIKIHRDTFLQQKAQSLTKDVQSYYVFVSSWMMKMESILSKEQRMDKFAEDLTNRCNVFIQGFLYAYSI
STIIKTTMNLYMSMQKPMTKTSVKALCRLVELLKAIEHMFYRRSMVVADSVSHITQHLQHQALHSISVAKCNSHSKSDNIPVTPQKCPSS
TGFHIQENEESHYESQRRVTFHLPDGSQESCSDSGLGDHEPVGSGTLISHPLPLVQPQDEFYDQASPDKRTEADGNSDPNSDGPLGPRGL
AEATEMCTQECLVLGHSDNCWMPPGLGPYQHPKSPLSTFAPQKEWVKKDKLVNGHTLTRAWKEDSNRNQFNDRKQYGSNEGHFNNGSHMT


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_KIAA1033_ENST00000332180_chr12_105534179_+_PCDH9_ENST00000544246_chr13_67477737_-_2238nt
ATGGCGGTGGAGACTCTGTCCCCGGACTGGGAGTTTGACCGCGTTGACGACGGCTCGCAGAAAATTCATGCCGAAGTCCAACTTAAGAAT
TATGGGAAATTTCTTGAGGAGTATACCTCTCAACTGAGAAGAATTGAGGACGCTCTGGATGACTCAATTGGAGATGTTTGGGATTTCAAT
CTTGATCCTATAGCATTAAAGCTTTTGCCTTATGAACAGTCCTCTCTTTTGGAACTCATAAAGACTGAAAACAAGGTCTTAAACAAAGTC
ATCACTGTTTATGCTGCACTTTGTTGTGAAATCAAGAAATTAAAATATGAGGCTGAAACTAAATTTTACAATGGTCTCTTGTTTTATGGA
GAAGGAGCTACAGATGCCAGCATGGTGGAAGGTGATTGCCAAATTCAAATGGGGAGATTTATTTCATTCTTACAGGAACTGTCTTGCTTT
GTTACGAGGTGCTATGAAGTGGTGATGAACGTAGTCCACCAGTTGGCTGCCCTCTATATCAGTAACAAGATTGCACCCAAAATTATAGAG
ACAACTGGAGTTCATTTTCAGACTATGTATGAGCACTTGGGAGAACTGCTAACAGTTTTGCTCACCCTGGATGAAATTATTGATAATCAT
ATCACACTGAAAGACCACTGGACTATGTACAAAAGGTTACTGAAATCTGTCCATCACAATCCTTCAAAATTTGGAATTCAGGAAGAAAAA
TTAAAGCCATTTGAAAAGTTCTTGCTGAAGCTAGAAGGGCAATTACTGGATGGAATGATATTCCAGGCCTGTATAGAACAACAATTTGAT
TCTCTCAATGGAGGAGTATCTGTGTCAAAAAATAGTACTTTTGCTGAGGAATTTGCACATAGTATTCGGTCAATTTTTGCAAATGTAGAA
GCCAAACTTGGAGAACCTTCTGAAATTGACCAGAGAGACAAGTATGTTGGAATTTGTGGACTCTTTGTATTGCACTTTCAGATTTTTCGA
ACTATTGATAAAAAGTTTTATAAGTCTTTATTGGACATTTGTAAGAAGGTACCAGCCATCACTCTAACTGCTAATATTATTTGGTTTCCT
GATAATTTTCTGATCCAGAAAATACCAGCAGCTGCCAAACTGCTAGACAGAAAAAGTCTTCAAGCCATTAAAATACACAGGGATACTTTT
CTACAACAGAAAGCTCAATCACTTACCAAAGATGTACAGTCTTACTACGTCTTTGTGAGCTCATGGATGATGAAAATGGAATCTATTTTG
TCTAAAGAGCAGAGAATGGATAAATTTGCTGAAGATCTCACCAATAGATGTAATGTTTTTATACAGGGCTTCTTGTATGCATATAGTATT
AGTACCATTATTAAAACCACAATGAATCTCTACATGTCCATGCAAAAGCCAATGACCAAAACCTCAGTTAAGGCATTGTGCAGGCTTGTT
GAACTTCTCAAGGCAATAGAGCATATGTTCTACAGGAGAAGCATGGTTGTGGCTGATTCAGTTTCACATATAACACAGCACCTTCAACAT
