FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 18568

FusionGeneSummary for KIAA0232_INPP4B

check button Fusion gene summary
Fusion gene informationFusion gene name: KIAA0232_INPP4B
Fusion gene ID: 18568
HgeneTgene
Gene symbol

KIAA0232

INPP4B

Gene ID

9778

8821

Gene nameKIAA0232inositol polyphosphate-4-phosphatase type II B
Synonyms--
Cytomap

4p16.1

4q31.21

Type of geneprotein-codingprotein-coding
Descriptionuncharacterized protein KIAA0232type II inositol 3,4-bisphosphate 4-phosphataseinositol polyphosphate 4-phosphatase II; 4-phosphatase IIinositol polyphosphate-4-phosphatase, type II, 105kDa
Modification date2018051920180523
UniProtAcc

Q92628

O15327

Ensembl transtripts involved in fusion geneENST00000503278, ENST00000425103, 
ENST00000307659, 
ENST00000513000, 
ENST00000509777, ENST00000262992, 
ENST00000308502, ENST00000508116, 
ENST00000507861, ENST00000506217, 
ENST00000508084, 
Fusion gene scores* DoF score8 X 7 X 4=2249 X 7 X 6=378
# samples 89
** MAII scorelog2(8/224*10)=-1.48542682717024
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(9/378*10)=-2.0703893278914
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: KIAA0232 [Title/Abstract] AND INPP4B [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBRCATCGA-LL-A441-01AKIAA0232chr4

6826411

+INPP4Bchr4

142950067

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
intron-3CDSENST00000503278ENST00000513000KIAA0232chr4

6826411

+INPP4Bchr4

142950067

-
intron-intronENST00000503278ENST00000509777KIAA0232chr4

6826411

+INPP4Bchr4

142950067

-
intron-intronENST00000503278ENST00000262992KIAA0232chr4

6826411

+INPP4Bchr4

142950067

-
intron-intronENST00000503278ENST00000308502KIAA0232chr4

6826411

+INPP4Bchr4

142950067

-
intron-intronENST00000503278ENST00000508116KIAA0232chr4

6826411

+INPP4Bchr4

142950067

-
intron-intronENST00000503278ENST00000507861KIAA0232chr4

6826411

+INPP4Bchr4

142950067

-
intron-intronENST00000503278ENST00000506217KIAA0232chr4

6826411

+INPP4Bchr4

142950067

-
intron-intronENST00000503278ENST00000508084KIAA0232chr4

6826411

+INPP4Bchr4

142950067

-
In-frameENST00000425103ENST00000513000KIAA0232chr4

6826411

+INPP4Bchr4

142950067

-
5CDS-intronENST00000425103ENST00000509777KIAA0232chr4

6826411

+INPP4Bchr4

142950067

-
5CDS-intronENST00000425103ENST00000262992KIAA0232chr4

6826411

+INPP4Bchr4

142950067

-
5CDS-intronENST00000425103ENST00000308502KIAA0232chr4

6826411

+INPP4Bchr4

142950067

-
5CDS-intronENST00000425103ENST00000508116KIAA0232chr4

6826411

+INPP4Bchr4

142950067

-
5CDS-intronENST00000425103ENST00000507861KIAA0232chr4

6826411

+INPP4Bchr4

142950067

-
5CDS-intronENST00000425103ENST00000506217KIAA0232chr4

6826411

+INPP4Bchr4

142950067

-
5CDS-intronENST00000425103ENST00000508084KIAA0232chr4

6826411

+INPP4Bchr4

142950067

-
In-frameENST00000307659ENST00000513000KIAA0232chr4

6826411

+INPP4Bchr4

142950067

-
5CDS-intronENST00000307659ENST00000509777KIAA0232chr4

6826411

+INPP4Bchr4

142950067

-
5CDS-intronENST00000307659ENST00000262992KIAA0232chr4

6826411

+INPP4Bchr4

142950067

-
5CDS-intronENST00000307659ENST00000308502KIAA0232chr4

6826411

+INPP4Bchr4

142950067

-
5CDS-intronENST00000307659ENST00000508116KIAA0232chr4

6826411

+INPP4Bchr4

142950067

-
5CDS-intronENST00000307659ENST00000507861KIAA0232chr4

6826411

+INPP4Bchr4

142950067

-
5CDS-intronENST00000307659ENST00000506217KIAA0232chr4

6826411

+INPP4Bchr4

142950067

-
5CDS-intronENST00000307659ENST00000508084KIAA0232chr4

6826411

+INPP4Bchr4

142950067

-

Top

FusionProtFeatures for KIAA0232_INPP4B


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
KIAA0232

Q92628

INPP4B

O15327

Catalyzes the hydrolysis of the 4-position phosphate ofphosphatidylinositol 3,4-bisphosphate, inositol 1,3,4-trisphosphate and inositol 1,4-bisphosphate.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for KIAA0232_INPP4B


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_KIAA0232_ENST00000425103_chr4_6826411_+_INPP4B_ENST00000513000_chr4_142950067_-_121aa
MYPICTVVVDGLPSESSSSSTPGPVSVSEMSLLHALGPVQTWLGQELEKCGIDAMIYTRTVLSLLLHDSTDYDLQEQRRMPHRECTEETQ

>In-frame_KIAA0232_ENST00000307659_chr4_6826411_+_INPP4B_ENST00000513000_chr4_142950067_-_121aa
MYPICTVVVDGLPSESSSSSTPGPVSVSEMSLLHALGPVQTWLGQELEKCGIDAMIYTRTVLSLLLHDSTDYDLQEQRRMPHRECTEETQ


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_KIAA0232_ENST00000425103_chr4_6826411_+_INPP4B_ENST00000513000_chr4_142950067_-_364nt
ATGTACCCTATCTGTACAGTTGTTGTGGATGGTTTGCCATCTGAAAGCTCCTCAAGTTCTTATCCAGGCCCTGTGTCTGTTTCTGAAATG
TCTCTGCTTCATGCTTTGGGTCCAGTGCAGACCTGGCTGGGACAAGAGCTCGAGAAATGTGGCATTGATGCCATGATTTACACTCGGTAT
GTCCTCAGTCTTCTGCTGCATGACAGCTATGACTACGACCTGCAGGAACAGAGAAGGATGCCGCATAGAGAATGTACTGAAGAATATCAA
ATGCAGAAAGTATGCTTTCAACATGCTACAGCTGATGGCTTTCCCCAAGTACTACAGACCTCCAGAGGGGACTTATGGAAAAGCTGACAC

>In-frame_KIAA0232_ENST00000307659_chr4_6826411_+_INPP4B_ENST00000513000_chr4_142950067_-_364nt
ATGTACCCTATCTGTACAGTTGTTGTGGATGGTTTGCCATCTGAAAGCTCCTCAAGTTCTTATCCAGGCCCTGTGTCTGTTTCTGAAATG
TCTCTGCTTCATGCTTTGGGTCCAGTGCAGACCTGGCTGGGACAAGAGCTCGAGAAATGTGGCATTGATGCCATGATTTACACTCGGTAT
GTCCTCAGTCTTCTGCTGCATGACAGCTATGACTACGACCTGCAGGAACAGAGAAGGATGCCGCATAGAGAATGTACTGAAGAATATCAA
ATGCAGAAAGTATGCTTTCAACATGCTACAGCTGATGGCTTTCCCCAAGTACTACAGACCTCCAGAGGGGACTTATGGAAAAGCTGACAC