CAGGCTCTTCATTCTATTTCTGTGGCCAAGTGTAACTCACACAGCAAAAGTGACAATATTCCTGTCACTCCTCAGAAATGTCCCAGCTCC
ACGGGTTTCCACATTCAGGAGAATGAAGAAAGCCATTACGAGTCGCAGCGCCGTGTTACGTTTCATCTCCCTGATGGCTCCCAGGAAAGC
TGCAGTGACAGTGGTCTAGGAGACCATGAGCCGGTGGGTAGTGGAACCCTGATCTCACACCCTCTTCCTCTGGTTCAGCCACAGGACGAA
TTCTATGACCAGGCCTCTCCGGACAAGAGGACTGAAGCAGATGGCAACTCTGATCCCAACTCTGATGGGCCTTTGGGTCCCCGAGGATTA
GCTGAAGCTACAGAGATGTGCACTCAAGAGTGCTTGGTTTTGGGTCACTCTGATAATTGCTGGATGCCTCCTGGCTTGGGTCCATATCAA
CACCCCAAATCTCCTCTCTCAACCTTTGCACCCCAGAAAGAATGGGTGAAGAAGGACAAGCTTGTGAATGGGCACACCCTGACCAGAGCC
TGGAAAGAAGACAGCAACAGGAACCAGTTCAATGACCGTAAGCAGTATGGCTCCAATGAAGGCCATTTCAACAATGGCAGCCACATGACA

>In-frame_KIAA1033_ENST00000332180_chr12_105534179_+_PCDH9_ENST00000377865_chr13_67477737_-_2238nt
ATGGCGGTGGAGACTCTGTCCCCGGACTGGGAGTTTGACCGCGTTGACGACGGCTCGCAGAAAATTCATGCCGAAGTCCAACTTAAGAAT
TATGGGAAATTTCTTGAGGAGTATACCTCTCAACTGAGAAGAATTGAGGACGCTCTGGATGACTCAATTGGAGATGTTTGGGATTTCAAT
CTTGATCCTATAGCATTAAAGCTTTTGCCTTATGAACAGTCCTCTCTTTTGGAACTCATAAAGACTGAAAACAAGGTCTTAAACAAAGTC
ATCACTGTTTATGCTGCACTTTGTTGTGAAATCAAGAAATTAAAATATGAGGCTGAAACTAAATTTTACAATGGTCTCTTGTTTTATGGA
GAAGGAGCTACAGATGCCAGCATGGTGGAAGGTGATTGCCAAATTCAAATGGGGAGATTTATTTCATTCTTACAGGAACTGTCTTGCTTT
GTTACGAGGTGCTATGAAGTGGTGATGAACGTAGTCCACCAGTTGGCTGCCCTCTATATCAGTAACAAGATTGCACCCAAAATTATAGAG
ACAACTGGAGTTCATTTTCAGACTATGTATGAGCACTTGGGAGAACTGCTAACAGTTTTGCTCACCCTGGATGAAATTATTGATAATCAT
ATCACACTGAAAGACCACTGGACTATGTACAAAAGGTTACTGAAATCTGTCCATCACAATCCTTCAAAATTTGGAATTCAGGAAGAAAAA
TTAAAGCCATTTGAAAAGTTCTTGCTGAAGCTAGAAGGGCAATTACTGGATGGAATGATATTCCAGGCCTGTATAGAACAACAATTTGAT
TCTCTCAATGGAGGAGTATCTGTGTCAAAAAATAGTACTTTTGCTGAGGAATTTGCACATAGTATTCGGTCAATTTTTGCAAATGTAGAA
GCCAAACTTGGAGAACCTTCTGAAATTGACCAGAGAGACAAGTATGTTGGAATTTGTGGACTCTTTGTATTGCACTTTCAGATTTTTCGA
ACTATTGATAAAAAGTTTTATAAGTCTTTATTGGACATTTGTAAGAAGGTACCAGCCATCACTCTAACTGCTAATATTATTTGGTTTCCT
GATAATTTTCTGATCCAGAAAATACCAGCAGCTGCCAAACTGCTAGACAGAAAAAGTCTTCAAGCCATTAAAATACACAGGGATACTTTT
CTACAACAGAAAGCTCAATCACTTACCAAAGATGTACAGTCTTACTACGTCTTTGTGAGCTCATGGATGATGAAAATGGAATCTATTTTG