* Fusion transcript sequences (Full-length transcript).
>In-frame_KIAA0232_ENST00000425103_chr4_6826411_+_INPP4B_ENST00000513000_chr4_142950067_-_6365nt
ACGTAAGGCGCAGGCCAGGGCCGCCCGGCGCTCGGCAGCCGCCCGCAGCCCCTCGGAGCCAGAGGAGAGGCGCCCCCGCCGGCCGCCGCG
CCGCCCGGCAGCCTCGGCAGGTTCTGCCGGAGACTTCCATTTGGCCTCAATGTGAAATTAAAGTAGAAAATCACATCTACATGCATGTTG
CTATCAGGATGTTGATTCATTAGTCATGCCTGAAGAGGGAAAGTCTGTTTTAGGTGGCTGACTACCAGCAAAAATAAATGCTTATCCTAC
ATGTCAAGCATCTCTACTTTTTACTGGAGTGAAAATCCCCTCCAGATACCAACAGAATATCAACTGCAGAAAATGCTTCACATTTTAAGG
ATGTCGGCAACCTAAATTCATGTACCCTATCTGTACAGTTGTTGTGGATGGTTTGCCATCTGAAAGCTCCTCAAGTTCTTATCCAGGCCC
TGTGTCTGTTTCTGAAATGTCTCTGCTTCATGCTTTGGGTCCAGTGCAGACCTGGCTGGGACAAGAGCTCGAGAAATGTGGCATTGATGC
CATGATTTACACTCGGTATGTCCTCAGTCTTCTGCTGCATGACAGCTATGACTACGACCTGCAGGAACAGAGAAGGATGCCGCATAGAGA
ATGTACTGAAGAATATCAAATGCAGAAAGTATGCTTTCAACATGCTACAGCTGATGGCTTTCCCCAAGTACTACAGACCTCCAGAGGGGA
CTTATGGAAAAGCTGACACCTAAGTTTACCAACATGTTAATAAACAGGAACACAAATACATTTCAGTTGGATAATCTTCACCTTGGTCTT
TTTTGTTTGTTTTTATTGTCATGAATTTGTGGTGGGGGAGATGATCACAGATGTTTCCCAAAATCTAGGAACTACTTCAATTCATCATCA
GCATATTGCTCTGAAAGAAATCCATTTTAAAAAATCTTACATGATTCAGTACTGTCATTTCTAGTTCTAAGCTTCTATGTGTTGAGCCTA
GCTGATTGAGATTGGTTCACAAAGTGTAAATTTCATTCATGAGTATTTAAATGTTTCTGAGGAAACATGGATCATTTCAATAGGACTAGG
GGTGATTCACAGAGCACCACTCTCCAACCAAATGGAAGAGAGGAGAGGGGGAAAAGGAACATATTTTTTTTGTGATACAACTTAATAGCC
TATGAGAACACAGTCAACCTGAGAATCAATGTAAGGGATTTAAAAAAAATGTGTAGCCACTCAATTAGGTAGAGTTAACTCATGATCTGG
AATACTGAGGCAGTTTGCAGGTATGTTCCACAATGATCTCTATCATCCAGTCAAGGTGTGACTCCTCCCTTGCAACAGGCATATGCATGG
AGTGAGTAAAGTGGTCAACAGACCTTTCAAAACCATGGCATCTTTTCAGAACTCTGACTTGGGTTGTGTGATCTAGCTGTGAATGTAGCA
ATATAGAACGTTTAATAGAATGATAAGCAAAACACTGCAATGATCTAAAATTACAAATAAAATAAAAATGAACAACATTTTGATACCCAA
AATGAAAATTCCCATCAGCCTGAACTTTATGTTGTGAAGTTCATGAATGTCAGTGAGGTATCTCTGAGATGTTTCTTAGCAGTCATCCTG
GTGTAAGCATGCAGTTATGGCATAGGTTTGTGTGTGTTAATAAGCCTTTAAAACATATGCAACCACAACAAATGATAAAGTAAAACAATT
ATTTTCTGTTGCCCTGAATATCAAACTTGCCCTTGCCCTTACTCAGCAAAATAACATTTATAAGTTTTCCAAAATCCCAAAGTAGAAGTT
TCCTTAAAAAAATCATCTTGTATAATACCAGTATTCAAACATGGGTAAGGTTAATCACCCCCAATCACTCAGGAGATAGTTGCAGAATTT
GAATTACAATCTCTTCTTACTTTCCTAGCCTGTGGCTTGTCACTTCTCCAAATTGCCATGCTAAATATGCATGAAAATTGAGGGAGAATG
CTAGTTAAAAAGAAATTAGGATTTATCACTGGAATTGAAACTAAGAGTACAAAAGTCTGAACGAATGAAACTTTTCTCCAAATTTTACAA
ATTCTTGTTCCTTTCTCATTAGAAGAGCATGCTATCCAAAGCATAAATCTCCCTTGAAAATAACAGAGGCTTCTTAAGCCCTCTCTTAGC
TATGATCAATGGATGATATTATGCTTCCCATAGCTAATGTGATAGCTCCTTGCCTAGGATTCCTGTTGAAATAAGGATTCTAGCCCCATG
TTAAGTTTTTCAAATTACTACAAATTTTAGATAAGCATTTGGAGCTTTTTATACTAGAATTATCAATTTTTTATTTTAGCTAATTACCTG
TGGGCATTATACTTGAGGCAGGTACCAAACTACTTACAGCCTTTTTAATGAAAATGTGCTGTGTACTTTGAATCCATTCATAGACAAAAT
TACCTTGATGTTCTCTTAACTCATTCTTTATTTTAGTGATTAAATACAACCTTTGAGTTGTTCAATATCATTTGAAAATGGTAGGATTTG
TGGTTATTTTCATTACCCTATTAGATTTAAGATAGGCTGGGATGACAGAGGCCTCCTTGAATAGCTATGAAGCCTCATTCAGCATATCAA
ATGGTAGTCTGAGTTCTAAGAAACCTTAAGTAATTTATCATTCTGTAAATACTCTTATAAGCAATAATTTTTATTTGTATTTTTGAAAAC
AAACTACTTAAATATGGAAAAATATTAACTGGAAAGCCAGCAGTAGGGTTTTCTATTTTTAAAAGACATTTCAAGGATTTCCTGTAATCC
CAGCACTTTGGGAGCCAAGGTGGATAGATCACCTGAGGTCAGGAATTGGAGATCAGCCTGGCCAACATGGTGAAACCCCATCTCTACTAA
AGATACAAAAATTAGCTGGATGTGGTGGCACACACGTGTAATCCCAGCTACTTGGGAGGCTGAGGCAAGAGAATCGCTTGAACCCCGGAG
GCGGAGGTTGCAGTGAGCTGAGATCATGCCATTGCACTCCAGCCTGGGTGAAAAGAGCGAAACTCCATCTTTAAATAAGTAAATAAATGA
ATAATATAGAAGTCTCAAATTATAGTGCTTACTGTAATACAAATGCTTATGAATTTTCATTCATTACCATAGTCATCTGCATTTCCTTAT
AGAAAGCCTGTACTGGTGCAAACTTCTAAAAGTGGATTTCATCAAGAAAATGTGTTTCATAGAGACAACAATATTGCTTTTTTCCTGAGA
GGCAGTTCATTCTTAAACAACCACTTCACTATTTCTTAAGTTATTAAGGCTAAATCAAAGAGCAAATGTTAAAGTGTTTAAATCTCTCTT
GAACAAACACAGCCACAGTCATGCTATTCTATCTATATTTTCACTTAAAAGATACACCAGCAGACCTATTTTAGGAGGTCATATTGAGCC
AAAAAATGAACTGAGCAAATGACATTTCCAAACTCTTTTTTTGCTCAAAAATAATATGTTCCCCTTTGATATTAAATGCAGATATCAATT
CTGGATTAGCTATTTACTGAGCCCTAGGAAAAACATATTTAAAGACAAGGAAACCATTCATTTACATCTCATATCATTGCTTTTTGCTTT
TAAATATCGCCTTGAGGTTTGTCTACACTCTGCCAAAACAATCCCTGAACATAAGTTTGGTCAGCCTCATAATTCAGTGAGTCGAGCAAC
CATTTGTTCCAAGTGATAAATTGTACTAAATGACAAACTGCCCAATCAGGGCAGAGCTCCATGGACCCAGCCTCCAGCCCTTATTTTATA
AGACTAACCCCTCTTCTGAAAAACTCTGAAGGCTTAAAAGCTAGCATTTGGATGGAGGATACTTCCTTTTTATCCTTCAGCTATGTATGG
CACTTTACATAAAATAAGAGGTAAAAAAGGAGAGAAACTGATGTGTATAAAGTAATGCCTTTCTTCCCAAGCAAATCAAACCTCTCCCTA
TGTAAAAGTTGATAGTGTACCAAGAGACACAATACCACTGGTGGGCTGGAACTAGCTCGTTCTGATGCATAAAAGTTGATAATTAAAGTA
CCAGAAATTTTGTAAGCTAGTTGTTAAACATTACCATTATTAAATATGAAATTATAAAACACAGTGGAATACATTAAAAACCAATGTAAT