TCTAAAGAGCAGAGAATGGATAAATTTGCTGAAGATCTCACCAATAGATGTAATGTTTTTATACAGGGCTTCTTGTATGCATATAGTATT
AGTACCATTATTAAAACCACAATGAATCTCTACATGTCCATGCAAAAGCCAATGACCAAAACCTCAGTTAAGGCATTGTGCAGGCTTGTT
GAACTTCTCAAGGCAATAGAGCATATGTTCTACAGGAGAAGCATGGTTGTGGCTGATTCAGTTTCACATATAACACAGCACCTTCAACAT
CAGGCTCTTCATTCTATTTCTGTGGCCAAGTGTAACTCACACAGCAAAAGTGACAATATTCCTGTCACTCCTCAGAAATGTCCCAGCTCC
ACGGGTTTCCACATTCAGGAGAATGAAGAAAGCCATTACGAGTCGCAGCGCCGTGTTACGTTTCATCTCCCTGATGGCTCCCAGGAAAGC
TGCAGTGACAGTGGTCTAGGAGACCATGAGCCGGTGGGTAGTGGAACCCTGATCTCACACCCTCTTCCTCTGGTTCAGCCACAGGACGAA
TTCTATGACCAGGCCTCTCCGGACAAGAGGACTGAAGCAGATGGCAACTCTGATCCCAACTCTGATGGGCCTTTGGGTCCCCGAGGATTA
GCTGAAGCTACAGAGATGTGCACTCAAGAGTGCTTGGTTTTGGGTCACTCTGATAATTGCTGGATGCCTCCTGGCTTGGGTCCATATCAA
CACCCCAAATCTCCTCTCTCAACCTTTGCACCCCAGAAAGAATGGGTGAAGAAGGACAAGCTTGTGAATGGGCACACCCTGACCAGAGCC
TGGAAAGAAGACAGCAACAGGAACCAGTTCAATGACCGTAAGCAGTATGGCTCCAATGAAGGCCATTTCAACAATGGCAGCCACATGACA


* Fusion transcript sequences (Full-length transcript).
>In-frame_KIAA1033_ENST00000332180_chr12_105534179_+_PCDH9_ENST00000544246_chr13_67477737_-_4145nt
AAGTCACGTGCTGTGACAGTAGCTGGGGTGAGGCCGTCGTCGCCGCACGGGCTGGTTGGGGCTGTGTCTGTGGGAGGCGCCGGGGTGATG
GCGGTGGAGACTCTGTCCCCGGACTGGGAGTTTGACCGCGTTGACGACGGCTCGCAGAAAATTCATGCCGAAGTCCAACTTAAGAATTAT
GGGAAATTTCTTGAGGAGTATACCTCTCAACTGAGAAGAATTGAGGACGCTCTGGATGACTCAATTGGAGATGTTTGGGATTTCAATCTT
GATCCTATAGCATTAAAGCTTTTGCCTTATGAACAGTCCTCTCTTTTGGAACTCATAAAGACTGAAAACAAGGTCTTAAACAAAGTCATC
ACTGTTTATGCTGCACTTTGTTGTGAAATCAAGAAATTAAAATATGAGGCTGAAACTAAATTTTACAATGGTCTCTTGTTTTATGGAGAA
GGAGCTACAGATGCCAGCATGGTGGAAGGTGATTGCCAAATTCAAATGGGGAGATTTATTTCATTCTTACAGGAACTGTCTTGCTTTGTT
ACGAGGTGCTATGAAGTGGTGATGAACGTAGTCCACCAGTTGGCTGCCCTCTATATCAGTAACAAGATTGCACCCAAAATTATAGAGACA
ACTGGAGTTCATTTTCAGACTATGTATGAGCACTTGGGAGAACTGCTAACAGTTTTGCTCACCCTGGATGAAATTATTGATAATCATATC
ACACTGAAAGACCACTGGACTATGTACAAAAGGTTACTGAAATCTGTCCATCACAATCCTTCAAAATTTGGAATTCAGGAAGAAAAATTA
AAGCCATTTGAAAAGTTCTTGCTGAAGCTAGAAGGGCAATTACTGGATGGAATGATATTCCAGGCCTGTATAGAACAACAATTTGATTCT
CTCAATGGAGGAGTATCTGTGTCAAAAAATAGTACTTTTGCTGAGGAATTTGCACATAGTATTCGGTCAATTTTTGCAAATGTAGAAGCC