AATCAAAACATACCACTTCCCAATTATTTTACTACCTTATACTATTTATTAGTACTCTTGAGTCTATTTAGGTCTATTACATCTTTACAG
TGAAAACAGGATACAATATTGTGCTACTGTGGGTCTCTTCCTGACTGCAGATTCAGTAACATGGTGTTCGTAGCTTGAAACTGTCCACAG
TGGGAGTATTTAACACCATAGAAACTGGCTGGCAAATGCTACAAACTAGCAATTTTAATTCCTGGAAAGGCAATTGTTGAGCATTTACCA
GCACACAATGAATGCCATATTCTTTTTTTTTTATTAGGAAATAAATTATTGGAGGCAGTATAAAATTATTTAAAAAGTATCAAATGCAAT
CCCTTATCTTCAGATGGCTATAATTTTGGTTATATAAATGTTTTGGTTTTTACCTTCTTTAAAGACTCCTATTAGGTTAAAAGTCATATT
TGATGACTATATTTTATTCATAATTAAATTATTAAATCACCTTTTCTCCTGATAATGCTTTGCCAGAGAATTCTTAGCAATTCAACTGTA
GTCTAAGCAATAACTCAGGGCTAAATTCAGGGAACTGTTAGCCCAATCAGATATCACTAAAAATGTACTTCACCATCTATTTTGGAGTTT
ATAATTTTGGCATTTGCTAAAAGTAGGAAAAACAGTAACATATTACTGTGCCCAGATTCTAATAAATATAGCTCAATTGAAACCAAAACT
GTTACATTAAACAAATTACACTCTGGCACTATGCTAAATCACCACAGATGTTTTAGGTGTTTGATTTCCAAGCAGGATGGTATATCATTT
GTTTGGTTCAATATATGAGGCACCATTTGTAGTCTTTTAGGAAATAAATTAGCTTTTATCACAGATTTAGGAAACTTGTCTAAAAAAACT
GTGATCATCAGTTACAGAGGGAAGGAAACATATTGAACACAAGGCATCATAGTAGCTGGAGGCCTTAAAAATTATGCACGACCAAAAAGA
ATGATTTGGTGAGAGATGTGTAGCTGATTGACAATTTTAGTGTGAATTCATATTCATTTAACCCAGCAGCAATCTACATAAGCTATGCTT
TTTCCCACCTGTATTTATGTTTCTTAGCTTATAAAGTCCCAATATATTATATCTTTTGTTGCTTTGGCAGTTTTAATTTAGAGCTCTGCG
TTCACAGAGATGCCACCTATAGCAAAAACTATCTTTAAGAATTGGAAAATAAAATGAATGTTTTAGATAAAATATTGCAAGCCATTATGT
GTAGAGTTAATGTATGGAAATTTGCATTTGTTTTTCTGAATCATGGTGTACATTAATCACTCATTGAATTCTATTTCTAAGCAAATAAGA
GAATCAAACATTTCTAAAAGGAACATATGTCTTGCTATTAATAACAAGGAGACAGGAAAAATAGTAAGGTAATATAAGCAAAAAAAAAAA
TGTAATGAATTTAGCTATCCTAAATTGGAATTTTTACAGATTGCATGCATACTTAGAATTTTAAATTTTTAAAAGATTTACAATTGAGTA
TGGTACCCACAGAGAGTGAGTACCAAGGGAAGGAAGACCTAATACAAGTGATGTTGCCTGATAAATCACATCTTGCCAAAAAAAATATAT
TTTAGTAAATACAGTTCTTTAGGAAGAAAAATGTTGCCCTTTCACACTCACAGTGTAAATACATTCATAATATTCCTTCAATCATCTAAA
TTACCGCCAGGTCATGAAAGGACGCGATCAATGATGACCTATTGCACTCACAGGTAACATTGACTCAAATTTTGGCAATATTGCTATATT
ATCTAGATAATTCTTGTGATGTTTTTATGTCACTATCAACATTAAAAATATTTTGTTAAACAACTATGAAACTTTCAAAAGTTTGCATAT
AACTGTATGGGCACTCTCATTTCACTGCATACATACAATACTTTGTATACACATACTTCTCGTGTGGATATTTTATAATTTTATTTAATC
TAACATTTAACTTTTAGGTTTTTGTGGTACTCATCTGAAAGGTTGGCATTTGTTTTCTTTTTATGTTATATATGTATTTTAGATGAATCA
ATAATGTGTATTCCTAGAAATTTTTTCTAGGCATAAATAGATCATTTTATGTTGGCATTTAAGAGATATCATTTTTGTTTTATTGTTCTG

>In-frame_KIAA0232_ENST00000307659_chr4_6826411_+_INPP4B_ENST00000513000_chr4_142950067_-_6441nt
CGCAGGCCAGGGCCGCCCGGCGCTCGGCAGCCGCCCGCAGCCCCTCGGAGCCAGAGGAGAGGCGCCCCCGCCGGCCGCCGCGCCGCCCGG
CAGCCTCGGCAGGTAGTGTACACTGATAAAGGTAGGGCGCGGTGGACTCTGCCCCTGTAACCGTTCCGGAGAATGCGTTGAGAATGAAGA
CAACCAGTTCTGCCGGAGACTTCCATTTGGCCTCAATGTGAAATTAAAGTAGAAAATCACATCTACATGCATGTTGCTATCAGGATGTTG
ATTCATTAGTCATGCCTGAAGAGGGAAAGTCTGTTTTAGGTGGCTGACTACCAGCAAAAATAAATGCTTATCCTACATGTCAAGCATCTC
TACTTTTTACTGGAGTGAAAATCCCCTCCAGATACCAACAGAATATCAACTGCAGAAAATGCTTCACATTTTAAGGATGTCGGCAACCTA
AATTCATGTACCCTATCTGTACAGTTGTTGTGGATGGTTTGCCATCTGAAAGCTCCTCAAGTTCTTATCCAGGCCCTGTGTCTGTTTCTG
AAATGTCTCTGCTTCATGCTTTGGGTCCAGTGCAGACCTGGCTGGGACAAGAGCTCGAGAAATGTGGCATTGATGCCATGATTTACACTC
GGTATGTCCTCAGTCTTCTGCTGCATGACAGCTATGACTACGACCTGCAGGAACAGAGAAGGATGCCGCATAGAGAATGTACTGAAGAAT
ATCAAATGCAGAAAGTATGCTTTCAACATGCTACAGCTGATGGCTTTCCCCAAGTACTACAGACCTCCAGAGGGGACTTATGGAAAAGCT
GACACCTAAGTTTACCAACATGTTAATAAACAGGAACACAAATACATTTCAGTTGGATAATCTTCACCTTGGTCTTTTTTGTTTGTTTTT
ATTGTCATGAATTTGTGGTGGGGGAGATGATCACAGATGTTTCCCAAAATCTAGGAACTACTTCAATTCATCATCAGCATATTGCTCTGA
AAGAAATCCATTTTAAAAAATCTTACATGATTCAGTACTGTCATTTCTAGTTCTAAGCTTCTATGTGTTGAGCCTAGCTGATTGAGATTG
GTTCACAAAGTGTAAATTTCATTCATGAGTATTTAAATGTTTCTGAGGAAACATGGATCATTTCAATAGGACTAGGGGTGATTCACAGAG
CACCACTCTCCAACCAAATGGAAGAGAGGAGAGGGGGAAAAGGAACATATTTTTTTTGTGATACAACTTAATAGCCTATGAGAACACAGT
CAACCTGAGAATCAATGTAAGGGATTTAAAAAAAATGTGTAGCCACTCAATTAGGTAGAGTTAACTCATGATCTGGAATACTGAGGCAGT
TTGCAGGTATGTTCCACAATGATCTCTATCATCCAGTCAAGGTGTGACTCCTCCCTTGCAACAGGCATATGCATGGAGTGAGTAAAGTGG
TCAACAGACCTTTCAAAACCATGGCATCTTTTCAGAACTCTGACTTGGGTTGTGTGATCTAGCTGTGAATGTAGCAATATAGAACGTTTA
ATAGAATGATAAGCAAAACACTGCAATGATCTAAAATTACAAATAAAATAAAAATGAACAACATTTTGATACCCAAAATGAAAATTCCCA
TCAGCCTGAACTTTATGTTGTGAAGTTCATGAATGTCAGTGAGGTATCTCTGAGATGTTTCTTAGCAGTCATCCTGGTGTAAGCATGCAG
TTATGGCATAGGTTTGTGTGTGTTAATAAGCCTTTAAAACATATGCAACCACAACAAATGATAAAGTAAAACAATTATTTTCTGTTGCCC
TGAATATCAAACTTGCCCTTGCCCTTACTCAGCAAAATAACATTTATAAGTTTTCCAAAATCCCAAAGTAGAAGTTTCCTTAAAAAAATC
ATCTTGTATAATACCAGTATTCAAACATGGGTAAGGTTAATCACCCCCAATCACTCAGGAGATAGTTGCAGAATTTGAATTACAATCTCT
TCTTACTTTCCTAGCCTGTGGCTTGTCACTTCTCCAAATTGCCATGCTAAATATGCATGAAAATTGAGGGAGAATGCTAGTTAAAAAGAA
ATTAGGATTTATCACTGGAATTGAAACTAAGAGTACAAAAGTCTGAACGAATGAAACTTTTCTCCAAATTTTACAAATTCTTGTTCCTTT
CTCATTAGAAGAGCATGCTATCCAAAGCATAAATCTCCCTTGAAAATAACAGAGGCTTCTTAAGCCCTCTCTTAGCTATGATCAATGGAT