AAACTTGGAGAACCTTCTGAAATTGACCAGAGAGACAAGTATGTTGGAATTTGTGGACTCTTTGTATTGCACTTTCAGATTTTTCGAACT
ATTGATAAAAAGTTTTATAAGTCTTTATTGGACATTTGTAAGAAGGTACCAGCCATCACTCTAACTGCTAATATTATTTGGTTTCCTGAT
AATTTTCTGATCCAGAAAATACCAGCAGCTGCCAAACTGCTAGACAGAAAAAGTCTTCAAGCCATTAAAATACACAGGGATACTTTTCTA
CAACAGAAAGCTCAATCACTTACCAAAGATGTACAGTCTTACTACGTCTTTGTGAGCTCATGGATGATGAAAATGGAATCTATTTTGTCT
AAAGAGCAGAGAATGGATAAATTTGCTGAAGATCTCACCAATAGATGTAATGTTTTTATACAGGGCTTCTTGTATGCATATAGTATTAGT
ACCATTATTAAAACCACAATGAATCTCTACATGTCCATGCAAAAGCCAATGACCAAAACCTCAGTTAAGGCATTGTGCAGGCTTGTTGAA
CTTCTCAAGGCAATAGAGCATATGTTCTACAGGAGAAGCATGGTTGTGGCTGATTCAGTTTCACATATAACACAGCACCTTCAACATCAG
GCTCTTCATTCTATTTCTGTGGCCAAGTGTAACTCACACAGCAAAAGTGACAATATTCCTGTCACTCCTCAGAAATGTCCCAGCTCCACG
GGTTTCCACATTCAGGAGAATGAAGAAAGCCATTACGAGTCGCAGCGCCGTGTTACGTTTCATCTCCCTGATGGCTCCCAGGAAAGCTGC
AGTGACAGTGGTCTAGGAGACCATGAGCCGGTGGGTAGTGGAACCCTGATCTCACACCCTCTTCCTCTGGTTCAGCCACAGGACGAATTC
TATGACCAGGCCTCTCCGGACAAGAGGACTGAAGCAGATGGCAACTCTGATCCCAACTCTGATGGGCCTTTGGGTCCCCGAGGATTAGCT
GAAGCTACAGAGATGTGCACTCAAGAGTGCTTGGTTTTGGGTCACTCTGATAATTGCTGGATGCCTCCTGGCTTGGGTCCATATCAACAC
CCCAAATCTCCTCTCTCAACCTTTGCACCCCAGAAAGAATGGGTGAAGAAGGACAAGCTTGTGAATGGGCACACCCTGACCAGAGCCTGG
AAAGAAGACAGCAACAGGAACCAGTTCAATGACCGTAAGCAGTATGGCTCCAATGAAGGCCATTTCAACAATGGCAGCCACATGACAGAC
ATTCCTCTGGCAAATCTGAAGTCTTATAAGCAAGCAGGAGGTGCTACTGAGAGTCCTAAGGAGCACCAACTCTAAGAAAAGGCTATATGG
GACCTAATAACTTTAAATAGACATGCTAATACCGTGTGCGTCAGAGCTTTATGTATTCAATAGATCTCTACAACTATGCCCCTTCTAGCA
GGGATACCTATAACTTTGTGTTAGCACCATGGAGAATACAATGTTTTTGCAACATATGAGAGAAGATAGTTCTAGCCATGCAATTTTGTT
TACTAGAATTGATTACACTCTCCAGAGATCTCTCCATTGTGCAAATTTTTTTTATTATTGCATTTTATTTTGACCCTGGACTGCTGCTAT
GAACAATAGAATATGCATTTGGAAAGTAAGAAAGTTTCATGGATTAGAGTGACTGAAAAACATATCCAGTTAGAAAATTGTGCTTTTTTT
TTTTTTTTTTTTTTTTTTTGTCATTGATTTGTGCTGGGACTGCTATACTTGACATTATACTGCAAACAAAACTTAAAGAGATAAGCATTA
AACCTATTGTGCTGTTAACAACGTTAGTGGACACTTGTAAGTCAATCAGTGTTAAAGTATTTGTAAATAGAAGCAAGCTATTATTAACAA
CTTTTGTGTACTTATAATGTTCACCTAAAAATGTTGTAGCATAATTCTGTGTTTTATGGTTGCTTCTGTCCTTCTTTTTATTTACCTCTT
TGTTGTTATTTTTGTTGTTTCTTTCAGTGAGGTGTTTCTGTGTTAGTAGTCTGTCTTGACACACATTGTTCAAACAATCTCAAGCACTTG
TGTTTAAAAAAGGTTCTGAAATCTTGCTTCTCATATGATAGCTTATGATGCCGGAATTCTGTAAACAATAAAGATGAAAGAAAAAATGAA
AACTTTATACAAAAAAGGACTTCTGCAAAAGCTTGGAAATTCAGAACCTATTTTTTATCATCTTATTTTCAAAGTAGGCAAAAGCAAAAT
CACTTAATTAGTACCATTAAGTGAGAGAGTAATGGAAAACTGTTATCCATCAAAAGTGATATAATATCCTGTACTTGTCACTCATGTAAA
ACTAATGTATCAAAATTAGCATATATGGAAGAAAAATCACTATTCAAAAATAGTTTCAATTGGGCAAATGTGTGTCTACAACTTTGTTGA
AATGGCAGAGTCTGTGTTGATCCTCATATACAATAATGTTGTTGTAACACAAGTGTTATTAGACCATAGCCACAAAATATTTAATGTGTT
GTGCCTTCATGATGTAACAGAACATTCTCCAGGTAGGGTAGTTGGGGGAAATAAAGGGATAAATCTCTAATTATTGCTGTTTAACTGTTT
GTTATCATAGTTGGTCAATGCCTGGCAGGTACCAGCATATTGTCACTTAGGTCAAACCAATAAAGTGACAACTAATGTTAATAAGATCTC
AGTTGCACGTGCAAACAAATCCAAATTCGAACATTCTTAGGAGGTTTTTGTTAAGGCATGACAGATGATTTAAACAAATAAATAGCATGC
AACAAAATGTCTTTATTGAAAGAAGTGGAAGTTATCTTAATGCCACGGTTCACCATCAATTTAAAAGTAAAAAAAACAAAAAAAAAACAA
AAAATTTAAAAAAAAGGTTTGCTAATCTGATAGTTAATTTGTTCTTACCAAAAAATAAAATTACTTTGTAAATAGCAGTTCACATTTTTC
CACAGTATAATGGAAAATAATGGGTAGGGGTGCATTGCTTATTGAAGTACATTTTTGTCGGTTTGTGAGGGGTGTTTGATGACTTTGACA
GAATAAATATCTAAACAATTATCCTTGTTACTGCTTTGCCAGTTCTACGTTATTTACAATTATTCAGCTCTTGCAATAAATGTTCTGAAT

>In-frame_KIAA1033_ENST00000332180_chr12_105534179_+_PCDH9_ENST00000377865_chr13_67477737_-_4143nt
AAGTCACGTGCTGTGACAGTAGCTGGGGTGAGGCCGTCGTCGCCGCACGGGCTGGTTGGGGCTGTGTCTGTGGGAGGCGCCGGGGTGATG
GCGGTGGAGACTCTGTCCCCGGACTGGGAGTTTGACCGCGTTGACGACGGCTCGCAGAAAATTCATGCCGAAGTCCAACTTAAGAATTAT
GGGAAATTTCTTGAGGAGTATACCTCTCAACTGAGAAGAATTGAGGACGCTCTGGATGACTCAATTGGAGATGTTTGGGATTTCAATCTT
GATCCTATAGCATTAAAGCTTTTGCCTTATGAACAGTCCTCTCTTTTGGAACTCATAAAGACTGAAAACAAGGTCTTAAACAAAGTCATC
ACTGTTTATGCTGCACTTTGTTGTGAAATCAAGAAATTAAAATATGAGGCTGAAACTAAATTTTACAATGGTCTCTTGTTTTATGGAGAA
GGAGCTACAGATGCCAGCATGGTGGAAGGTGATTGCCAAATTCAAATGGGGAGATTTATTTCATTCTTACAGGAACTGTCTTGCTTTGTT
ACGAGGTGCTATGAAGTGGTGATGAACGTAGTCCACCAGTTGGCTGCCCTCTATATCAGTAACAAGATTGCACCCAAAATTATAGAGACA
ACTGGAGTTCATTTTCAGACTATGTATGAGCACTTGGGAGAACTGCTAACAGTTTTGCTCACCCTGGATGAAATTATTGATAATCATATC
ACACTGAAAGACCACTGGACTATGTACAAAAGGTTACTGAAATCTGTCCATCACAATCCTTCAAAATTTGGAATTCAGGAAGAAAAATTA
AAGCCATTTGAAAAGTTCTTGCTGAAGCTAGAAGGGCAATTACTGGATGGAATGATATTCCAGGCCTGTATAGAACAACAATTTGATTCT
CTCAATGGAGGAGTATCTGTGTCAAAAAATAGTACTTTTGCTGAGGAATTTGCACATAGTATTCGGTCAATTTTTGCAAATGTAGAAGCC
AAACTTGGAGAACCTTCTGAAATTGACCAGAGAGACAAGTATGTTGGAATTTGTGGACTCTTTGTATTGCACTTTCAGATTTTTCGAACT
ATTGATAAAAAGTTTTATAAGTCTTTATTGGACATTTGTAAGAAGGTACCAGCCATCACTCTAACTGCTAATATTATTTGGTTTCCTGAT
AATTTTCTGATCCAGAAAATACCAGCAGCTGCCAAACTGCTAGACAGAAAAAGTCTTCAAGCCATTAAAATACACAGGGATACTTTTCTA
CAACAGAAAGCTCAATCACTTACCAAAGATGTACAGTCTTACTACGTCTTTGTGAGCTCATGGATGATGAAAATGGAATCTATTTTGTCT
AAAGAGCAGAGAATGGATAAATTTGCTGAAGATCTCACCAATAGATGTAATGTTTTTATACAGGGCTTCTTGTATGCATATAGTATTAGT
ACCATTATTAAAACCACAATGAATCTCTACATGTCCATGCAAAAGCCAATGACCAAAACCTCAGTTAAGGCATTGTGCAGGCTTGTTGAA
CTTCTCAAGGCAATAGAGCATATGTTCTACAGGAGAAGCATGGTTGTGGCTGATTCAGTTTCACATATAACACAGCACCTTCAACATCAG
GCTCTTCATTCTATTTCTGTGGCCAAGTGTAACTCACACAGCAAAAGTGACAATATTCCTGTCACTCCTCAGAAATGTCCCAGCTCCACG
GGTTTCCACATTCAGGAGAATGAAGAAAGCCATTACGAGTCGCAGCGCCGTGTTACGTTTCATCTCCCTGATGGCTCCCAGGAAAGCTGC
AGTGACAGTGGTCTAGGAGACCATGAGCCGGTGGGTAGTGGAACCCTGATCTCACACCCTCTTCCTCTGGTTCAGCCACAGGACGAATTC
TATGACCAGGCCTCTCCGGACAAGAGGACTGAAGCAGATGGCAACTCTGATCCCAACTCTGATGGGCCTTTGGGTCCCCGAGGATTAGCT
GAAGCTACAGAGATGTGCACTCAAGAGTGCTTGGTTTTGGGTCACTCTGATAATTGCTGGATGCCTCCTGGCTTGGGTCCATATCAACAC
CCCAAATCTCCTCTCTCAACCTTTGCACCCCAGAAAGAATGGGTGAAGAAGGACAAGCTTGTGAATGGGCACACCCTGACCAGAGCCTGG
AAAGAAGACAGCAACAGGAACCAGTTCAATGACCGTAAGCAGTATGGCTCCAATGAAGGCCATTTCAACAATGGCAGCCACATGACAGAC
ATTCCTCTGGCAAATCTGAAGTCTTATAAGCAAGCAGGAGGTGCTACTGAGAGTCCTAAGGAGCACCAACTCTAAGAAAAGGCTATATGG
GACCTAATAACTTTAAATAGACATGCTAATACCGTGTGCGTCAGAGCTTTATGTATTCAATAGATCTCTACAACTATGCCCCTTCTAGCA
GGGATACCTATAACTTTGTGTTAGCACCATGGAGAATACAATGTTTTTGCAACATATGAGAGAAGATAGTTCTAGCCATGCAATTTTGTT
TACTAGAATTGATTACACTCTCCAGAGATCTCTCCATTGTGCAAATTTTTTTTATTATTGCATTTTATTTTGACCCTGGACTGCTGCTAT
GAACAATAGAATATGCATTTGGAAAGTAAGAAAGTTTCATGGATTAGAGTGACTGAAAAACATATCCAGTTAGAAAATTGTGCTTTTTTT
TTTTTTTTTTTTTTTTTTTGTCATTGATTTGTGCTGGGACTGCTATACTTGACATTATACTGCAAACAAAACTTAAAGAGATAAGCATTA
AACCTATTGTGCTGTTAACAACGTTAGTGGACACTTGTAAGTCAATCAGTGTTAAAGTATTTGTAAATAGAAGCAAGCTATTATTAACAA
CTTTTGTGTACTTATAATGTTCACCTAAAAATGTTGTAGCATAATTCTGTGTTTTATGGTTGCTTCTGTCCTTCTTTTTATTTACCTCTT
TGTTGTTATTTTTGTTGTTTCTTTCAGTGAGGTGTTTCTGTGTTAGTAGTCTGTCTTGACACACATTGTTCAAACAATCTCAAGCACTTG
TGTTTAAAAAAGGTTCTGAAATCTTGCTTCTCATATGATAGCTTATGATGCCGGAATTCTGTAAACAATAAAGATGAAAGAAAAAATGAA
AACTTTATACAAAAAAGGACTTCTGCAAAAGCTTGGAAATTCAGAACCTATTTTTTATCATCTTATTTTCAAAGTAGGCAAAAGCAAAAT
CACTTAATTAGTACCATTAAGTGAGAGAGTAATGGAAAACTGTTATCCATCAAAAGTGATATAATATCCTGTACTTGTCACTCATGTAAA
ACTAATGTATCAAAATTAGCATATATGGAAGAAAAATCACTATTCAAAAATAGTTTCAATTGGGCAAATGTGTGTCTACAACTTTGTTGA
AATGGCAGAGTCTGTGTTGATCCTCATATACAATAATGTTGTTGTAACACAAGTGTTATTAGACCATAGCCACAAAATATTTAATGTGTT
GTGCCTTCATGATGTAACAGAACATTCTCCAGGTAGGGTAGTTGGGGGAAATAAAGGGATAAATCTCTAATTATTGCTGTTTAACTGTTT
GTTATCATAGTTGGTCAATGCCTGGCAGGTACCAGCATATTGTCACTTAGGTCAAACCAATAAAGTGACAACTAATGTTAATAAGATCTC
AGTTGCACGTGCAAACAAATCCAAATTCGAACATTCTTAGGAGGTTTTTGTTAAGGCATGACAGATGATTTAAACAAATAAATAGCATGC
AACAAAATGTCTTTATTGAAAGAAGTGGAAGTTATCTTAATGCCACGGTTCACCATCAATTTAAAAGTAAAAAAAACAAAAAAAAAACAA
AAAATTTAAAAAAAAGGTTTGCTAATCTGATAGTTAATTTGTTCTTACCAAAAAATAAAATTACTTTGTAAATAGCAGTTCACATTTTTC
CACAGTATAATGGAAAATAATGGGTAGGGGTGCATTGCTTATTGAAGTACATTTTTGTCGGTTTGTGAGGGGTGTTTGATGACTTTGACA
GAATAAATATCTAAACAATTATCCTTGTTACTGCTTTGCCAGTTCTACGTTATTTACAATTATTCAGCTCTTGCAATAAATGTTCTGAAT


Top

FusionGenePPI for KIAA1033_PCDH9


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
KIAA1033FAM21C, WASH1, KIAA0196, CCDC53, FAM21A, SMAD2, ANKFY1, CD2AP, ELP2, LAMB1, NUP50, SNRNP200, ROCK1, USP34, WDHD1, RPA3, RPA2, RPA1, CAPZA2, CSNK2A1, RTN4, NTRK1, CEP128, XPO1, VPS26A, VPS26B, FKBP15, SEC22B, TCEANC2, LDLRAD4, MTNR1APCDH9RYK, BCL6, ELAVL1, MEOX2, HLA-DPA1, NXPH2, CEACAM21, LGALS9, VSIG4, LPPR2, EVA1C, PCDHGB1, TPCN2, IKBIP


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for KIAA1033_PCDH9


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for KIAA1033_PCDH9


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgenePCDH9C1510586Autism Spectrum Disorders1CTD_human