GATATTATGCTTCCCATAGCTAATGTGATAGCTCCTTGCCTAGGATTCCTGTTGAAATAAGGATTCTAGCCCCATGTTAAGTTTTTCAAA
TTACTACAAATTTTAGATAAGCATTTGGAGCTTTTTATACTAGAATTATCAATTTTTTATTTTAGCTAATTACCTGTGGGCATTATACTT
GAGGCAGGTACCAAACTACTTACAGCCTTTTTAATGAAAATGTGCTGTGTACTTTGAATCCATTCATAGACAAAATTACCTTGATGTTCT
CTTAACTCATTCTTTATTTTAGTGATTAAATACAACCTTTGAGTTGTTCAATATCATTTGAAAATGGTAGGATTTGTGGTTATTTTCATT
ACCCTATTAGATTTAAGATAGGCTGGGATGACAGAGGCCTCCTTGAATAGCTATGAAGCCTCATTCAGCATATCAAATGGTAGTCTGAGT
TCTAAGAAACCTTAAGTAATTTATCATTCTGTAAATACTCTTATAAGCAATAATTTTTATTTGTATTTTTGAAAACAAACTACTTAAATA
TGGAAAAATATTAACTGGAAAGCCAGCAGTAGGGTTTTCTATTTTTAAAAGACATTTCAAGGATTTCCTGTAATCCCAGCACTTTGGGAG
CCAAGGTGGATAGATCACCTGAGGTCAGGAATTGGAGATCAGCCTGGCCAACATGGTGAAACCCCATCTCTACTAAAGATACAAAAATTA
GCTGGATGTGGTGGCACACACGTGTAATCCCAGCTACTTGGGAGGCTGAGGCAAGAGAATCGCTTGAACCCCGGAGGCGGAGGTTGCAGT
GAGCTGAGATCATGCCATTGCACTCCAGCCTGGGTGAAAAGAGCGAAACTCCATCTTTAAATAAGTAAATAAATGAATAATATAGAAGTC
TCAAATTATAGTGCTTACTGTAATACAAATGCTTATGAATTTTCATTCATTACCATAGTCATCTGCATTTCCTTATAGAAAGCCTGTACT
GGTGCAAACTTCTAAAAGTGGATTTCATCAAGAAAATGTGTTTCATAGAGACAACAATATTGCTTTTTTCCTGAGAGGCAGTTCATTCTT
AAACAACCACTTCACTATTTCTTAAGTTATTAAGGCTAAATCAAAGAGCAAATGTTAAAGTGTTTAAATCTCTCTTGAACAAACACAGCC
ACAGTCATGCTATTCTATCTATATTTTCACTTAAAAGATACACCAGCAGACCTATTTTAGGAGGTCATATTGAGCCAAAAAATGAACTGA
GCAAATGACATTTCCAAACTCTTTTTTTGCTCAAAAATAATATGTTCCCCTTTGATATTAAATGCAGATATCAATTCTGGATTAGCTATT
TACTGAGCCCTAGGAAAAACATATTTAAAGACAAGGAAACCATTCATTTACATCTCATATCATTGCTTTTTGCTTTTAAATATCGCCTTG
AGGTTTGTCTACACTCTGCCAAAACAATCCCTGAACATAAGTTTGGTCAGCCTCATAATTCAGTGAGTCGAGCAACCATTTGTTCCAAGT
GATAAATTGTACTAAATGACAAACTGCCCAATCAGGGCAGAGCTCCATGGACCCAGCCTCCAGCCCTTATTTTATAAGACTAACCCCTCT
TCTGAAAAACTCTGAAGGCTTAAAAGCTAGCATTTGGATGGAGGATACTTCCTTTTTATCCTTCAGCTATGTATGGCACTTTACATAAAA
TAAGAGGTAAAAAAGGAGAGAAACTGATGTGTATAAAGTAATGCCTTTCTTCCCAAGCAAATCAAACCTCTCCCTATGTAAAAGTTGATA
GTGTACCAAGAGACACAATACCACTGGTGGGCTGGAACTAGCTCGTTCTGATGCATAAAAGTTGATAATTAAAGTACCAGAAATTTTGTA
AGCTAGTTGTTAAACATTACCATTATTAAATATGAAATTATAAAACACAGTGGAATACATTAAAAACCAATGTAATAATCAAAACATACC
ACTTCCCAATTATTTTACTACCTTATACTATTTATTAGTACTCTTGAGTCTATTTAGGTCTATTACATCTTTACAGTGAAAACAGGATAC
AATATTGTGCTACTGTGGGTCTCTTCCTGACTGCAGATTCAGTAACATGGTGTTCGTAGCTTGAAACTGTCCACAGTGGGAGTATTTAAC
ACCATAGAAACTGGCTGGCAAATGCTACAAACTAGCAATTTTAATTCCTGGAAAGGCAATTGTTGAGCATTTACCAGCACACAATGAATG
CCATATTCTTTTTTTTTTATTAGGAAATAAATTATTGGAGGCAGTATAAAATTATTTAAAAAGTATCAAATGCAATCCCTTATCTTCAGA
TGGCTATAATTTTGGTTATATAAATGTTTTGGTTTTTACCTTCTTTAAAGACTCCTATTAGGTTAAAAGTCATATTTGATGACTATATTT
TATTCATAATTAAATTATTAAATCACCTTTTCTCCTGATAATGCTTTGCCAGAGAATTCTTAGCAATTCAACTGTAGTCTAAGCAATAAC
TCAGGGCTAAATTCAGGGAACTGTTAGCCCAATCAGATATCACTAAAAATGTACTTCACCATCTATTTTGGAGTTTATAATTTTGGCATT
TGCTAAAAGTAGGAAAAACAGTAACATATTACTGTGCCCAGATTCTAATAAATATAGCTCAATTGAAACCAAAACTGTTACATTAAACAA
ATTACACTCTGGCACTATGCTAAATCACCACAGATGTTTTAGGTGTTTGATTTCCAAGCAGGATGGTATATCATTTGTTTGGTTCAATAT
ATGAGGCACCATTTGTAGTCTTTTAGGAAATAAATTAGCTTTTATCACAGATTTAGGAAACTTGTCTAAAAAAACTGTGATCATCAGTTA
CAGAGGGAAGGAAACATATTGAACACAAGGCATCATAGTAGCTGGAGGCCTTAAAAATTATGCACGACCAAAAAGAATGATTTGGTGAGA
GATGTGTAGCTGATTGACAATTTTAGTGTGAATTCATATTCATTTAACCCAGCAGCAATCTACATAAGCTATGCTTTTTCCCACCTGTAT
TTATGTTTCTTAGCTTATAAAGTCCCAATATATTATATCTTTTGTTGCTTTGGCAGTTTTAATTTAGAGCTCTGCGTTCACAGAGATGCC
ACCTATAGCAAAAACTATCTTTAAGAATTGGAAAATAAAATGAATGTTTTAGATAAAATATTGCAAGCCATTATGTGTAGAGTTAATGTA
TGGAAATTTGCATTTGTTTTTCTGAATCATGGTGTACATTAATCACTCATTGAATTCTATTTCTAAGCAAATAAGAGAATCAAACATTTC
TAAAAGGAACATATGTCTTGCTATTAATAACAAGGAGACAGGAAAAATAGTAAGGTAATATAAGCAAAAAAAAAAATGTAATGAATTTAG
CTATCCTAAATTGGAATTTTTACAGATTGCATGCATACTTAGAATTTTAAATTTTTAAAAGATTTACAATTGAGTATGGTACCCACAGAG
AGTGAGTACCAAGGGAAGGAAGACCTAATACAAGTGATGTTGCCTGATAAATCACATCTTGCCAAAAAAAATATATTTTAGTAAATACAG
TTCTTTAGGAAGAAAAATGTTGCCCTTTCACACTCACAGTGTAAATACATTCATAATATTCCTTCAATCATCTAAATTACCGCCAGGTCA
TGAAAGGACGCGATCAATGATGACCTATTGCACTCACAGGTAACATTGACTCAAATTTTGGCAATATTGCTATATTATCTAGATAATTCT
TGTGATGTTTTTATGTCACTATCAACATTAAAAATATTTTGTTAAACAACTATGAAACTTTCAAAAGTTTGCATATAACTGTATGGGCAC
TCTCATTTCACTGCATACATACAATACTTTGTATACACATACTTCTCGTGTGGATATTTTATAATTTTATTTAATCTAACATTTAACTTT
TAGGTTTTTGTGGTACTCATCTGAAAGGTTGGCATTTGTTTTCTTTTTATGTTATATATGTATTTTAGATGAATCAATAATGTGTATTCC
TAGAAATTTTTTCTAGGCATAAATAGATCATTTTATGTTGGCATTTAAGAGATATCATTTTTGTTTTATTGTTCTGTGTAAACCATATTC


Top

FusionGenePPI for KIAA0232_INPP4B


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
KIAA0232SLC35F6, YWHAZ, YWHAE, ALB, DYRK1B, DYRK1A, SOCS6, USP36, FOXD4L6, AP2M1, NAT8L, KIAA1683, ZBBX, SSH3, ADAMTS4, FRMD1, RPL28, SIRT6, BRINP3, TPTE2, TRIM41, DOCK5, C4orf26, NOL9, RGS3, ZNF408, FOXD4, TSPYL6, TSPYL1, HCFC2, FGFRL1INPP4BELAVL1, PYCARD, ZNF131


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for KIAA0232_INPP4B


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for KIAA0232_INPP4B


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource