FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 18482

FusionGeneSummary for KDM5A_NINJ2

check button Fusion gene summary
Fusion gene informationFusion gene name: KDM5A_NINJ2
Fusion gene ID: 18482
HgeneTgene
Gene symbol

KDM5A

NINJ2

Gene ID

5927

4815

Gene namelysine demethylase 5Aninjurin 2
SynonymsRBBP-2|RBBP2|RBP2-
Cytomap

12p13.33

12p13.33

Type of geneprotein-codingprotein-coding
Descriptionlysine-specific demethylase 5AJumonji, AT rich interactive domain 1A (RBP2-like)histone demethylase JARID1Ajumonji/ARID domain-containing protein 1Alysine (K)-specific demethylase 5Aretinoblastoma binding protein 2ninjurin-2nerve injury-induced protein 2
Modification date2018052320180519
UniProtAcc

P29375

Q9NZG7

Ensembl transtripts involved in fusion geneENST00000399788, ENST00000540838, 
ENST00000382815, 
ENST00000305108, 
ENST00000397265, ENST00000542920, 
ENST00000433832, ENST00000537416, 
Fusion gene scores* DoF score7 X 8 X 6=3367 X 1 X 7=49
# samples 1110
** MAII scorelog2(11/336*10)=-1.6109577092541
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(10/49*10)=1.02914634565952
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: KDM5A [Title/Abstract] AND NINJ2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Tumor suppressor gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneKDM5A

GO:0033169

histone H3-K9 demethylation

18270511

HgeneKDM5A

GO:0034720

histone H3-K4 demethylation

18270511

HgeneKDM5A

GO:0045893

positive regulation of transcription, DNA-templated

11358960


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBRCATCGA-AO-A124-01AKDM5Achr12

404739

-NINJ2chr12

675344

-
TCGARVESCATCGA-L5-A8NI-01AKDM5Achr12

430161

-NINJ2chr12

675344

-
TCGARVSTADTCGA-BR-8295-01AKDM5Achr12

404739

-NINJ2chr12

675344

-
TCGALDSTADTCGA-BR-8289-01AKDM5Achr12

459787

-NINJ2chr12

675344

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000399788ENST00000305108KDM5Achr12

404739

-NINJ2chr12

675344

-
In-frameENST00000399788ENST00000397265KDM5Achr12

404739

-NINJ2chr12

675344

-
5CDS-5UTRENST00000399788ENST00000542920KDM5Achr12

404739

-NINJ2chr12

675344

-
5CDS-5UTRENST00000399788ENST00000433832KDM5Achr12

404739

-NINJ2chr12

675344

-
5CDS-intronENST00000399788ENST00000537416KDM5Achr12

404739

-NINJ2chr12

675344

-
intron-3CDSENST00000540838ENST00000305108KDM5Achr12

404739

-NINJ2chr12

675344

-
intron-3CDSENST00000540838ENST00000397265KDM5Achr12

404739

-NINJ2chr12

675344

-
intron-5UTRENST00000540838ENST00000542920KDM5Achr12

404739

-NINJ2chr12

675344

-
intron-5UTRENST00000540838ENST00000433832KDM5Achr12

404739

-NINJ2chr12

675344

-
intron-intronENST00000540838ENST00000537416KDM5Achr12

404739

-NINJ2chr12

675344

-
In-frameENST00000382815ENST00000305108KDM5Achr12

404739

-NINJ2chr12

675344

-
In-frameENST00000382815ENST00000397265KDM5Achr12

404739

-NINJ2chr12

675344

-
5CDS-5UTRENST00000382815ENST00000542920KDM5Achr12

404739

-NINJ2chr12

675344

-
5CDS-5UTRENST00000382815ENST00000433832KDM5Achr12

404739

-NINJ2chr12

675344

-
5CDS-intronENST00000382815ENST00000537416KDM5Achr12

404739

-NINJ2chr12

675344

-
In-frameENST00000399788ENST00000305108KDM5Achr12

430161

-NINJ2chr12

675344

-
In-frameENST00000399788ENST00000397265KDM5Achr12

430161

-NINJ2chr12

675344

-
5CDS-5UTRENST00000399788ENST00000542920KDM5Achr12

430161

-NINJ2chr12

675344

-
5CDS-5UTRENST00000399788ENST00000433832KDM5Achr12

430161

-NINJ2chr12

675344

-
5CDS-intronENST00000399788ENST00000537416KDM5Achr12

430161

-NINJ2chr12

675344

-
intron-3CDSENST00000540838ENST00000305108KDM5Achr12

430161

-NINJ2chr12

675344

-
intron-3CDSENST00000540838ENST00000397265KDM5Achr12

430161

-NINJ2chr12

675344

-
intron-5UTRENST00000540838ENST00000542920KDM5Achr12

430161

-NINJ2chr12

675344

-
intron-5UTRENST00000540838ENST00000433832KDM5Achr12

430161

-NINJ2chr12

675344

-
intron-intronENST00000540838ENST00000537416KDM5Achr12

430161

-NINJ2chr12

675344

-
In-frameENST00000382815ENST00000305108KDM5Achr12

430161

-NINJ2chr12

675344

-
In-frameENST00000382815ENST00000397265KDM5Achr12

430161

-NINJ2chr12

675344

-
5CDS-5UTRENST00000382815ENST00000542920KDM5Achr12

430161

-NINJ2chr12

675344

-
5CDS-5UTRENST00000382815ENST00000433832KDM5Achr12

430161

-NINJ2chr12

675344

-
5CDS-intronENST00000382815ENST00000537416KDM5Achr12

430161

-NINJ2chr12

675344

-
In-frameENST00000399788ENST00000305108KDM5Achr12

459787

-NINJ2chr12

675344

-
In-frameENST00000399788ENST00000397265KDM5Achr12

459787

-NINJ2chr12

675344

-
5CDS-5UTRENST00000399788ENST00000542920KDM5Achr12

459787

-NINJ2chr12

675344

-
5CDS-5UTRENST00000399788ENST00000433832KDM5Achr12

459787

-NINJ2chr12

675344

-
5CDS-intronENST00000399788ENST00000537416KDM5Achr12

459787

-NINJ2chr12

675344

-
intron-3CDSENST00000540838ENST00000305108KDM5Achr12

459787

-NINJ2chr12

675344

-
intron-3CDSENST00000540838ENST00000397265KDM5Achr12

459787

-NINJ2chr12

675344

-
intron-5UTRENST00000540838ENST00000542920KDM5Achr12

459787

-NINJ2chr12

675344

-
intron-5UTRENST00000540838ENST00000433832KDM5Achr12

459787

-NINJ2chr12

675344

-
intron-intronENST00000540838ENST00000537416KDM5Achr12

459787

-NINJ2chr12

675344

-
In-frameENST00000382815ENST00000305108KDM5Achr12

459787

-NINJ2chr12

675344

-
In-frameENST00000382815ENST00000397265KDM5Achr12

459787

-NINJ2chr12

675344

-
5CDS-5UTRENST00000382815ENST00000542920KDM5Achr12

459787

-NINJ2chr12

675344

-
5CDS-5UTRENST00000382815ENST00000433832KDM5Achr12

459787

-NINJ2chr12

675344

-
5CDS-intronENST00000382815ENST00000537416KDM5Achr12

459787

-NINJ2chr12

675344

-

Top

FusionProtFeatures for KDM5A_NINJ2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
KDM5A

P29375

NINJ2

Q9NZG7

Histone demethylase that specifically demethylates 'Lys-4' of histone H3, thereby playing a central role in histone code.Does not demethylate histone H3 'Lys-9', H3 'Lys-27', H3 'Lys-36',H3 'Lys-79' or H4 'Lys-20'. Demethylates trimethylated anddimethylated but not monomethylated H3 'Lys-4'. Regulates specificgene transcription through DNA-binding on 5'-CCGCCC-3' motif(PubMed:18270511). May stimulate transcription mediated by nuclearreceptors. Involved in transcriptional regulation of Hox proteinsduring cell differentiation (PubMed:19430464). May participate intranscriptional repression of cytokines such as CXCL12. Plays arole in the regulation of the circadian rhythm and in maintainingthe normal periodicity of the circadian clock. In a histonedemethylase-independent manner, acts as a coactivator of theCLOCK-ARNTL/BMAL1-mediated transcriptional activation of PER1/2and other clock-controlled genes and increases histone acetylationat PER1/2 promoters by inhibiting the activity of HDAC1 (Bysimilarity). Seems to act as a transcriptional corepressor forsome genes such as MT1F and to favor the proliferation of cancercells (PubMed:27427228). {ECO:0000250|UniProtKB:Q3UXZ9,ECO:0000269|PubMed:11358960, ECO:0000269|PubMed:15949438,ECO:0000269|PubMed:17320160, ECO:0000269|PubMed:17320161,ECO:0000269|PubMed:17320163, ECO:0000269|PubMed:18270511,ECO:0000269|PubMed:19430464, ECO:0000269|PubMed:27427228}. Homophilic cell adhesion molecule that promotes axonalgrowth. May play a role in nerve regeneration and in the formationand function of other tissues.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneKDM5Achr12:404739chr12:675344ENST00000399788-262819_6014851691DomainJmjN
HgeneKDM5Achr12:404739chr12:675344ENST00000399788-2628437_60314851691DomainJmjC
HgeneKDM5Achr12:404739chr12:675344ENST00000399788-262884_17414851691DomainARID
HgeneKDM5Achr12:430161chr12:675344ENST00000399788-182819_608471691DomainJmjN
HgeneKDM5Achr12:430161chr12:675344ENST00000399788-1828437_6038471691DomainJmjC
HgeneKDM5Achr12:430161chr12:675344ENST00000399788-182884_1748471691DomainARID
HgeneKDM5Achr12:459787chr12:675344ENST00000399788-102819_604361691DomainJmjN
HgeneKDM5Achr12:459787chr12:675344ENST00000399788-102884_1744361691DomainARID
HgeneKDM5Achr12:404739chr12:675344ENST00000399788-2628419_42314851691MotifGSGFP motif
HgeneKDM5Achr12:430161chr12:675344ENST00000399788-1828419_4238471691MotifGSGFP motif
HgeneKDM5Achr12:459787chr12:675344ENST00000399788-1028419_4234361691MotifGSGFP motif
HgeneKDM5Achr12:404739chr12:675344ENST00000399788-26281161_121814851691Zinc fingerPHD-type 2
HgeneKDM5Achr12:404739chr12:675344ENST00000399788-2628293_34314851691Zinc fingerPHD-type 1
HgeneKDM5Achr12:404739chr12:675344ENST00000399788-2628676_72814851691Zinc fingerC5HC2
HgeneKDM5Achr12:430161chr12:675344ENST00000399788-1828293_3438471691Zinc fingerPHD-type 1
HgeneKDM5Achr12:430161chr12:675344ENST00000399788-1828676_7288471691Zinc fingerC5HC2
HgeneKDM5Achr12:459787chr12:675344ENST00000399788-1028293_3434361691Zinc fingerPHD-type 1
TgeneNINJ2chr12:404739chr12:675344ENST00000305108-04128_14257152Topological domainExtracellular
TgeneNINJ2chr12:404739chr12:675344ENST00000305108-0489_10657152Topological domainCytoplasmic
TgeneNINJ2chr12:430161chr12:675344ENST00000305108-04128_14257152Topological domainExtracellular
TgeneNINJ2chr12:430161chr12:675344ENST00000305108-0489_10657152Topological domainCytoplasmic
TgeneNINJ2chr12:459787chr12:675344ENST00000305108-04128_14257152Topological domainExtracellular
TgeneNINJ2chr12:459787chr12:675344ENST00000305108-0489_10657152Topological domainCytoplasmic
TgeneNINJ2chr12:404739chr12:675344ENST00000305108-04107_12757152TransmembraneHelical
TgeneNINJ2chr12:404739chr12:675344ENST00000305108-0466_8857152TransmembraneHelical
TgeneNINJ2chr12:430161chr12:675344ENST00000305108-04107_12757152TransmembraneHelical
TgeneNINJ2chr12:430161chr12:675344ENST00000305108-0466_8857152TransmembraneHelical
TgeneNINJ2chr12:459787chr12:675344ENST00000305108-04107_12757152TransmembraneHelical
TgeneNINJ2chr12:459787chr12:675344ENST00000305108-0466_8857152TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneKDM5Achr12:404739chr12:675344ENST00000399788-26281492_158714851691Compositional biasNote=Lys-rich
HgeneKDM5Achr12:430161chr12:675344ENST00000399788-18281492_15878471691Compositional biasNote=Lys-rich
HgeneKDM5Achr12:459787chr12:675344ENST00000399788-10281492_15874361691Compositional biasNote=Lys-rich
HgeneKDM5Achr12:459787chr12:675344ENST00000399788-1028437_6034361691DomainJmjC
HgeneKDM5Achr12:404739chr12:675344ENST00000399788-26281607_166114851691Zinc fingerPHD-type 3
HgeneKDM5Achr12:430161chr12:675344ENST00000399788-18281161_12188471691Zinc fingerPHD-type 2
HgeneKDM5Achr12:430161chr12:675344ENST00000399788-18281607_16618471691Zinc fingerPHD-type 3
HgeneKDM5Achr12:459787chr12:675344ENST00000399788-10281161_12184361691Zinc fingerPHD-type 2
HgeneKDM5Achr12:459787chr12:675344ENST00000399788-10281607_16614361691Zinc fingerPHD-type 3
HgeneKDM5Achr12:459787chr12:675344ENST00000399788-1028676_7284361691Zinc fingerC5HC2
TgeneNINJ2chr12:404739chr12:675344ENST00000305108-041_6557152Topological domainExtracellular
TgeneNINJ2chr12:430161chr12:675344ENST00000305108-041_6557152Topological domainExtracellular
TgeneNINJ2chr12:459787chr12:675344ENST00000305108-041_6557152Topological domainExtracellular


Top

FusionGeneSequence for KDM5A_NINJ2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_KDM5A_ENST00000399788_chr12_404739_-_NINJ2_ENST00000305108_chr12_675344_-_1485aa
MAGVGPGGYAAEFVPPPECPVFEPSWEEFTDPLSFIGRIRPLAEKTGICKIRPPKDWQPPFACEVKSFRFTPRVQRLNELEAMTRVRLDF
LDQLAKFWELQGSTLKIPVVERKILDLYALSKIVASKGGFEMVTKEKKWSKVGSRLGYLPGKGTGSLLKSHYERILYPYELFQSGVSLMG
VQMPNLDLKEKVEPEVLSTDTQTSPEPGTRMNILPKRTRRVKTQSESGDVSRNTELKKLQIFGAGPKVVGLAMGTKDKEDEVTRRRKVTN
RSDAFNMQMRQRKGTLSVNFVDLYVCMFCGRGNNEDKLLLCDGCDDSYHTFCLIPPLPDVPKGDWRCPKCVAEECSKPREAFGFEQAVRE
YTLQSFGEMADNFKSDYFNMPVHMVPTELVEKEFWRLVSSIEEDVIVEYGADISSKDFGSGFPVKDGRRKILPEEEEYALSGWNLNNMPV
LEQSVLAHINVDISGMKVPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPSHAAEQLEEVMRELAPELFESQPDLLHQLVTIM
NPNVLMEHGVPVYRTNQCAGEFVVTFPRAYHSGFNQGYNFAEAVNFCTADWLPIGRQCVNHYRRLRRHCVFSHEELIFKMAADPECLDVG
LAAMVCKELTLMTEEETRLRESVVQMGVLMSEEEVFELVPDDERQCSACRTTCFLSALTCSCNPERLVCLYHPTDLCPCPMQKKCLRYRY
PLEDLPSLLYGVKVRAQSYDTWVSRVTEALSANFNHKKDLIELRVMLEDAEDRKYPENDLFRKLRDAVKEAETCASVAQLLLSKKQKHRQ
SPDSGRTRTKLTVEELKAFVQQLFSLPCVISQARQVKNLLDDVEEFHERAQEAMMDETPDSSKLQMLIDMGSSLYVELPELPRLKQELQQ
ARWLDEVRLTLSDPQQVTLDVMKKLIDSGVGLAPHHAVEKAMAELQELLTVSERWEEKAKVCLQARPRHSVASLESIVNEAKNIPAFLPN
VLSLKEALQKAREWTAKVEAIQSGSNYAYLEQLESLSAKGRPIPVRLEALPQVESQVAAARAWRERTGRTFLKKNSSHTLLQVLSPRTDI
GVYGSGKNRRKKVKELIEKEKEKDLDLEPLSDLEEGLEETRDTAMVVAVFKEREQKEIEAMHSLRAANLAKMTMVDRIEEVKFCICRKTA
SGFMLQCELCKDWFHNSCVPLPKSSSQKKGSSWQAKEVKFLCPLCMRSRRPRLETILSLLVSLQKLPVRLPEGEALQCLTERAMSWQDRA
RQALATDELSSALAKLSVLSQRMVEQAAREKTEKIISAELQKAAANPDLQGHLPSFQQSAFNRVVSSVSSSPRQTMDYDDEETDSDEDIR
ETYGYDMKDTASVKSSSSLEPNLFCDEEIPIKSEEVVTHMWTAPSFCAEHAYSSASKSCSQGSSTPRKQPRKSPLVPRSLEPPVLELSPG

>In-frame_KDM5A_ENST00000399788_chr12_404739_-_NINJ2_ENST00000397265_chr12_675344_-_1485aa
MAGVGPGGYAAEFVPPPECPVFEPSWEEFTDPLSFIGRIRPLAEKTGICKIRPPKDWQPPFACEVKSFRFTPRVQRLNELEAMTRVRLDF
LDQLAKFWELQGSTLKIPVVERKILDLYALSKIVASKGGFEMVTKEKKWSKVGSRLGYLPGKGTGSLLKSHYERILYPYELFQSGVSLMG
VQMPNLDLKEKVEPEVLSTDTQTSPEPGTRMNILPKRTRRVKTQSESGDVSRNTELKKLQIFGAGPKVVGLAMGTKDKEDEVTRRRKVTN
RSDAFNMQMRQRKGTLSVNFVDLYVCMFCGRGNNEDKLLLCDGCDDSYHTFCLIPPLPDVPKGDWRCPKCVAEECSKPREAFGFEQAVRE
YTLQSFGEMADNFKSDYFNMPVHMVPTELVEKEFWRLVSSIEEDVIVEYGADISSKDFGSGFPVKDGRRKILPEEEEYALSGWNLNNMPV
LEQSVLAHINVDISGMKVPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPSHAAEQLEEVMRELAPELFESQPDLLHQLVTIM
NPNVLMEHGVPVYRTNQCAGEFVVTFPRAYHSGFNQGYNFAEAVNFCTADWLPIGRQCVNHYRRLRRHCVFSHEELIFKMAADPECLDVG
LAAMVCKELTLMTEEETRLRESVVQMGVLMSEEEVFELVPDDERQCSACRTTCFLSALTCSCNPERLVCLYHPTDLCPCPMQKKCLRYRY
PLEDLPSLLYGVKVRAQSYDTWVSRVTEALSANFNHKKDLIELRVMLEDAEDRKYPENDLFRKLRDAVKEAETCASVAQLLLSKKQKHRQ
SPDSGRTRTKLTVEELKAFVQQLFSLPCVISQARQVKNLLDDVEEFHERAQEAMMDETPDSSKLQMLIDMGSSLYVELPELPRLKQELQQ
ARWLDEVRLTLSDPQQVTLDVMKKLIDSGVGLAPHHAVEKAMAELQELLTVSERWEEKAKVCLQARPRHSVASLESIVNEAKNIPAFLPN
VLSLKEALQKAREWTAKVEAIQSGSNYAYLEQLESLSAKGRPIPVRLEALPQVESQVAAARAWRERTGRTFLKKNSSHTLLQVLSPRTDI
GVYGSGKNRRKKVKELIEKEKEKDLDLEPLSDLEEGLEETRDTAMVVAVFKEREQKEIEAMHSLRAANLAKMTMVDRIEEVKFCICRKTA
SGFMLQCELCKDWFHNSCVPLPKSSSQKKGSSWQAKEVKFLCPLCMRSRRPRLETILSLLVSLQKLPVRLPEGEALQCLTERAMSWQDRA
RQALATDELSSALAKLSVLSQRMVEQAAREKTEKIISAELQKAAANPDLQGHLPSFQQSAFNRVVSSVSSSPRQTMDYDDEETDSDEDIR
ETYGYDMKDTASVKSSSSLEPNLFCDEEIPIKSEEVVTHMWTAPSFCAEHAYSSASKSCSQGSSTPRKQPRKSPLVPRSLEPPVLELSPG

>In-frame_KDM5A_ENST00000382815_chr12_404739_-_NINJ2_ENST00000305108_chr12_675344_-_1485aa
MAGVGPGGYAAEFVPPPECPVFEPSWEEFTDPLSFIGRIRPLAEKTGICKIRPPKDWQPPFACEVKSFRFTPRVQRLNELEAMTRVRLDF
LDQLAKFWELQGSTLKIPVVERKILDLYALSKIVASKGGFEMVTKEKKWSKVGSRLGYLPGKGTGSLLKSHYERILYPYELFQSGVSLMG
VQMPNLDLKEKVEPEVLSTDTQTSPEPGTRMNILPKRTRRVKTQSESGDVSRNTELKKLQIFGAGPKVVGLAMGTKDKEDEVTRRRKVTN
RSDAFNMQMRQRKGTLSVNFVDLYVCMFCGRGNNEDKLLLCDGCDDSYHTFCLIPPLPDVPKGDWRCPKCVAEECSKPREAFGFEQAVRE
YTLQSFGEMADNFKSDYFNMPVHMVPTELVEKEFWRLVSSIEEDVIVEYGADISSKDFGSGFPVKDGRRKILPEEEEYALSGWNLNNMPV
LEQSVLAHINVDISGMKVPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPSHAAEQLEEVMRELAPELFESQPDLLHQLVTIM
NPNVLMEHGVPVYRTNQCAGEFVVTFPRAYHSGFNQGYNFAEAVNFCTADWLPIGRQCVNHYRRLRRHCVFSHEELIFKMAADPECLDVG
LAAMVCKELTLMTEEETRLRESVVQMGVLMSEEEVFELVPDDERQCSACRTTCFLSALTCSCNPERLVCLYHPTDLCPCPMQKKCLRYRY
PLEDLPSLLYGVKVRAQSYDTWVSRVTEALSANFNHKKDLIELRVMLEDAEDRKYPENDLFRKLRDAVKEAETCASVAQLLLSKKQKHRQ
SPDSGRTRTKLTVEELKAFVQQLFSLPCVISQARQVKNLLDDVEEFHERAQEAMMDETPDSSKLQMLIDMGSSLYVELPELPRLKQELQQ
ARWLDEVRLTLSDPQQVTLDVMKKLIDSGVGLAPHHAVEKAMAELQELLTVSERWEEKAKVCLQARPRHSVASLESIVNEAKNIPAFLPN
VLSLKEALQKAREWTAKVEAIQSGSNYAYLEQLESLSAKGRPIPVRLEALPQVESQVAAARAWRERTGRTFLKKNSSHTLLQVLSPRTDI
GVYGSGKNRRKKVKELIEKEKEKDLDLEPLSDLEEGLEETRDTAMVVAVFKEREQKEIEAMHSLRAANLAKMTMVDRIEEVKFCICRKTA
SGFMLQCELCKDWFHNSCVPLPKSSSQKKGSSWQAKEVKFLCPLCMRSRRPRLETILSLLVSLQKLPVRLPEGEALQCLTERAMSWQDRA
RQALATDELSSALAKLSVLSQRMVEQAAREKTEKIISAELQKAAANPDLQGHLPSFQQSAFNRVVSSVSSSPRQTMDYDDEETDSDEDIR
ETYGYDMKDTASVKSSSSLEPNLFCDEEIPIKSEEVVTHMWTAPSFCAEHAYSSASKSCSQGSSTPRKQPRKSPLVPRSLEPPVLELSPG

>In-frame_KDM5A_ENST00000382815_chr12_404739_-_NINJ2_ENST00000397265_chr12_675344_-_1485aa
MAGVGPGGYAAEFVPPPECPVFEPSWEEFTDPLSFIGRIRPLAEKTGICKIRPPKDWQPPFACEVKSFRFTPRVQRLNELEAMTRVRLDF
LDQLAKFWELQGSTLKIPVVERKILDLYALSKIVASKGGFEMVTKEKKWSKVGSRLGYLPGKGTGSLLKSHYERILYPYELFQSGVSLMG
VQMPNLDLKEKVEPEVLSTDTQTSPEPGTRMNILPKRTRRVKTQSESGDVSRNTELKKLQIFGAGPKVVGLAMGTKDKEDEVTRRRKVTN
RSDAFNMQMRQRKGTLSVNFVDLYVCMFCGRGNNEDKLLLCDGCDDSYHTFCLIPPLPDVPKGDWRCPKCVAEECSKPREAFGFEQAVRE
YTLQSFGEMADNFKSDYFNMPVHMVPTELVEKEFWRLVSSIEEDVIVEYGADISSKDFGSGFPVKDGRRKILPEEEEYALSGWNLNNMPV
LEQSVLAHINVDISGMKVPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPSHAAEQLEEVMRELAPELFESQPDLLHQLVTIM
NPNVLMEHGVPVYRTNQCAGEFVVTFPRAYHSGFNQGYNFAEAVNFCTADWLPIGRQCVNHYRRLRRHCVFSHEELIFKMAADPECLDVG
LAAMVCKELTLMTEEETRLRESVVQMGVLMSEEEVFELVPDDERQCSACRTTCFLSALTCSCNPERLVCLYHPTDLCPCPMQKKCLRYRY
PLEDLPSLLYGVKVRAQSYDTWVSRVTEALSANFNHKKDLIELRVMLEDAEDRKYPENDLFRKLRDAVKEAETCASVAQLLLSKKQKHRQ
SPDSGRTRTKLTVEELKAFVQQLFSLPCVISQARQVKNLLDDVEEFHERAQEAMMDETPDSSKLQMLIDMGSSLYVELPELPRLKQELQQ
ARWLDEVRLTLSDPQQVTLDVMKKLIDSGVGLAPHHAVEKAMAELQELLTVSERWEEKAKVCLQARPRHSVASLESIVNEAKNIPAFLPN
VLSLKEALQKAREWTAKVEAIQSGSNYAYLEQLESLSAKGRPIPVRLEALPQVESQVAAARAWRERTGRTFLKKNSSHTLLQVLSPRTDI
GVYGSGKNRRKKVKELIEKEKEKDLDLEPLSDLEEGLEETRDTAMVVAVFKEREQKEIEAMHSLRAANLAKMTMVDRIEEVKFCICRKTA
SGFMLQCELCKDWFHNSCVPLPKSSSQKKGSSWQAKEVKFLCPLCMRSRRPRLETILSLLVSLQKLPVRLPEGEALQCLTERAMSWQDRA
RQALATDELSSALAKLSVLSQRMVEQAAREKTEKIISAELQKAAANPDLQGHLPSFQQSAFNRVVSSVSSSPRQTMDYDDEETDSDEDIR
ETYGYDMKDTASVKSSSSLEPNLFCDEEIPIKSEEVVTHMWTAPSFCAEHAYSSASKSCSQGSSTPRKQPRKSPLVPRSLEPPVLELSPG

>In-frame_KDM5A_ENST00000399788_chr12_430161_-_NINJ2_ENST00000305108_chr12_675344_-_847aa
MAGVGPGGYAAEFVPPPECPVFEPSWEEFTDPLSFIGRIRPLAEKTGICKIRPPKDWQPPFACEVKSFRFTPRVQRLNELEAMTRVRLDF
LDQLAKFWELQGSTLKIPVVERKILDLYALSKIVASKGGFEMVTKEKKWSKVGSRLGYLPGKGTGSLLKSHYERILYPYELFQSGVSLMG
VQMPNLDLKEKVEPEVLSTDTQTSPEPGTRMNILPKRTRRVKTQSESGDVSRNTELKKLQIFGAGPKVVGLAMGTKDKEDEVTRRRKVTN
RSDAFNMQMRQRKGTLSVNFVDLYVCMFCGRGNNEDKLLLCDGCDDSYHTFCLIPPLPDVPKGDWRCPKCVAEECSKPREAFGFEQAVRE
YTLQSFGEMADNFKSDYFNMPVHMVPTELVEKEFWRLVSSIEEDVIVEYGADISSKDFGSGFPVKDGRRKILPEEEEYALSGWNLNNMPV
LEQSVLAHINVDISGMKVPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPSHAAEQLEEVMRELAPELFESQPDLLHQLVTIM
NPNVLMEHGVPVYRTNQCAGEFVVTFPRAYHSGFNQGYNFAEAVNFCTADWLPIGRQCVNHYRRLRRHCVFSHEELIFKMAADPECLDVG
LAAMVCKELTLMTEEETRLRESVVQMGVLMSEEEVFELVPDDERQCSACRTTCFLSALTCSCNPERLVCLYHPTDLCPCPMQKKCLRYRY
PLEDLPSLLYGVKVRAQSYDTWVSRVTEALSANFNHKKDLIELRVMLEDAEDRKYPENDLFRKLRDAVKEAETCASVAQLLLSKKQKHRQ

>In-frame_KDM5A_ENST00000399788_chr12_430161_-_NINJ2_ENST00000397265_chr12_675344_-_847aa
MAGVGPGGYAAEFVPPPECPVFEPSWEEFTDPLSFIGRIRPLAEKTGICKIRPPKDWQPPFACEVKSFRFTPRVQRLNELEAMTRVRLDF
LDQLAKFWELQGSTLKIPVVERKILDLYALSKIVASKGGFEMVTKEKKWSKVGSRLGYLPGKGTGSLLKSHYERILYPYELFQSGVSLMG
VQMPNLDLKEKVEPEVLSTDTQTSPEPGTRMNILPKRTRRVKTQSESGDVSRNTELKKLQIFGAGPKVVGLAMGTKDKEDEVTRRRKVTN
RSDAFNMQMRQRKGTLSVNFVDLYVCMFCGRGNNEDKLLLCDGCDDSYHTFCLIPPLPDVPKGDWRCPKCVAEECSKPREAFGFEQAVRE
YTLQSFGEMADNFKSDYFNMPVHMVPTELVEKEFWRLVSSIEEDVIVEYGADISSKDFGSGFPVKDGRRKILPEEEEYALSGWNLNNMPV
LEQSVLAHINVDISGMKVPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPSHAAEQLEEVMRELAPELFESQPDLLHQLVTIM
NPNVLMEHGVPVYRTNQCAGEFVVTFPRAYHSGFNQGYNFAEAVNFCTADWLPIGRQCVNHYRRLRRHCVFSHEELIFKMAADPECLDVG
LAAMVCKELTLMTEEETRLRESVVQMGVLMSEEEVFELVPDDERQCSACRTTCFLSALTCSCNPERLVCLYHPTDLCPCPMQKKCLRYRY
PLEDLPSLLYGVKVRAQSYDTWVSRVTEALSANFNHKKDLIELRVMLEDAEDRKYPENDLFRKLRDAVKEAETCASVAQLLLSKKQKHRQ

>In-frame_KDM5A_ENST00000382815_chr12_430161_-_NINJ2_ENST00000305108_chr12_675344_-_847aa
MAGVGPGGYAAEFVPPPECPVFEPSWEEFTDPLSFIGRIRPLAEKTGICKIRPPKDWQPPFACEVKSFRFTPRVQRLNELEAMTRVRLDF
LDQLAKFWELQGSTLKIPVVERKILDLYALSKIVASKGGFEMVTKEKKWSKVGSRLGYLPGKGTGSLLKSHYERILYPYELFQSGVSLMG
VQMPNLDLKEKVEPEVLSTDTQTSPEPGTRMNILPKRTRRVKTQSESGDVSRNTELKKLQIFGAGPKVVGLAMGTKDKEDEVTRRRKVTN
RSDAFNMQMRQRKGTLSVNFVDLYVCMFCGRGNNEDKLLLCDGCDDSYHTFCLIPPLPDVPKGDWRCPKCVAEECSKPREAFGFEQAVRE
YTLQSFGEMADNFKSDYFNMPVHMVPTELVEKEFWRLVSSIEEDVIVEYGADISSKDFGSGFPVKDGRRKILPEEEEYALSGWNLNNMPV
LEQSVLAHINVDISGMKVPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPSHAAEQLEEVMRELAPELFESQPDLLHQLVTIM
NPNVLMEHGVPVYRTNQCAGEFVVTFPRAYHSGFNQGYNFAEAVNFCTADWLPIGRQCVNHYRRLRRHCVFSHEELIFKMAADPECLDVG
LAAMVCKELTLMTEEETRLRESVVQMGVLMSEEEVFELVPDDERQCSACRTTCFLSALTCSCNPERLVCLYHPTDLCPCPMQKKCLRYRY
PLEDLPSLLYGVKVRAQSYDTWVSRVTEALSANFNHKKDLIELRVMLEDAEDRKYPENDLFRKLRDAVKEAETCASVAQLLLSKKQKHRQ

>In-frame_KDM5A_ENST00000382815_chr12_430161_-_NINJ2_ENST00000397265_chr12_675344_-_847aa
MAGVGPGGYAAEFVPPPECPVFEPSWEEFTDPLSFIGRIRPLAEKTGICKIRPPKDWQPPFACEVKSFRFTPRVQRLNELEAMTRVRLDF
LDQLAKFWELQGSTLKIPVVERKILDLYALSKIVASKGGFEMVTKEKKWSKVGSRLGYLPGKGTGSLLKSHYERILYPYELFQSGVSLMG
VQMPNLDLKEKVEPEVLSTDTQTSPEPGTRMNILPKRTRRVKTQSESGDVSRNTELKKLQIFGAGPKVVGLAMGTKDKEDEVTRRRKVTN
RSDAFNMQMRQRKGTLSVNFVDLYVCMFCGRGNNEDKLLLCDGCDDSYHTFCLIPPLPDVPKGDWRCPKCVAEECSKPREAFGFEQAVRE
YTLQSFGEMADNFKSDYFNMPVHMVPTELVEKEFWRLVSSIEEDVIVEYGADISSKDFGSGFPVKDGRRKILPEEEEYALSGWNLNNMPV
LEQSVLAHINVDISGMKVPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPSHAAEQLEEVMRELAPELFESQPDLLHQLVTIM
NPNVLMEHGVPVYRTNQCAGEFVVTFPRAYHSGFNQGYNFAEAVNFCTADWLPIGRQCVNHYRRLRRHCVFSHEELIFKMAADPECLDVG
LAAMVCKELTLMTEEETRLRESVVQMGVLMSEEEVFELVPDDERQCSACRTTCFLSALTCSCNPERLVCLYHPTDLCPCPMQKKCLRYRY
PLEDLPSLLYGVKVRAQSYDTWVSRVTEALSANFNHKKDLIELRVMLEDAEDRKYPENDLFRKLRDAVKEAETCASVAQLLLSKKQKHRQ

>In-frame_KDM5A_ENST00000399788_chr12_404739_-_NINJ2_ENST00000305108_chr12_675344_-_1485aa
MAGVGPGGYAAEFVPPPECPVFEPSWEEFTDPLSFIGRIRPLAEKTGICKIRPPKDWQPPFACEVKSFRFTPRVQRLNELEAMTRVRLDF
LDQLAKFWELQGSTLKIPVVERKILDLYALSKIVASKGGFEMVTKEKKWSKVGSRLGYLPGKGTGSLLKSHYERILYPYELFQSGVSLMG
VQMPNLDLKEKVEPEVLSTDTQTSPEPGTRMNILPKRTRRVKTQSESGDVSRNTELKKLQIFGAGPKVVGLAMGTKDKEDEVTRRRKVTN
RSDAFNMQMRQRKGTLSVNFVDLYVCMFCGRGNNEDKLLLCDGCDDSYHTFCLIPPLPDVPKGDWRCPKCVAEECSKPREAFGFEQAVRE
YTLQSFGEMADNFKSDYFNMPVHMVPTELVEKEFWRLVSSIEEDVIVEYGADISSKDFGSGFPVKDGRRKILPEEEEYALSGWNLNNMPV
LEQSVLAHINVDISGMKVPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPSHAAEQLEEVMRELAPELFESQPDLLHQLVTIM
NPNVLMEHGVPVYRTNQCAGEFVVTFPRAYHSGFNQGYNFAEAVNFCTADWLPIGRQCVNHYRRLRRHCVFSHEELIFKMAADPECLDVG
LAAMVCKELTLMTEEETRLRESVVQMGVLMSEEEVFELVPDDERQCSACRTTCFLSALTCSCNPERLVCLYHPTDLCPCPMQKKCLRYRY
PLEDLPSLLYGVKVRAQSYDTWVSRVTEALSANFNHKKDLIELRVMLEDAEDRKYPENDLFRKLRDAVKEAETCASVAQLLLSKKQKHRQ
SPDSGRTRTKLTVEELKAFVQQLFSLPCVISQARQVKNLLDDVEEFHERAQEAMMDETPDSSKLQMLIDMGSSLYVELPELPRLKQELQQ
ARWLDEVRLTLSDPQQVTLDVMKKLIDSGVGLAPHHAVEKAMAELQELLTVSERWEEKAKVCLQARPRHSVASLESIVNEAKNIPAFLPN
VLSLKEALQKAREWTAKVEAIQSGSNYAYLEQLESLSAKGRPIPVRLEALPQVESQVAAARAWRERTGRTFLKKNSSHTLLQVLSPRTDI
GVYGSGKNRRKKVKELIEKEKEKDLDLEPLSDLEEGLEETRDTAMVVAVFKEREQKEIEAMHSLRAANLAKMTMVDRIEEVKFCICRKTA
SGFMLQCELCKDWFHNSCVPLPKSSSQKKGSSWQAKEVKFLCPLCMRSRRPRLETILSLLVSLQKLPVRLPEGEALQCLTERAMSWQDRA
RQALATDELSSALAKLSVLSQRMVEQAAREKTEKIISAELQKAAANPDLQGHLPSFQQSAFNRVVSSVSSSPRQTMDYDDEETDSDEDIR
ETYGYDMKDTASVKSSSSLEPNLFCDEEIPIKSEEVVTHMWTAPSFCAEHAYSSASKSCSQGSSTPRKQPRKSPLVPRSLEPPVLELSPG

>In-frame_KDM5A_ENST00000399788_chr12_404739_-_NINJ2_ENST00000397265_chr12_675344_-_1485aa
MAGVGPGGYAAEFVPPPECPVFEPSWEEFTDPLSFIGRIRPLAEKTGICKIRPPKDWQPPFACEVKSFRFTPRVQRLNELEAMTRVRLDF
LDQLAKFWELQGSTLKIPVVERKILDLYALSKIVASKGGFEMVTKEKKWSKVGSRLGYLPGKGTGSLLKSHYERILYPYELFQSGVSLMG
VQMPNLDLKEKVEPEVLSTDTQTSPEPGTRMNILPKRTRRVKTQSESGDVSRNTELKKLQIFGAGPKVVGLAMGTKDKEDEVTRRRKVTN
RSDAFNMQMRQRKGTLSVNFVDLYVCMFCGRGNNEDKLLLCDGCDDSYHTFCLIPPLPDVPKGDWRCPKCVAEECSKPREAFGFEQAVRE
YTLQSFGEMADNFKSDYFNMPVHMVPTELVEKEFWRLVSSIEEDVIVEYGADISSKDFGSGFPVKDGRRKILPEEEEYALSGWNLNNMPV
LEQSVLAHINVDISGMKVPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPSHAAEQLEEVMRELAPELFESQPDLLHQLVTIM
NPNVLMEHGVPVYRTNQCAGEFVVTFPRAYHSGFNQGYNFAEAVNFCTADWLPIGRQCVNHYRRLRRHCVFSHEELIFKMAADPECLDVG
LAAMVCKELTLMTEEETRLRESVVQMGVLMSEEEVFELVPDDERQCSACRTTCFLSALTCSCNPERLVCLYHPTDLCPCPMQKKCLRYRY
PLEDLPSLLYGVKVRAQSYDTWVSRVTEALSANFNHKKDLIELRVMLEDAEDRKYPENDLFRKLRDAVKEAETCASVAQLLLSKKQKHRQ
SPDSGRTRTKLTVEELKAFVQQLFSLPCVISQARQVKNLLDDVEEFHERAQEAMMDETPDSSKLQMLIDMGSSLYVELPELPRLKQELQQ
ARWLDEVRLTLSDPQQVTLDVMKKLIDSGVGLAPHHAVEKAMAELQELLTVSERWEEKAKVCLQARPRHSVASLESIVNEAKNIPAFLPN
VLSLKEALQKAREWTAKVEAIQSGSNYAYLEQLESLSAKGRPIPVRLEALPQVESQVAAARAWRERTGRTFLKKNSSHTLLQVLSPRTDI
GVYGSGKNRRKKVKELIEKEKEKDLDLEPLSDLEEGLEETRDTAMVVAVFKEREQKEIEAMHSLRAANLAKMTMVDRIEEVKFCICRKTA
SGFMLQCELCKDWFHNSCVPLPKSSSQKKGSSWQAKEVKFLCPLCMRSRRPRLETILSLLVSLQKLPVRLPEGEALQCLTERAMSWQDRA
RQALATDELSSALAKLSVLSQRMVEQAAREKTEKIISAELQKAAANPDLQGHLPSFQQSAFNRVVSSVSSSPRQTMDYDDEETDSDEDIR
ETYGYDMKDTASVKSSSSLEPNLFCDEEIPIKSEEVVTHMWTAPSFCAEHAYSSASKSCSQGSSTPRKQPRKSPLVPRSLEPPVLELSPG

>In-frame_KDM5A_ENST00000382815_chr12_404739_-_NINJ2_ENST00000305108_chr12_675344_-_1485aa
MAGVGPGGYAAEFVPPPECPVFEPSWEEFTDPLSFIGRIRPLAEKTGICKIRPPKDWQPPFACEVKSFRFTPRVQRLNELEAMTRVRLDF
LDQLAKFWELQGSTLKIPVVERKILDLYALSKIVASKGGFEMVTKEKKWSKVGSRLGYLPGKGTGSLLKSHYERILYPYELFQSGVSLMG
VQMPNLDLKEKVEPEVLSTDTQTSPEPGTRMNILPKRTRRVKTQSESGDVSRNTELKKLQIFGAGPKVVGLAMGTKDKEDEVTRRRKVTN
RSDAFNMQMRQRKGTLSVNFVDLYVCMFCGRGNNEDKLLLCDGCDDSYHTFCLIPPLPDVPKGDWRCPKCVAEECSKPREAFGFEQAVRE
YTLQSFGEMADNFKSDYFNMPVHMVPTELVEKEFWRLVSSIEEDVIVEYGADISSKDFGSGFPVKDGRRKILPEEEEYALSGWNLNNMPV
LEQSVLAHINVDISGMKVPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPSHAAEQLEEVMRELAPELFESQPDLLHQLVTIM
NPNVLMEHGVPVYRTNQCAGEFVVTFPRAYHSGFNQGYNFAEAVNFCTADWLPIGRQCVNHYRRLRRHCVFSHEELIFKMAADPECLDVG
LAAMVCKELTLMTEEETRLRESVVQMGVLMSEEEVFELVPDDERQCSACRTTCFLSALTCSCNPERLVCLYHPTDLCPCPMQKKCLRYRY
PLEDLPSLLYGVKVRAQSYDTWVSRVTEALSANFNHKKDLIELRVMLEDAEDRKYPENDLFRKLRDAVKEAETCASVAQLLLSKKQKHRQ
SPDSGRTRTKLTVEELKAFVQQLFSLPCVISQARQVKNLLDDVEEFHERAQEAMMDETPDSSKLQMLIDMGSSLYVELPELPRLKQELQQ
ARWLDEVRLTLSDPQQVTLDVMKKLIDSGVGLAPHHAVEKAMAELQELLTVSERWEEKAKVCLQARPRHSVASLESIVNEAKNIPAFLPN
VLSLKEALQKAREWTAKVEAIQSGSNYAYLEQLESLSAKGRPIPVRLEALPQVESQVAAARAWRERTGRTFLKKNSSHTLLQVLSPRTDI
GVYGSGKNRRKKVKELIEKEKEKDLDLEPLSDLEEGLEETRDTAMVVAVFKEREQKEIEAMHSLRAANLAKMTMVDRIEEVKFCICRKTA
SGFMLQCELCKDWFHNSCVPLPKSSSQKKGSSWQAKEVKFLCPLCMRSRRPRLETILSLLVSLQKLPVRLPEGEALQCLTERAMSWQDRA
RQALATDELSSALAKLSVLSQRMVEQAAREKTEKIISAELQKAAANPDLQGHLPSFQQSAFNRVVSSVSSSPRQTMDYDDEETDSDEDIR
ETYGYDMKDTASVKSSSSLEPNLFCDEEIPIKSEEVVTHMWTAPSFCAEHAYSSASKSCSQGSSTPRKQPRKSPLVPRSLEPPVLELSPG

>In-frame_KDM5A_ENST00000382815_chr12_404739_-_NINJ2_ENST00000397265_chr12_675344_-_1485aa
MAGVGPGGYAAEFVPPPECPVFEPSWEEFTDPLSFIGRIRPLAEKTGICKIRPPKDWQPPFACEVKSFRFTPRVQRLNELEAMTRVRLDF
LDQLAKFWELQGSTLKIPVVERKILDLYALSKIVASKGGFEMVTKEKKWSKVGSRLGYLPGKGTGSLLKSHYERILYPYELFQSGVSLMG
VQMPNLDLKEKVEPEVLSTDTQTSPEPGTRMNILPKRTRRVKTQSESGDVSRNTELKKLQIFGAGPKVVGLAMGTKDKEDEVTRRRKVTN
RSDAFNMQMRQRKGTLSVNFVDLYVCMFCGRGNNEDKLLLCDGCDDSYHTFCLIPPLPDVPKGDWRCPKCVAEECSKPREAFGFEQAVRE
YTLQSFGEMADNFKSDYFNMPVHMVPTELVEKEFWRLVSSIEEDVIVEYGADISSKDFGSGFPVKDGRRKILPEEEEYALSGWNLNNMPV
LEQSVLAHINVDISGMKVPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPSHAAEQLEEVMRELAPELFESQPDLLHQLVTIM
NPNVLMEHGVPVYRTNQCAGEFVVTFPRAYHSGFNQGYNFAEAVNFCTADWLPIGRQCVNHYRRLRRHCVFSHEELIFKMAADPECLDVG
LAAMVCKELTLMTEEETRLRESVVQMGVLMSEEEVFELVPDDERQCSACRTTCFLSALTCSCNPERLVCLYHPTDLCPCPMQKKCLRYRY
PLEDLPSLLYGVKVRAQSYDTWVSRVTEALSANFNHKKDLIELRVMLEDAEDRKYPENDLFRKLRDAVKEAETCASVAQLLLSKKQKHRQ
SPDSGRTRTKLTVEELKAFVQQLFSLPCVISQARQVKNLLDDVEEFHERAQEAMMDETPDSSKLQMLIDMGSSLYVELPELPRLKQELQQ
ARWLDEVRLTLSDPQQVTLDVMKKLIDSGVGLAPHHAVEKAMAELQELLTVSERWEEKAKVCLQARPRHSVASLESIVNEAKNIPAFLPN
VLSLKEALQKAREWTAKVEAIQSGSNYAYLEQLESLSAKGRPIPVRLEALPQVESQVAAARAWRERTGRTFLKKNSSHTLLQVLSPRTDI
GVYGSGKNRRKKVKELIEKEKEKDLDLEPLSDLEEGLEETRDTAMVVAVFKEREQKEIEAMHSLRAANLAKMTMVDRIEEVKFCICRKTA
SGFMLQCELCKDWFHNSCVPLPKSSSQKKGSSWQAKEVKFLCPLCMRSRRPRLETILSLLVSLQKLPVRLPEGEALQCLTERAMSWQDRA
RQALATDELSSALAKLSVLSQRMVEQAAREKTEKIISAELQKAAANPDLQGHLPSFQQSAFNRVVSSVSSSPRQTMDYDDEETDSDEDIR
ETYGYDMKDTASVKSSSSLEPNLFCDEEIPIKSEEVVTHMWTAPSFCAEHAYSSASKSCSQGSSTPRKQPRKSPLVPRSLEPPVLELSPG

>In-frame_KDM5A_ENST00000399788_chr12_459787_-_NINJ2_ENST00000305108_chr12_675344_-_436aa
MAGVGPGGYAAEFVPPPECPVFEPSWEEFTDPLSFIGRIRPLAEKTGICKIRPPKDWQPPFACEVKSFRFTPRVQRLNELEAMTRVRLDF
LDQLAKFWELQGSTLKIPVVERKILDLYALSKIVASKGGFEMVTKEKKWSKVGSRLGYLPGKGTGSLLKSHYERILYPYELFQSGVSLMG
VQMPNLDLKEKVEPEVLSTDTQTSPEPGTRMNILPKRTRRVKTQSESGDVSRNTELKKLQIFGAGPKVVGLAMGTKDKEDEVTRRRKVTN
RSDAFNMQMRQRKGTLSVNFVDLYVCMFCGRGNNEDKLLLCDGCDDSYHTFCLIPPLPDVPKGDWRCPKCVAEECSKPREAFGFEQAVRE

>In-frame_KDM5A_ENST00000399788_chr12_459787_-_NINJ2_ENST00000397265_chr12_675344_-_436aa
MAGVGPGGYAAEFVPPPECPVFEPSWEEFTDPLSFIGRIRPLAEKTGICKIRPPKDWQPPFACEVKSFRFTPRVQRLNELEAMTRVRLDF
LDQLAKFWELQGSTLKIPVVERKILDLYALSKIVASKGGFEMVTKEKKWSKVGSRLGYLPGKGTGSLLKSHYERILYPYELFQSGVSLMG
VQMPNLDLKEKVEPEVLSTDTQTSPEPGTRMNILPKRTRRVKTQSESGDVSRNTELKKLQIFGAGPKVVGLAMGTKDKEDEVTRRRKVTN
RSDAFNMQMRQRKGTLSVNFVDLYVCMFCGRGNNEDKLLLCDGCDDSYHTFCLIPPLPDVPKGDWRCPKCVAEECSKPREAFGFEQAVRE

>In-frame_KDM5A_ENST00000382815_chr12_459787_-_NINJ2_ENST00000305108_chr12_675344_-_436aa
MAGVGPGGYAAEFVPPPECPVFEPSWEEFTDPLSFIGRIRPLAEKTGICKIRPPKDWQPPFACEVKSFRFTPRVQRLNELEAMTRVRLDF
LDQLAKFWELQGSTLKIPVVERKILDLYALSKIVASKGGFEMVTKEKKWSKVGSRLGYLPGKGTGSLLKSHYERILYPYELFQSGVSLMG
VQMPNLDLKEKVEPEVLSTDTQTSPEPGTRMNILPKRTRRVKTQSESGDVSRNTELKKLQIFGAGPKVVGLAMGTKDKEDEVTRRRKVTN
RSDAFNMQMRQRKGTLSVNFVDLYVCMFCGRGNNEDKLLLCDGCDDSYHTFCLIPPLPDVPKGDWRCPKCVAEECSKPREAFGFEQAVRE

>In-frame_KDM5A_ENST00000382815_chr12_459787_-_NINJ2_ENST00000397265_chr12_675344_-_436aa
MAGVGPGGYAAEFVPPPECPVFEPSWEEFTDPLSFIGRIRPLAEKTGICKIRPPKDWQPPFACEVKSFRFTPRVQRLNELEAMTRVRLDF
LDQLAKFWELQGSTLKIPVVERKILDLYALSKIVASKGGFEMVTKEKKWSKVGSRLGYLPGKGTGSLLKSHYERILYPYELFQSGVSLMG
VQMPNLDLKEKVEPEVLSTDTQTSPEPGTRMNILPKRTRRVKTQSESGDVSRNTELKKLQIFGAGPKVVGLAMGTKDKEDEVTRRRKVTN
RSDAFNMQMRQRKGTLSVNFVDLYVCMFCGRGNNEDKLLLCDGCDDSYHTFCLIPPLPDVPKGDWRCPKCVAEECSKPREAFGFEQAVRE


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_KDM5A_ENST00000399788_chr12_404739_-_NINJ2_ENST00000305108_chr12_675344_-_4455nt
ATGGCGGGCGTGGGGCCGGGGGGCTACGCGGCGGAGTTCGTGCCACCGCCAGAGTGCCCCGTCTTTGAGCCGAGTTGGGAGGAGTTCACA
GATCCGCTCAGCTTTATCGGCCGCATCCGGCCTTTGGCGGAGAAAACCGGCATCTGCAAAATTCGGCCGCCCAAGGACTGGCAGCCTCCA
TTTGCCTGTGAAGTAAAAAGCTTTCGTTTCACTCCAAGAGTCCAGCGCCTGAATGAACTTGAGGCAATGACCAGAGTGAGATTGGATTTC
TTGGATCAACTAGCAAAATTTTGGGAACTTCAAGGATCTACTCTGAAGATCCCTGTGGTAGAGAGAAAAATCCTGGATCTGTATGCTTTG
AGCAAGATTGTTGCCAGCAAAGGAGGTTTTGAAATGGTCACCAAAGAGAAGAAATGGTCTAAAGTGGGTAGTCGCTTGGGATATCTGCCA
GGAAAAGGAACTGGGTCTCTTTTGAAGTCACATTATGAAAGAATTCTCTACCCATATGAGCTTTTCCAGTCTGGTGTGAGCCTTATGGGT
GTGCAGATGCCTAATTTAGATCTTAAAGAAAAAGTGGAGCCTGAGGTTCTCAGCACTGATACCCAAACTTCCCCAGAGCCAGGCACAAGG
ATGAACATTCTGCCGAAGAGAACAAGACGTGTGAAGACTCAGTCAGAATCTGGAGATGTGAGTAGAAACACGGAACTGAAGAAACTTCAG
ATTTTTGGGGCTGGGCCCAAGGTTGTGGGCTTGGCAATGGGAACAAAAGATAAAGAAGATGAGGTCACCCGAAGACGAAAAGTTACCAAC
AGGTCAGACGCATTTAACATGCAAATGAGACAACGGAAAGGCACTCTCTCTGTTAACTTTGTTGATCTCTATGTTTGTATGTTTTGTGGT
CGGGGAAACAATGAAGATAAATTGCTTTTGTGTGATGGATGTGATGACAGCTATCATACATTTTGTCTAATTCCTCCACTACCTGATGTG
CCCAAAGGAGACTGGAGGTGTCCTAAATGTGTCGCCGAGGAATGTAGCAAACCTCGAGAAGCCTTTGGATTTGAACAAGCTGTACGAGAG
TATACACTTCAGAGCTTTGGAGAGATGGCAGATAATTTTAAGTCTGATTATTTTAATATGCCAGTCCATATGGTTCCCACAGAACTAGTA
GAAAAGGAATTTTGGCGGCTGGTAAGCAGCATTGAAGAAGATGTTATTGTGGAATATGGAGCAGATATCTCCTCAAAAGACTTTGGAAGT
GGATTTCCGGTGAAGGATGGGCGGAGAAAGATTCTGCCAGAAGAAGAGGAATATGCACTTTCTGGTTGGAATTTGAATAACATGCCTGTC
CTGGAACAGTCTGTTCTTGCACATATTAATGTGGACATCTCTGGTATGAAAGTGCCGTGGCTCTATGTGGGAATGTGCTTCTCTTCTTTT
TGCTGGCACATTGAGGATCACTGGAGTTATTCCATCAACTACTTGCACTGGGGGGAGCCAAAGACATGGTATGGTGTGCCATCTCATGCT
GCAGAGCAACTGGAGGAGGTGATGAGAGAGCTGGCCCCCGAGTTATTTGAATCCCAGCCTGATCTTCTGCATCAGTTAGTTACCATCATG
AACCCCAACGTGCTAATGGAGCATGGTGTGCCTGTGTACAGGACCAATCAGTGTGCTGGCGAGTTTGTTGTGACATTTCCTCGTGCCTAT
CACTCTGGATTTAACCAGGGCTACAACTTTGCTGAAGCTGTGAACTTCTGTACTGCTGACTGGTTGCCCATTGGACGTCAATGTGTAAAT
CATTACCGACGCCTAAGGCGCCACTGTGTCTTTTCACACGAGGAACTAATTTTCAAGATGGCAGCAGATCCAGAATGCTTAGATGTGGGG
CTGGCTGCCATGGTCTGCAAAGAATTGACTCTCATGACTGAAGAAGAAACACGATTAAGAGAGTCTGTTGTACAGATGGGTGTCCTGATG
TCAGAAGAAGAAGTGTTTGAACTTGTTCCTGATGATGAGCGGCAGTGTTCAGCATGCAGAACCACATGTTTTCTCTCTGCTCTCACATGT
TCCTGTAATCCTGAGCGGCTTGTATGTCTCTACCATCCAACTGATCTGTGCCCCTGCCCCATGCAGAAGAAATGTCTTAGATATCGCTAC
CCATTAGAAGACCTCCCTTCTCTGCTATATGGTGTAAAAGTCAGGGCACAGTCCTATGACACTTGGGTCAGTCGTGTTACAGAAGCATTG
TCTGCTAACTTCAACCACAAAAAAGATTTGATTGAATTGCGAGTAATGCTGGAAGATGCTGAGGATAGGAAATACCCAGAGAATGATCTC
TTTCGAAAACTCAGGGATGCTGTAAAAGAAGCTGAGACCTGTGCTTCTGTGGCTCAGCTGCTTCTGAGCAAAAAGCAGAAACACAGACAG
AGCCCAGATAGTGGGAGGACTCGGACCAAACTGACAGTGGAAGAATTGAAGGCCTTTGTCCAACAACTTTTTAGTCTTCCGTGTGTCATC
AGCCAAGCTCGGCAAGTAAAGAATCTGCTAGATGATGTGGAAGAGTTTCATGAACGTGCTCAGGAGGCCATGATGGATGAAACCCCAGAT
TCTTCCAAACTCCAGATGTTGATAGATATGGGCTCTAGTCTCTATGTGGAACTCCCTGAATTACCACGACTGAAGCAAGAGCTACAACAG
GCTCGGTGGTTGGACGAAGTAAGACTGACCTTATCAGATCCGCAACAAGTCACTTTGGATGTCATGAAGAAGCTGATAGACTCTGGGGTA
GGGTTGGCACCCCACCATGCTGTGGAGAAAGCAATGGCTGAACTACAGGAGCTCCTTACAGTCTCTGAACGATGGGAAGAAAAGGCTAAG
GTCTGCCTACAGGCAAGACCGAGGCACAGTGTGGCAAGTTTAGAAAGCATTGTGAATGAAGCCAAGAACATTCCAGCCTTTCTACCCAAT
GTGTTGTCCTTGAAAGAAGCCTTACAAAAGGCTCGAGAATGGACCGCTAAAGTGGAAGCTATTCAGAGTGGCAGCAATTACGCTTATTTG
GAGCAGCTTGAGAGCTTGTCTGCGAAAGGACGCCCTATTCCTGTGCGTCTTGAAGCACTGCCGCAAGTGGAATCACAGGTAGCAGCAGCA
CGGGCATGGAGAGAACGGACTGGGCGGACGTTTCTTAAGAAGAATTCTAGCCATACATTGTTACAGGTGCTGAGCCCCCGGACCGACATT
GGTGTATATGGGAGTGGCAAAAATAGGAGGAAAAAAGTAAAAGAACTAATAGAAAAAGAAAAAGAAAAGGATCTGGACCTGGAGCCTCTG
AGTGATCTGGAGGAAGGATTGGAGGAAACCAGAGATACAGCCATGGTGGTGGCAGTTTTCAAAGAACGGGAGCAAAAAGAGATTGAAGCC
ATGCATTCTCTCAGAGCAGCCAACCTAGCCAAGATGACAATGGTGGACCGCATAGAAGAAGTAAAATTTTGCATTTGCCGCAAGACAGCC
AGTGGGTTTATGCTACAGTGTGAGCTCTGCAAAGACTGGTTCCATAACAGCTGTGTTCCTCTTCCTAAATCAAGTTCCCAAAAAAAAGGA
TCCAGCTGGCAAGCTAAAGAAGTAAAATTCCTTTGCCCTCTTTGTATGCGGTCTCGAAGGCCCAGGCTAGAGACTATTCTGTCACTCCTG
GTATCCCTTCAGAAGTTGCCCGTACGGTTGCCTGAAGGAGAGGCCCTGCAGTGTTTGACAGAACGTGCTATGAGTTGGCAAGATAGAGCG
CGGCAGGCTCTAGCCACAGATGAACTATCCTCTGCCCTGGCCAAACTATCTGTGTTGAGCCAGCGTATGGTGGAACAGGCGGCTCGAGAA
AAAACTGAAAAGATCATCAGTGCAGAACTCCAAAAAGCAGCTGCCAATCCAGACTTACAGGGACACTTACCTAGTTTCCAGCAGTCTGCT
TTTAACCGGGTGGTGAGCAGTGTGTCATCTTCTCCTCGACAAACAATGGACTATGATGATGAAGAAACAGACTCTGATGAAGACATTCGA
GAGACATATGGCTACGACATGAAGGACACAGCCAGTGTGAAGTCCTCTAGTAGTCTTGAACCCAATCTTTTTTGTGATGAAGAGATTCCC
ATCAAATCCGAGGAGGTGGTGACCCACATGTGGACAGCACCTTCATTTTGTGCAGAGCATGCTTATTCTTCTGCTTCTAAGAGTTGTTCT
CAAGGTTCTAGCACCCCAAGGAAACAACCTCGGAAGAGCCCTTTGGTGCCCCGAAGTTTGGAACCTCCAGTGCTGGAGTTGTCACCTGGA
GCTAAGGCACAACTGGAAGAACTTATGATGGTTGGAGATCTCCTGGAAGTATCTCTGGACGAGACTCAACACATATGGCGGATTTTGCAG

>In-frame_KDM5A_ENST00000399788_chr12_404739_-_NINJ2_ENST00000397265_chr12_675344_-_4455nt
ATGGCGGGCGTGGGGCCGGGGGGCTACGCGGCGGAGTTCGTGCCACCGCCAGAGTGCCCCGTCTTTGAGCCGAGTTGGGAGGAGTTCACA
GATCCGCTCAGCTTTATCGGCCGCATCCGGCCTTTGGCGGAGAAAACCGGCATCTGCAAAATTCGGCCGCCCAAGGACTGGCAGCCTCCA
TTTGCCTGTGAAGTAAAAAGCTTTCGTTTCACTCCAAGAGTCCAGCGCCTGAATGAACTTGAGGCAATGACCAGAGTGAGATTGGATTTC
TTGGATCAACTAGCAAAATTTTGGGAACTTCAAGGATCTACTCTGAAGATCCCTGTGGTAGAGAGAAAAATCCTGGATCTGTATGCTTTG
AGCAAGATTGTTGCCAGCAAAGGAGGTTTTGAAATGGTCACCAAAGAGAAGAAATGGTCTAAAGTGGGTAGTCGCTTGGGATATCTGCCA
GGAAAAGGAACTGGGTCTCTTTTGAAGTCACATTATGAAAGAATTCTCTACCCATATGAGCTTTTCCAGTCTGGTGTGAGCCTTATGGGT
GTGCAGATGCCTAATTTAGATCTTAAAGAAAAAGTGGAGCCTGAGGTTCTCAGCACTGATACCCAAACTTCCCCAGAGCCAGGCACAAGG
ATGAACATTCTGCCGAAGAGAACAAGACGTGTGAAGACTCAGTCAGAATCTGGAGATGTGAGTAGAAACACGGAACTGAAGAAACTTCAG
ATTTTTGGGGCTGGGCCCAAGGTTGTGGGCTTGGCAATGGGAACAAAAGATAAAGAAGATGAGGTCACCCGAAGACGAAAAGTTACCAAC
AGGTCAGACGCATTTAACATGCAAATGAGACAACGGAAAGGCACTCTCTCTGTTAACTTTGTTGATCTCTATGTTTGTATGTTTTGTGGT
CGGGGAAACAATGAAGATAAATTGCTTTTGTGTGATGGATGTGATGACAGCTATCATACATTTTGTCTAATTCCTCCACTACCTGATGTG
CCCAAAGGAGACTGGAGGTGTCCTAAATGTGTCGCCGAGGAATGTAGCAAACCTCGAGAAGCCTTTGGATTTGAACAAGCTGTACGAGAG
TATACACTTCAGAGCTTTGGAGAGATGGCAGATAATTTTAAGTCTGATTATTTTAATATGCCAGTCCATATGGTTCCCACAGAACTAGTA
GAAAAGGAATTTTGGCGGCTGGTAAGCAGCATTGAAGAAGATGTTATTGTGGAATATGGAGCAGATATCTCCTCAAAAGACTTTGGAAGT
GGATTTCCGGTGAAGGATGGGCGGAGAAAGATTCTGCCAGAAGAAGAGGAATATGCACTTTCTGGTTGGAATTTGAATAACATGCCTGTC
CTGGAACAGTCTGTTCTTGCACATATTAATGTGGACATCTCTGGTATGAAAGTGCCGTGGCTCTATGTGGGAATGTGCTTCTCTTCTTTT
TGCTGGCACATTGAGGATCACTGGAGTTATTCCATCAACTACTTGCACTGGGGGGAGCCAAAGACATGGTATGGTGTGCCATCTCATGCT
GCAGAGCAACTGGAGGAGGTGATGAGAGAGCTGGCCCCCGAGTTATTTGAATCCCAGCCTGATCTTCTGCATCAGTTAGTTACCATCATG
AACCCCAACGTGCTAATGGAGCATGGTGTGCCTGTGTACAGGACCAATCAGTGTGCTGGCGAGTTTGTTGTGACATTTCCTCGTGCCTAT
CACTCTGGATTTAACCAGGGCTACAACTTTGCTGAAGCTGTGAACTTCTGTACTGCTGACTGGTTGCCCATTGGACGTCAATGTGTAAAT
CATTACCGACGCCTAAGGCGCCACTGTGTCTTTTCACACGAGGAACTAATTTTCAAGATGGCAGCAGATCCAGAATGCTTAGATGTGGGG
CTGGCTGCCATGGTCTGCAAAGAATTGACTCTCATGACTGAAGAAGAAACACGATTAAGAGAGTCTGTTGTACAGATGGGTGTCCTGATG
TCAGAAGAAGAAGTGTTTGAACTTGTTCCTGATGATGAGCGGCAGTGTTCAGCATGCAGAACCACATGTTTTCTCTCTGCTCTCACATGT
TCCTGTAATCCTGAGCGGCTTGTATGTCTCTACCATCCAACTGATCTGTGCCCCTGCCCCATGCAGAAGAAATGTCTTAGATATCGCTAC
CCATTAGAAGACCTCCCTTCTCTGCTATATGGTGTAAAAGTCAGGGCACAGTCCTATGACACTTGGGTCAGTCGTGTTACAGAAGCATTG
TCTGCTAACTTCAACCACAAAAAAGATTTGATTGAATTGCGAGTAATGCTGGAAGATGCTGAGGATAGGAAATACCCAGAGAATGATCTC
TTTCGAAAACTCAGGGATGCTGTAAAAGAAGCTGAGACCTGTGCTTCTGTGGCTCAGCTGCTTCTGAGCAAAAAGCAGAAACACAGACAG
AGCCCAGATAGTGGGAGGACTCGGACCAAACTGACAGTGGAAGAATTGAAGGCCTTTGTCCAACAACTTTTTAGTCTTCCGTGTGTCATC
AGCCAAGCTCGGCAAGTAAAGAATCTGCTAGATGATGTGGAAGAGTTTCATGAACGTGCTCAGGAGGCCATGATGGATGAAACCCCAGAT
TCTTCCAAACTCCAGATGTTGATAGATATGGGCTCTAGTCTCTATGTGGAACTCCCTGAATTACCACGACTGAAGCAAGAGCTACAACAG
GCTCGGTGGTTGGACGAAGTAAGACTGACCTTATCAGATCCGCAACAAGTCACTTTGGATGTCATGAAGAAGCTGATAGACTCTGGGGTA
GGGTTGGCACCCCACCATGCTGTGGAGAAAGCAATGGCTGAACTACAGGAGCTCCTTACAGTCTCTGAACGATGGGAAGAAAAGGCTAAG
GTCTGCCTACAGGCAAGACCGAGGCACAGTGTGGCAAGTTTAGAAAGCATTGTGAATGAAGCCAAGAACATTCCAGCCTTTCTACCCAAT
GTGTTGTCCTTGAAAGAAGCCTTACAAAAGGCTCGAGAATGGACCGCTAAAGTGGAAGCTATTCAGAGTGGCAGCAATTACGCTTATTTG
GAGCAGCTTGAGAGCTTGTCTGCGAAAGGACGCCCTATTCCTGTGCGTCTTGAAGCACTGCCGCAAGTGGAATCACAGGTAGCAGCAGCA
CGGGCATGGAGAGAACGGACTGGGCGGACGTTTCTTAAGAAGAATTCTAGCCATACATTGTTACAGGTGCTGAGCCCCCGGACCGACATT
GGTGTATATGGGAGTGGCAAAAATAGGAGGAAAAAAGTAAAAGAACTAATAGAAAAAGAAAAAGAAAAGGATCTGGACCTGGAGCCTCTG
AGTGATCTGGAGGAAGGATTGGAGGAAACCAGAGATACAGCCATGGTGGTGGCAGTTTTCAAAGAACGGGAGCAAAAAGAGATTGAAGCC
ATGCATTCTCTCAGAGCAGCCAACCTAGCCAAGATGACAATGGTGGACCGCATAGAAGAAGTAAAATTTTGCATTTGCCGCAAGACAGCC
AGTGGGTTTATGCTACAGTGTGAGCTCTGCAAAGACTGGTTCCATAACAGCTGTGTTCCTCTTCCTAAATCAAGTTCCCAAAAAAAAGGA
TCCAGCTGGCAAGCTAAAGAAGTAAAATTCCTTTGCCCTCTTTGTATGCGGTCTCGAAGGCCCAGGCTAGAGACTATTCTGTCACTCCTG
GTATCCCTTCAGAAGTTGCCCGTACGGTTGCCTGAAGGAGAGGCCCTGCAGTGTTTGACAGAACGTGCTATGAGTTGGCAAGATAGAGCG
CGGCAGGCTCTAGCCACAGATGAACTATCCTCTGCCCTGGCCAAACTATCTGTGTTGAGCCAGCGTATGGTGGAACAGGCGGCTCGAGAA
AAAACTGAAAAGATCATCAGTGCAGAACTCCAAAAAGCAGCTGCCAATCCAGACTTACAGGGACACTTACCTAGTTTCCAGCAGTCTGCT
TTTAACCGGGTGGTGAGCAGTGTGTCATCTTCTCCTCGACAAACAATGGACTATGATGATGAAGAAACAGACTCTGATGAAGACATTCGA
GAGACATATGGCTACGACATGAAGGACACAGCCAGTGTGAAGTCCTCTAGTAGTCTTGAACCCAATCTTTTTTGTGATGAAGAGATTCCC
ATCAAATCCGAGGAGGTGGTGACCCACATGTGGACAGCACCTTCATTTTGTGCAGAGCATGCTTATTCTTCTGCTTCTAAGAGTTGTTCT
CAAGGTTCTAGCACCCCAAGGAAACAACCTCGGAAGAGCCCTTTGGTGCCCCGAAGTTTGGAACCTCCAGTGCTGGAGTTGTCACCTGGA
GCTAAGGCACAACTGGAAGAACTTATGATGGTTGGAGATCTCCTGGAAGTATCTCTGGACGAGACTCAACACATATGGCGGATTTTGCAG

>In-frame_KDM5A_ENST00000382815_chr12_404739_-_NINJ2_ENST00000305108_chr12_675344_-_4455nt
ATGGCGGGCGTGGGGCCGGGGGGCTACGCGGCGGAGTTCGTGCCACCGCCAGAGTGCCCCGTCTTTGAGCCGAGTTGGGAGGAGTTCACA
GATCCGCTCAGCTTTATCGGCCGCATCCGGCCTTTGGCGGAGAAAACCGGCATCTGCAAAATTCGGCCGCCCAAGGACTGGCAGCCTCCA
TTTGCCTGTGAAGTAAAAAGCTTTCGTTTCACTCCAAGAGTCCAGCGCCTGAATGAACTTGAGGCAATGACCAGAGTGAGATTGGATTTC
TTGGATCAACTAGCAAAATTTTGGGAACTTCAAGGATCTACTCTGAAGATCCCTGTGGTAGAGAGAAAAATCCTGGATCTGTATGCTTTG
AGCAAGATTGTTGCCAGCAAAGGAGGTTTTGAAATGGTCACCAAAGAGAAGAAATGGTCTAAAGTGGGTAGTCGCTTGGGATATCTGCCA
GGAAAAGGAACTGGGTCTCTTTTGAAGTCACATTATGAAAGAATTCTCTACCCATATGAGCTTTTCCAGTCTGGTGTGAGCCTTATGGGT
GTGCAGATGCCTAATTTAGATCTTAAAGAAAAAGTGGAGCCTGAGGTTCTCAGCACTGATACCCAAACTTCCCCAGAGCCAGGCACAAGG
ATGAACATTCTGCCGAAGAGAACAAGACGTGTGAAGACTCAGTCAGAATCTGGAGATGTGAGTAGAAACACGGAACTGAAGAAACTTCAG
ATTTTTGGGGCTGGGCCCAAGGTTGTGGGCTTGGCAATGGGAACAAAAGATAAAGAAGATGAGGTCACCCGAAGACGAAAAGTTACCAAC
AGGTCAGACGCATTTAACATGCAAATGAGACAACGGAAAGGCACTCTCTCTGTTAACTTTGTTGATCTCTATGTTTGTATGTTTTGTGGT
CGGGGAAACAATGAAGATAAATTGCTTTTGTGTGATGGATGTGATGACAGCTATCATACATTTTGTCTAATTCCTCCACTACCTGATGTG
CCCAAAGGAGACTGGAGGTGTCCTAAATGTGTCGCCGAGGAATGTAGCAAACCTCGAGAAGCCTTTGGATTTGAACAAGCTGTACGAGAG
TATACACTTCAGAGCTTTGGAGAGATGGCAGATAATTTTAAGTCTGATTATTTTAATATGCCAGTCCATATGGTTCCCACAGAACTAGTA
GAAAAGGAATTTTGGCGGCTGGTAAGCAGCATTGAAGAAGATGTTATTGTGGAATATGGAGCAGATATCTCCTCAAAAGACTTTGGAAGT
GGATTTCCGGTGAAGGATGGGCGGAGAAAGATTCTGCCAGAAGAAGAGGAATATGCACTTTCTGGTTGGAATTTGAATAACATGCCTGTC
CTGGAACAGTCTGTTCTTGCACATATTAATGTGGACATCTCTGGTATGAAAGTGCCGTGGCTCTATGTGGGAATGTGCTTCTCTTCTTTT
TGCTGGCACATTGAGGATCACTGGAGTTATTCCATCAACTACTTGCACTGGGGGGAGCCAAAGACATGGTATGGTGTGCCATCTCATGCT
GCAGAGCAACTGGAGGAGGTGATGAGAGAGCTGGCCCCCGAGTTATTTGAATCCCAGCCTGATCTTCTGCATCAGTTAGTTACCATCATG
AACCCCAACGTGCTAATGGAGCATGGTGTGCCTGTGTACAGGACCAATCAGTGTGCTGGCGAGTTTGTTGTGACATTTCCTCGTGCCTAT
CACTCTGGATTTAACCAGGGCTACAACTTTGCTGAAGCTGTGAACTTCTGTACTGCTGACTGGTTGCCCATTGGACGTCAATGTGTAAAT
CATTACCGACGCCTAAGGCGCCACTGTGTCTTTTCACACGAGGAACTAATTTTCAAGATGGCAGCAGATCCAGAATGCTTAGATGTGGGG
CTGGCTGCCATGGTCTGCAAAGAATTGACTCTCATGACTGAAGAAGAAACACGATTAAGAGAGTCTGTTGTACAGATGGGTGTCCTGATG
TCAGAAGAAGAAGTGTTTGAACTTGTTCCTGATGATGAGCGGCAGTGTTCAGCATGCAGAACCACATGTTTTCTCTCTGCTCTCACATGT
TCCTGTAATCCTGAGCGGCTTGTATGTCTCTACCATCCAACTGATCTGTGCCCCTGCCCCATGCAGAAGAAATGTCTTAGATATCGCTAC
CCATTAGAAGACCTCCCTTCTCTGCTATATGGTGTAAAAGTCAGGGCACAGTCCTATGACACTTGGGTCAGTCGTGTTACAGAAGCATTG
TCTGCTAACTTCAACCACAAAAAAGATTTGATTGAATTGCGAGTAATGCTGGAAGATGCTGAGGATAGGAAATACCCAGAGAATGATCTC
TTTCGAAAACTCAGGGATGCTGTAAAAGAAGCTGAGACCTGTGCTTCTGTGGCTCAGCTGCTTCTGAGCAAAAAGCAGAAACACAGACAG
AGCCCAGATAGTGGGAGGACTCGGACCAAACTGACAGTGGAAGAATTGAAGGCCTTTGTCCAACAACTTTTTAGTCTTCCGTGTGTCATC
AGCCAAGCTCGGCAAGTAAAGAATCTGCTAGATGATGTGGAAGAGTTTCATGAACGTGCTCAGGAGGCCATGATGGATGAAACCCCAGAT
TCTTCCAAACTCCAGATGTTGATAGATATGGGCTCTAGTCTCTATGTGGAACTCCCTGAATTACCACGACTGAAGCAAGAGCTACAACAG
GCTCGGTGGTTGGACGAAGTAAGACTGACCTTATCAGATCCGCAACAAGTCACTTTGGATGTCATGAAGAAGCTGATAGACTCTGGGGTA
GGGTTGGCACCCCACCATGCTGTGGAGAAAGCAATGGCTGAACTACAGGAGCTCCTTACAGTCTCTGAACGATGGGAAGAAAAGGCTAAG
GTCTGCCTACAGGCAAGACCGAGGCACAGTGTGGCAAGTTTAGAAAGCATTGTGAATGAAGCCAAGAACATTCCAGCCTTTCTACCCAAT
GTGTTGTCCTTGAAAGAAGCCTTACAAAAGGCTCGAGAATGGACCGCTAAAGTGGAAGCTATTCAGAGTGGCAGCAATTACGCTTATTTG
GAGCAGCTTGAGAGCTTGTCTGCGAAAGGACGCCCTATTCCTGTGCGTCTTGAAGCACTGCCGCAAGTGGAATCACAGGTAGCAGCAGCA
CGGGCATGGAGAGAACGGACTGGGCGGACGTTTCTTAAGAAGAATTCTAGCCATACATTGTTACAGGTGCTGAGCCCCCGGACCGACATT
GGTGTATATGGGAGTGGCAAAAATAGGAGGAAAAAAGTAAAAGAACTAATAGAAAAAGAAAAAGAAAAGGATCTGGACCTGGAGCCTCTG
AGTGATCTGGAGGAAGGATTGGAGGAAACCAGAGATACAGCCATGGTGGTGGCAGTTTTCAAAGAACGGGAGCAAAAAGAGATTGAAGCC
ATGCATTCTCTCAGAGCAGCCAACCTAGCCAAGATGACAATGGTGGACCGCATAGAAGAAGTAAAATTTTGCATTTGCCGCAAGACAGCC
AGTGGGTTTATGCTACAGTGTGAGCTCTGCAAAGACTGGTTCCATAACAGCTGTGTTCCTCTTCCTAAATCAAGTTCCCAAAAAAAAGGA
TCCAGCTGGCAAGCTAAAGAAGTAAAATTCCTTTGCCCTCTTTGTATGCGGTCTCGAAGGCCCAGGCTAGAGACTATTCTGTCACTCCTG
GTATCCCTTCAGAAGTTGCCCGTACGGTTGCCTGAAGGAGAGGCCCTGCAGTGTTTGACAGAACGTGCTATGAGTTGGCAAGATAGAGCG
CGGCAGGCTCTAGCCACAGATGAACTATCCTCTGCCCTGGCCAAACTATCTGTGTTGAGCCAGCGTATGGTGGAACAGGCGGCTCGAGAA
AAAACTGAAAAGATCATCAGTGCAGAACTCCAAAAAGCAGCTGCCAATCCAGACTTACAGGGACACTTACCTAGTTTCCAGCAGTCTGCT
TTTAACCGGGTGGTGAGCAGTGTGTCATCTTCTCCTCGACAAACAATGGACTATGATGATGAAGAAACAGACTCTGATGAAGACATTCGA
GAGACATATGGCTACGACATGAAGGACACAGCCAGTGTGAAGTCCTCTAGTAGTCTTGAACCCAATCTTTTTTGTGATGAAGAGATTCCC
ATCAAATCCGAGGAGGTGGTGACCCACATGTGGACAGCACCTTCATTTTGTGCAGAGCATGCTTATTCTTCTGCTTCTAAGAGTTGTTCT
CAAGGTTCTAGCACCCCAAGGAAACAACCTCGGAAGAGCCCTTTGGTGCCCCGAAGTTTGGAACCTCCAGTGCTGGAGTTGTCACCTGGA
GCTAAGGCACAACTGGAAGAACTTATGATGGTTGGAGATCTCCTGGAAGTATCTCTGGACGAGACTCAACACATATGGCGGATTTTGCAG

>In-frame_KDM5A_ENST00000382815_chr12_404739_-_NINJ2_ENST00000397265_chr12_675344_-_4455nt
ATGGCGGGCGTGGGGCCGGGGGGCTACGCGGCGGAGTTCGTGCCACCGCCAGAGTGCCCCGTCTTTGAGCCGAGTTGGGAGGAGTTCACA
GATCCGCTCAGCTTTATCGGCCGCATCCGGCCTTTGGCGGAGAAAACCGGCATCTGCAAAATTCGGCCGCCCAAGGACTGGCAGCCTCCA
TTTGCCTGTGAAGTAAAAAGCTTTCGTTTCACTCCAAGAGTCCAGCGCCTGAATGAACTTGAGGCAATGACCAGAGTGAGATTGGATTTC
TTGGATCAACTAGCAAAATTTTGGGAACTTCAAGGATCTACTCTGAAGATCCCTGTGGTAGAGAGAAAAATCCTGGATCTGTATGCTTTG
AGCAAGATTGTTGCCAGCAAAGGAGGTTTTGAAATGGTCACCAAAGAGAAGAAATGGTCTAAAGTGGGTAGTCGCTTGGGATATCTGCCA
GGAAAAGGAACTGGGTCTCTTTTGAAGTCACATTATGAAAGAATTCTCTACCCATATGAGCTTTTCCAGTCTGGTGTGAGCCTTATGGGT
GTGCAGATGCCTAATTTAGATCTTAAAGAAAAAGTGGAGCCTGAGGTTCTCAGCACTGATACCCAAACTTCCCCAGAGCCAGGCACAAGG
ATGAACATTCTGCCGAAGAGAACAAGACGTGTGAAGACTCAGTCAGAATCTGGAGATGTGAGTAGAAACACGGAACTGAAGAAACTTCAG
ATTTTTGGGGCTGGGCCCAAGGTTGTGGGCTTGGCAATGGGAACAAAAGATAAAGAAGATGAGGTCACCCGAAGACGAAAAGTTACCAAC
AGGTCAGACGCATTTAACATGCAAATGAGACAACGGAAAGGCACTCTCTCTGTTAACTTTGTTGATCTCTATGTTTGTATGTTTTGTGGT
CGGGGAAACAATGAAGATAAATTGCTTTTGTGTGATGGATGTGATGACAGCTATCATACATTTTGTCTAATTCCTCCACTACCTGATGTG
CCCAAAGGAGACTGGAGGTGTCCTAAATGTGTCGCCGAGGAATGTAGCAAACCTCGAGAAGCCTTTGGATTTGAACAAGCTGTACGAGAG
TATACACTTCAGAGCTTTGGAGAGATGGCAGATAATTTTAAGTCTGATTATTTTAATATGCCAGTCCATATGGTTCCCACAGAACTAGTA
GAAAAGGAATTTTGGCGGCTGGTAAGCAGCATTGAAGAAGATGTTATTGTGGAATATGGAGCAGATATCTCCTCAAAAGACTTTGGAAGT
GGATTTCCGGTGAAGGATGGGCGGAGAAAGATTCTGCCAGAAGAAGAGGAATATGCACTTTCTGGTTGGAATTTGAATAACATGCCTGTC
CTGGAACAGTCTGTTCTTGCACATATTAATGTGGACATCTCTGGTATGAAAGTGCCGTGGCTCTATGTGGGAATGTGCTTCTCTTCTTTT
TGCTGGCACATTGAGGATCACTGGAGTTATTCCATCAACTACTTGCACTGGGGGGAGCCAAAGACATGGTATGGTGTGCCATCTCATGCT
GCAGAGCAACTGGAGGAGGTGATGAGAGAGCTGGCCCCCGAGTTATTTGAATCCCAGCCTGATCTTCTGCATCAGTTAGTTACCATCATG
AACCCCAACGTGCTAATGGAGCATGGTGTGCCTGTGTACAGGACCAATCAGTGTGCTGGCGAGTTTGTTGTGACATTTCCTCGTGCCTAT
CACTCTGGATTTAACCAGGGCTACAACTTTGCTGAAGCTGTGAACTTCTGTACTGCTGACTGGTTGCCCATTGGACGTCAATGTGTAAAT
CATTACCGACGCCTAAGGCGCCACTGTGTCTTTTCACACGAGGAACTAATTTTCAAGATGGCAGCAGATCCAGAATGCTTAGATGTGGGG
CTGGCTGCCATGGTCTGCAAAGAATTGACTCTCATGACTGAAGAAGAAACACGATTAAGAGAGTCTGTTGTACAGATGGGTGTCCTGATG
TCAGAAGAAGAAGTGTTTGAACTTGTTCCTGATGATGAGCGGCAGTGTTCAGCATGCAGAACCACATGTTTTCTCTCTGCTCTCACATGT
TCCTGTAATCCTGAGCGGCTTGTATGTCTCTACCATCCAACTGATCTGTGCCCCTGCCCCATGCAGAAGAAATGTCTTAGATATCGCTAC
CCATTAGAAGACCTCCCTTCTCTGCTATATGGTGTAAAAGTCAGGGCACAGTCCTATGACACTTGGGTCAGTCGTGTTACAGAAGCATTG
TCTGCTAACTTCAACCACAAAAAAGATTTGATTGAATTGCGAGTAATGCTGGAAGATGCTGAGGATAGGAAATACCCAGAGAATGATCTC
TTTCGAAAACTCAGGGATGCTGTAAAAGAAGCTGAGACCTGTGCTTCTGTGGCTCAGCTGCTTCTGAGCAAAAAGCAGAAACACAGACAG
AGCCCAGATAGTGGGAGGACTCGGACCAAACTGACAGTGGAAGAATTGAAGGCCTTTGTCCAACAACTTTTTAGTCTTCCGTGTGTCATC
AGCCAAGCTCGGCAAGTAAAGAATCTGCTAGATGATGTGGAAGAGTTTCATGAACGTGCTCAGGAGGCCATGATGGATGAAACCCCAGAT
TCTTCCAAACTCCAGATGTTGATAGATATGGGCTCTAGTCTCTATGTGGAACTCCCTGAATTACCACGACTGAAGCAAGAGCTACAACAG
GCTCGGTGGTTGGACGAAGTAAGACTGACCTTATCAGATCCGCAACAAGTCACTTTGGATGTCATGAAGAAGCTGATAGACTCTGGGGTA
GGGTTGGCACCCCACCATGCTGTGGAGAAAGCAATGGCTGAACTACAGGAGCTCCTTACAGTCTCTGAACGATGGGAAGAAAAGGCTAAG
GTCTGCCTACAGGCAAGACCGAGGCACAGTGTGGCAAGTTTAGAAAGCATTGTGAATGAAGCCAAGAACATTCCAGCCTTTCTACCCAAT
GTGTTGTCCTTGAAAGAAGCCTTACAAAAGGCTCGAGAATGGACCGCTAAAGTGGAAGCTATTCAGAGTGGCAGCAATTACGCTTATTTG
GAGCAGCTTGAGAGCTTGTCTGCGAAAGGACGCCCTATTCCTGTGCGTCTTGAAGCACTGCCGCAAGTGGAATCACAGGTAGCAGCAGCA
CGGGCATGGAGAGAACGGACTGGGCGGACGTTTCTTAAGAAGAATTCTAGCCATACATTGTTACAGGTGCTGAGCCCCCGGACCGACATT
GGTGTATATGGGAGTGGCAAAAATAGGAGGAAAAAAGTAAAAGAACTAATAGAAAAAGAAAAAGAAAAGGATCTGGACCTGGAGCCTCTG
AGTGATCTGGAGGAAGGATTGGAGGAAACCAGAGATACAGCCATGGTGGTGGCAGTTTTCAAAGAACGGGAGCAAAAAGAGATTGAAGCC
ATGCATTCTCTCAGAGCAGCCAACCTAGCCAAGATGACAATGGTGGACCGCATAGAAGAAGTAAAATTTTGCATTTGCCGCAAGACAGCC
AGTGGGTTTATGCTACAGTGTGAGCTCTGCAAAGACTGGTTCCATAACAGCTGTGTTCCTCTTCCTAAATCAAGTTCCCAAAAAAAAGGA
TCCAGCTGGCAAGCTAAAGAAGTAAAATTCCTTTGCCCTCTTTGTATGCGGTCTCGAAGGCCCAGGCTAGAGACTATTCTGTCACTCCTG
GTATCCCTTCAGAAGTTGCCCGTACGGTTGCCTGAAGGAGAGGCCCTGCAGTGTTTGACAGAACGTGCTATGAGTTGGCAAGATAGAGCG
CGGCAGGCTCTAGCCACAGATGAACTATCCTCTGCCCTGGCCAAACTATCTGTGTTGAGCCAGCGTATGGTGGAACAGGCGGCTCGAGAA
AAAACTGAAAAGATCATCAGTGCAGAACTCCAAAAAGCAGCTGCCAATCCAGACTTACAGGGACACTTACCTAGTTTCCAGCAGTCTGCT
TTTAACCGGGTGGTGAGCAGTGTGTCATCTTCTCCTCGACAAACAATGGACTATGATGATGAAGAAACAGACTCTGATGAAGACATTCGA
GAGACATATGGCTACGACATGAAGGACACAGCCAGTGTGAAGTCCTCTAGTAGTCTTGAACCCAATCTTTTTTGTGATGAAGAGATTCCC
ATCAAATCCGAGGAGGTGGTGACCCACATGTGGACAGCACCTTCATTTTGTGCAGAGCATGCTTATTCTTCTGCTTCTAAGAGTTGTTCT
CAAGGTTCTAGCACCCCAAGGAAACAACCTCGGAAGAGCCCTTTGGTGCCCCGAAGTTTGGAACCTCCAGTGCTGGAGTTGTCACCTGGA
GCTAAGGCACAACTGGAAGAACTTATGATGGTTGGAGATCTCCTGGAAGTATCTCTGGACGAGACTCAACACATATGGCGGATTTTGCAG

>In-frame_KDM5A_ENST00000399788_chr12_430161_-_NINJ2_ENST00000305108_chr12_675344_-_2541nt
ATGGCGGGCGTGGGGCCGGGGGGCTACGCGGCGGAGTTCGTGCCACCGCCAGAGTGCCCCGTCTTTGAGCCGAGTTGGGAGGAGTTCACA
GATCCGCTCAGCTTTATCGGCCGCATCCGGCCTTTGGCGGAGAAAACCGGCATCTGCAAAATTCGGCCGCCCAAGGACTGGCAGCCTCCA
TTTGCCTGTGAAGTAAAAAGCTTTCGTTTCACTCCAAGAGTCCAGCGCCTGAATGAACTTGAGGCAATGACCAGAGTGAGATTGGATTTC
TTGGATCAACTAGCAAAATTTTGGGAACTTCAAGGATCTACTCTGAAGATCCCTGTGGTAGAGAGAAAAATCCTGGATCTGTATGCTTTG
AGCAAGATTGTTGCCAGCAAAGGAGGTTTTGAAATGGTCACCAAAGAGAAGAAATGGTCTAAAGTGGGTAGTCGCTTGGGATATCTGCCA
GGAAAAGGAACTGGGTCTCTTTTGAAGTCACATTATGAAAGAATTCTCTACCCATATGAGCTTTTCCAGTCTGGTGTGAGCCTTATGGGT
GTGCAGATGCCTAATTTAGATCTTAAAGAAAAAGTGGAGCCTGAGGTTCTCAGCACTGATACCCAAACTTCCCCAGAGCCAGGCACAAGG
ATGAACATTCTGCCGAAGAGAACAAGACGTGTGAAGACTCAGTCAGAATCTGGAGATGTGAGTAGAAACACGGAACTGAAGAAACTTCAG
ATTTTTGGGGCTGGGCCCAAGGTTGTGGGCTTGGCAATGGGAACAAAAGATAAAGAAGATGAGGTCACCCGAAGACGAAAAGTTACCAAC
AGGTCAGACGCATTTAACATGCAAATGAGACAACGGAAAGGCACTCTCTCTGTTAACTTTGTTGATCTCTATGTTTGTATGTTTTGTGGT
CGGGGAAACAATGAAGATAAATTGCTTTTGTGTGATGGATGTGATGACAGCTATCATACATTTTGTCTAATTCCTCCACTACCTGATGTG
CCCAAAGGAGACTGGAGGTGTCCTAAATGTGTCGCCGAGGAATGTAGCAAACCTCGAGAAGCCTTTGGATTTGAACAAGCTGTACGAGAG
TATACACTTCAGAGCTTTGGAGAGATGGCAGATAATTTTAAGTCTGATTATTTTAATATGCCAGTCCATATGGTTCCCACAGAACTAGTA
GAAAAGGAATTTTGGCGGCTGGTAAGCAGCATTGAAGAAGATGTTATTGTGGAATATGGAGCAGATATCTCCTCAAAAGACTTTGGAAGT
GGATTTCCGGTGAAGGATGGGCGGAGAAAGATTCTGCCAGAAGAAGAGGAATATGCACTTTCTGGTTGGAATTTGAATAACATGCCTGTC
CTGGAACAGTCTGTTCTTGCACATATTAATGTGGACATCTCTGGTATGAAAGTGCCGTGGCTCTATGTGGGAATGTGCTTCTCTTCTTTT
TGCTGGCACATTGAGGATCACTGGAGTTATTCCATCAACTACTTGCACTGGGGGGAGCCAAAGACATGGTATGGTGTGCCATCTCATGCT
GCAGAGCAACTGGAGGAGGTGATGAGAGAGCTGGCCCCCGAGTTATTTGAATCCCAGCCTGATCTTCTGCATCAGTTAGTTACCATCATG
AACCCCAACGTGCTAATGGAGCATGGTGTGCCTGTGTACAGGACCAATCAGTGTGCTGGCGAGTTTGTTGTGACATTTCCTCGTGCCTAT
CACTCTGGATTTAACCAGGGCTACAACTTTGCTGAAGCTGTGAACTTCTGTACTGCTGACTGGTTGCCCATTGGACGTCAATGTGTAAAT
CATTACCGACGCCTAAGGCGCCACTGTGTCTTTTCACACGAGGAACTAATTTTCAAGATGGCAGCAGATCCAGAATGCTTAGATGTGGGG
CTGGCTGCCATGGTCTGCAAAGAATTGACTCTCATGACTGAAGAAGAAACACGATTAAGAGAGTCTGTTGTACAGATGGGTGTCCTGATG
TCAGAAGAAGAAGTGTTTGAACTTGTTCCTGATGATGAGCGGCAGTGTTCAGCATGCAGAACCACATGTTTTCTCTCTGCTCTCACATGT
TCCTGTAATCCTGAGCGGCTTGTATGTCTCTACCATCCAACTGATCTGTGCCCCTGCCCCATGCAGAAGAAATGTCTTAGATATCGCTAC
CCATTAGAAGACCTCCCTTCTCTGCTATATGGTGTAAAAGTCAGGGCACAGTCCTATGACACTTGGGTCAGTCGTGTTACAGAAGCATTG
TCTGCTAACTTCAACCACAAAAAAGATTTGATTGAATTGCGAGTAATGCTGGAAGATGCTGAGGATAGGAAATACCCAGAGAATGATCTC
TTTCGAAAACTCAGGGATGCTGTAAAAGAAGCTGAGACCTGTGCTTCTGTGGCTCAGCTGCTTCTGAGCAAAAAGCAGAAACACAGACAG
AGCCCAGATAGTGGGAGGACTCGGACCAAACTGACAGTGGAAGAATTGAAGGCCTTTGTCCAACAACTTTTTAGTCTTCCGTGTGTCATC

>In-frame_KDM5A_ENST00000399788_chr12_430161_-_NINJ2_ENST00000397265_chr12_675344_-_2541nt
ATGGCGGGCGTGGGGCCGGGGGGCTACGCGGCGGAGTTCGTGCCACCGCCAGAGTGCCCCGTCTTTGAGCCGAGTTGGGAGGAGTTCACA
GATCCGCTCAGCTTTATCGGCCGCATCCGGCCTTTGGCGGAGAAAACCGGCATCTGCAAAATTCGGCCGCCCAAGGACTGGCAGCCTCCA
TTTGCCTGTGAAGTAAAAAGCTTTCGTTTCACTCCAAGAGTCCAGCGCCTGAATGAACTTGAGGCAATGACCAGAGTGAGATTGGATTTC
TTGGATCAACTAGCAAAATTTTGGGAACTTCAAGGATCTACTCTGAAGATCCCTGTGGTAGAGAGAAAAATCCTGGATCTGTATGCTTTG
AGCAAGATTGTTGCCAGCAAAGGAGGTTTTGAAATGGTCACCAAAGAGAAGAAATGGTCTAAAGTGGGTAGTCGCTTGGGATATCTGCCA
GGAAAAGGAACTGGGTCTCTTTTGAAGTCACATTATGAAAGAATTCTCTACCCATATGAGCTTTTCCAGTCTGGTGTGAGCCTTATGGGT
GTGCAGATGCCTAATTTAGATCTTAAAGAAAAAGTGGAGCCTGAGGTTCTCAGCACTGATACCCAAACTTCCCCAGAGCCAGGCACAAGG
ATGAACATTCTGCCGAAGAGAACAAGACGTGTGAAGACTCAGTCAGAATCTGGAGATGTGAGTAGAAACACGGAACTGAAGAAACTTCAG
ATTTTTGGGGCTGGGCCCAAGGTTGTGGGCTTGGCAATGGGAACAAAAGATAAAGAAGATGAGGTCACCCGAAGACGAAAAGTTACCAAC
AGGTCAGACGCATTTAACATGCAAATGAGACAACGGAAAGGCACTCTCTCTGTTAACTTTGTTGATCTCTATGTTTGTATGTTTTGTGGT
CGGGGAAACAATGAAGATAAATTGCTTTTGTGTGATGGATGTGATGACAGCTATCATACATTTTGTCTAATTCCTCCACTACCTGATGTG
CCCAAAGGAGACTGGAGGTGTCCTAAATGTGTCGCCGAGGAATGTAGCAAACCTCGAGAAGCCTTTGGATTTGAACAAGCTGTACGAGAG
TATACACTTCAGAGCTTTGGAGAGATGGCAGATAATTTTAAGTCTGATTATTTTAATATGCCAGTCCATATGGTTCCCACAGAACTAGTA
GAAAAGGAATTTTGGCGGCTGGTAAGCAGCATTGAAGAAGATGTTATTGTGGAATATGGAGCAGATATCTCCTCAAAAGACTTTGGAAGT
GGATTTCCGGTGAAGGATGGGCGGAGAAAGATTCTGCCAGAAGAAGAGGAATATGCACTTTCTGGTTGGAATTTGAATAACATGCCTGTC
CTGGAACAGTCTGTTCTTGCACATATTAATGTGGACATCTCTGGTATGAAAGTGCCGTGGCTCTATGTGGGAATGTGCTTCTCTTCTTTT
TGCTGGCACATTGAGGATCACTGGAGTTATTCCATCAACTACTTGCACTGGGGGGAGCCAAAGACATGGTATGGTGTGCCATCTCATGCT
GCAGAGCAACTGGAGGAGGTGATGAGAGAGCTGGCCCCCGAGTTATTTGAATCCCAGCCTGATCTTCTGCATCAGTTAGTTACCATCATG
AACCCCAACGTGCTAATGGAGCATGGTGTGCCTGTGTACAGGACCAATCAGTGTGCTGGCGAGTTTGTTGTGACATTTCCTCGTGCCTAT
CACTCTGGATTTAACCAGGGCTACAACTTTGCTGAAGCTGTGAACTTCTGTACTGCTGACTGGTTGCCCATTGGACGTCAATGTGTAAAT
CATTACCGACGCCTAAGGCGCCACTGTGTCTTTTCACACGAGGAACTAATTTTCAAGATGGCAGCAGATCCAGAATGCTTAGATGTGGGG
CTGGCTGCCATGGTCTGCAAAGAATTGACTCTCATGACTGAAGAAGAAACACGATTAAGAGAGTCTGTTGTACAGATGGGTGTCCTGATG
TCAGAAGAAGAAGTGTTTGAACTTGTTCCTGATGATGAGCGGCAGTGTTCAGCATGCAGAACCACATGTTTTCTCTCTGCTCTCACATGT
TCCTGTAATCCTGAGCGGCTTGTATGTCTCTACCATCCAACTGATCTGTGCCCCTGCCCCATGCAGAAGAAATGTCTTAGATATCGCTAC
CCATTAGAAGACCTCCCTTCTCTGCTATATGGTGTAAAAGTCAGGGCACAGTCCTATGACACTTGGGTCAGTCGTGTTACAGAAGCATTG
TCTGCTAACTTCAACCACAAAAAAGATTTGATTGAATTGCGAGTAATGCTGGAAGATGCTGAGGATAGGAAATACCCAGAGAATGATCTC
TTTCGAAAACTCAGGGATGCTGTAAAAGAAGCTGAGACCTGTGCTTCTGTGGCTCAGCTGCTTCTGAGCAAAAAGCAGAAACACAGACAG
AGCCCAGATAGTGGGAGGACTCGGACCAAACTGACAGTGGAAGAATTGAAGGCCTTTGTCCAACAACTTTTTAGTCTTCCGTGTGTCATC

>In-frame_KDM5A_ENST00000382815_chr12_430161_-_NINJ2_ENST00000305108_chr12_675344_-_2541nt
ATGGCGGGCGTGGGGCCGGGGGGCTACGCGGCGGAGTTCGTGCCACCGCCAGAGTGCCCCGTCTTTGAGCCGAGTTGGGAGGAGTTCACA
GATCCGCTCAGCTTTATCGGCCGCATCCGGCCTTTGGCGGAGAAAACCGGCATCTGCAAAATTCGGCCGCCCAAGGACTGGCAGCCTCCA
TTTGCCTGTGAAGTAAAAAGCTTTCGTTTCACTCCAAGAGTCCAGCGCCTGAATGAACTTGAGGCAATGACCAGAGTGAGATTGGATTTC
TTGGATCAACTAGCAAAATTTTGGGAACTTCAAGGATCTACTCTGAAGATCCCTGTGGTAGAGAGAAAAATCCTGGATCTGTATGCTTTG
AGCAAGATTGTTGCCAGCAAAGGAGGTTTTGAAATGGTCACCAAAGAGAAGAAATGGTCTAAAGTGGGTAGTCGCTTGGGATATCTGCCA
GGAAAAGGAACTGGGTCTCTTTTGAAGTCACATTATGAAAGAATTCTCTACCCATATGAGCTTTTCCAGTCTGGTGTGAGCCTTATGGGT
GTGCAGATGCCTAATTTAGATCTTAAAGAAAAAGTGGAGCCTGAGGTTCTCAGCACTGATACCCAAACTTCCCCAGAGCCAGGCACAAGG
ATGAACATTCTGCCGAAGAGAACAAGACGTGTGAAGACTCAGTCAGAATCTGGAGATGTGAGTAGAAACACGGAACTGAAGAAACTTCAG
ATTTTTGGGGCTGGGCCCAAGGTTGTGGGCTTGGCAATGGGAACAAAAGATAAAGAAGATGAGGTCACCCGAAGACGAAAAGTTACCAAC
AGGTCAGACGCATTTAACATGCAAATGAGACAACGGAAAGGCACTCTCTCTGTTAACTTTGTTGATCTCTATGTTTGTATGTTTTGTGGT
CGGGGAAACAATGAAGATAAATTGCTTTTGTGTGATGGATGTGATGACAGCTATCATACATTTTGTCTAATTCCTCCACTACCTGATGTG
CCCAAAGGAGACTGGAGGTGTCCTAAATGTGTCGCCGAGGAATGTAGCAAACCTCGAGAAGCCTTTGGATTTGAACAAGCTGTACGAGAG
TATACACTTCAGAGCTTTGGAGAGATGGCAGATAATTTTAAGTCTGATTATTTTAATATGCCAGTCCATATGGTTCCCACAGAACTAGTA
GAAAAGGAATTTTGGCGGCTGGTAAGCAGCATTGAAGAAGATGTTATTGTGGAATATGGAGCAGATATCTCCTCAAAAGACTTTGGAAGT
GGATTTCCGGTGAAGGATGGGCGGAGAAAGATTCTGCCAGAAGAAGAGGAATATGCACTTTCTGGTTGGAATTTGAATAACATGCCTGTC
CTGGAACAGTCTGTTCTTGCACATATTAATGTGGACATCTCTGGTATGAAAGTGCCGTGGCTCTATGTGGGAATGTGCTTCTCTTCTTTT
TGCTGGCACATTGAGGATCACTGGAGTTATTCCATCAACTACTTGCACTGGGGGGAGCCAAAGACATGGTATGGTGTGCCATCTCATGCT
GCAGAGCAACTGGAGGAGGTGATGAGAGAGCTGGCCCCCGAGTTATTTGAATCCCAGCCTGATCTTCTGCATCAGTTAGTTACCATCATG
AACCCCAACGTGCTAATGGAGCATGGTGTGCCTGTGTACAGGACCAATCAGTGTGCTGGCGAGTTTGTTGTGACATTTCCTCGTGCCTAT
CACTCTGGATTTAACCAGGGCTACAACTTTGCTGAAGCTGTGAACTTCTGTACTGCTGACTGGTTGCCCATTGGACGTCAATGTGTAAAT
CATTACCGACGCCTAAGGCGCCACTGTGTCTTTTCACACGAGGAACTAATTTTCAAGATGGCAGCAGATCCAGAATGCTTAGATGTGGGG
CTGGCTGCCATGGTCTGCAAAGAATTGACTCTCATGACTGAAGAAGAAACACGATTAAGAGAGTCTGTTGTACAGATGGGTGTCCTGATG
TCAGAAGAAGAAGTGTTTGAACTTGTTCCTGATGATGAGCGGCAGTGTTCAGCATGCAGAACCACATGTTTTCTCTCTGCTCTCACATGT
TCCTGTAATCCTGAGCGGCTTGTATGTCTCTACCATCCAACTGATCTGTGCCCCTGCCCCATGCAGAAGAAATGTCTTAGATATCGCTAC
CCATTAGAAGACCTCCCTTCTCTGCTATATGGTGTAAAAGTCAGGGCACAGTCCTATGACACTTGGGTCAGTCGTGTTACAGAAGCATTG
TCTGCTAACTTCAACCACAAAAAAGATTTGATTGAATTGCGAGTAATGCTGGAAGATGCTGAGGATAGGAAATACCCAGAGAATGATCTC
TTTCGAAAACTCAGGGATGCTGTAAAAGAAGCTGAGACCTGTGCTTCTGTGGCTCAGCTGCTTCTGAGCAAAAAGCAGAAACACAGACAG
AGCCCAGATAGTGGGAGGACTCGGACCAAACTGACAGTGGAAGAATTGAAGGCCTTTGTCCAACAACTTTTTAGTCTTCCGTGTGTCATC

>In-frame_KDM5A_ENST00000382815_chr12_430161_-_NINJ2_ENST00000397265_chr12_675344_-_2541nt
ATGGCGGGCGTGGGGCCGGGGGGCTACGCGGCGGAGTTCGTGCCACCGCCAGAGTGCCCCGTCTTTGAGCCGAGTTGGGAGGAGTTCACA
GATCCGCTCAGCTTTATCGGCCGCATCCGGCCTTTGGCGGAGAAAACCGGCATCTGCAAAATTCGGCCGCCCAAGGACTGGCAGCCTCCA
TTTGCCTGTGAAGTAAAAAGCTTTCGTTTCACTCCAAGAGTCCAGCGCCTGAATGAACTTGAGGCAATGACCAGAGTGAGATTGGATTTC
TTGGATCAACTAGCAAAATTTTGGGAACTTCAAGGATCTACTCTGAAGATCCCTGTGGTAGAGAGAAAAATCCTGGATCTGTATGCTTTG
AGCAAGATTGTTGCCAGCAAAGGAGGTTTTGAAATGGTCACCAAAGAGAAGAAATGGTCTAAAGTGGGTAGTCGCTTGGGATATCTGCCA
GGAAAAGGAACTGGGTCTCTTTTGAAGTCACATTATGAAAGAATTCTCTACCCATATGAGCTTTTCCAGTCTGGTGTGAGCCTTATGGGT
GTGCAGATGCCTAATTTAGATCTTAAAGAAAAAGTGGAGCCTGAGGTTCTCAGCACTGATACCCAAACTTCCCCAGAGCCAGGCACAAGG
ATGAACATTCTGCCGAAGAGAACAAGACGTGTGAAGACTCAGTCAGAATCTGGAGATGTGAGTAGAAACACGGAACTGAAGAAACTTCAG
ATTTTTGGGGCTGGGCCCAAGGTTGTGGGCTTGGCAATGGGAACAAAAGATAAAGAAGATGAGGTCACCCGAAGACGAAAAGTTACCAAC
AGGTCAGACGCATTTAACATGCAAATGAGACAACGGAAAGGCACTCTCTCTGTTAACTTTGTTGATCTCTATGTTTGTATGTTTTGTGGT
CGGGGAAACAATGAAGATAAATTGCTTTTGTGTGATGGATGTGATGACAGCTATCATACATTTTGTCTAATTCCTCCACTACCTGATGTG
CCCAAAGGAGACTGGAGGTGTCCTAAATGTGTCGCCGAGGAATGTAGCAAACCTCGAGAAGCCTTTGGATTTGAACAAGCTGTACGAGAG
TATACACTTCAGAGCTTTGGAGAGATGGCAGATAATTTTAAGTCTGATTATTTTAATATGCCAGTCCATATGGTTCCCACAGAACTAGTA
GAAAAGGAATTTTGGCGGCTGGTAAGCAGCATTGAAGAAGATGTTATTGTGGAATATGGAGCAGATATCTCCTCAAAAGACTTTGGAAGT
GGATTTCCGGTGAAGGATGGGCGGAGAAAGATTCTGCCAGAAGAAGAGGAATATGCACTTTCTGGTTGGAATTTGAATAACATGCCTGTC
CTGGAACAGTCTGTTCTTGCACATATTAATGTGGACATCTCTGGTATGAAAGTGCCGTGGCTCTATGTGGGAATGTGCTTCTCTTCTTTT
TGCTGGCACATTGAGGATCACTGGAGTTATTCCATCAACTACTTGCACTGGGGGGAGCCAAAGACATGGTATGGTGTGCCATCTCATGCT
GCAGAGCAACTGGAGGAGGTGATGAGAGAGCTGGCCCCCGAGTTATTTGAATCCCAGCCTGATCTTCTGCATCAGTTAGTTACCATCATG
AACCCCAACGTGCTAATGGAGCATGGTGTGCCTGTGTACAGGACCAATCAGTGTGCTGGCGAGTTTGTTGTGACATTTCCTCGTGCCTAT
CACTCTGGATTTAACCAGGGCTACAACTTTGCTGAAGCTGTGAACTTCTGTACTGCTGACTGGTTGCCCATTGGACGTCAATGTGTAAAT
CATTACCGACGCCTAAGGCGCCACTGTGTCTTTTCACACGAGGAACTAATTTTCAAGATGGCAGCAGATCCAGAATGCTTAGATGTGGGG
CTGGCTGCCATGGTCTGCAAAGAATTGACTCTCATGACTGAAGAAGAAACACGATTAAGAGAGTCTGTTGTACAGATGGGTGTCCTGATG
TCAGAAGAAGAAGTGTTTGAACTTGTTCCTGATGATGAGCGGCAGTGTTCAGCATGCAGAACCACATGTTTTCTCTCTGCTCTCACATGT
TCCTGTAATCCTGAGCGGCTTGTATGTCTCTACCATCCAACTGATCTGTGCCCCTGCCCCATGCAGAAGAAATGTCTTAGATATCGCTAC
CCATTAGAAGACCTCCCTTCTCTGCTATATGGTGTAAAAGTCAGGGCACAGTCCTATGACACTTGGGTCAGTCGTGTTACAGAAGCATTG
TCTGCTAACTTCAACCACAAAAAAGATTTGATTGAATTGCGAGTAATGCTGGAAGATGCTGAGGATAGGAAATACCCAGAGAATGATCTC
TTTCGAAAACTCAGGGATGCTGTAAAAGAAGCTGAGACCTGTGCTTCTGTGGCTCAGCTGCTTCTGAGCAAAAAGCAGAAACACAGACAG
AGCCCAGATAGTGGGAGGACTCGGACCAAACTGACAGTGGAAGAATTGAAGGCCTTTGTCCAACAACTTTTTAGTCTTCCGTGTGTCATC

>In-frame_KDM5A_ENST00000399788_chr12_404739_-_NINJ2_ENST00000305108_chr12_675344_-_4455nt
ATGGCGGGCGTGGGGCCGGGGGGCTACGCGGCGGAGTTCGTGCCACCGCCAGAGTGCCCCGTCTTTGAGCCGAGTTGGGAGGAGTTCACA
GATCCGCTCAGCTTTATCGGCCGCATCCGGCCTTTGGCGGAGAAAACCGGCATCTGCAAAATTCGGCCGCCCAAGGACTGGCAGCCTCCA
TTTGCCTGTGAAGTAAAAAGCTTTCGTTTCACTCCAAGAGTCCAGCGCCTGAATGAACTTGAGGCAATGACCAGAGTGAGATTGGATTTC
TTGGATCAACTAGCAAAATTTTGGGAACTTCAAGGATCTACTCTGAAGATCCCTGTGGTAGAGAGAAAAATCCTGGATCTGTATGCTTTG
AGCAAGATTGTTGCCAGCAAAGGAGGTTTTGAAATGGTCACCAAAGAGAAGAAATGGTCTAAAGTGGGTAGTCGCTTGGGATATCTGCCA
GGAAAAGGAACTGGGTCTCTTTTGAAGTCACATTATGAAAGAATTCTCTACCCATATGAGCTTTTCCAGTCTGGTGTGAGCCTTATGGGT
GTGCAGATGCCTAATTTAGATCTTAAAGAAAAAGTGGAGCCTGAGGTTCTCAGCACTGATACCCAAACTTCCCCAGAGCCAGGCACAAGG
ATGAACATTCTGCCGAAGAGAACAAGACGTGTGAAGACTCAGTCAGAATCTGGAGATGTGAGTAGAAACACGGAACTGAAGAAACTTCAG
ATTTTTGGGGCTGGGCCCAAGGTTGTGGGCTTGGCAATGGGAACAAAAGATAAAGAAGATGAGGTCACCCGAAGACGAAAAGTTACCAAC
AGGTCAGACGCATTTAACATGCAAATGAGACAACGGAAAGGCACTCTCTCTGTTAACTTTGTTGATCTCTATGTTTGTATGTTTTGTGGT
CGGGGAAACAATGAAGATAAATTGCTTTTGTGTGATGGATGTGATGACAGCTATCATACATTTTGTCTAATTCCTCCACTACCTGATGTG
CCCAAAGGAGACTGGAGGTGTCCTAAATGTGTCGCCGAGGAATGTAGCAAACCTCGAGAAGCCTTTGGATTTGAACAAGCTGTACGAGAG
TATACACTTCAGAGCTTTGGAGAGATGGCAGATAATTTTAAGTCTGATTATTTTAATATGCCAGTCCATATGGTTCCCACAGAACTAGTA
GAAAAGGAATTTTGGCGGCTGGTAAGCAGCATTGAAGAAGATGTTATTGTGGAATATGGAGCAGATATCTCCTCAAAAGACTTTGGAAGT
GGATTTCCGGTGAAGGATGGGCGGAGAAAGATTCTGCCAGAAGAAGAGGAATATGCACTTTCTGGTTGGAATTTGAATAACATGCCTGTC
CTGGAACAGTCTGTTCTTGCACATATTAATGTGGACATCTCTGGTATGAAAGTGCCGTGGCTCTATGTGGGAATGTGCTTCTCTTCTTTT
TGCTGGCACATTGAGGATCACTGGAGTTATTCCATCAACTACTTGCACTGGGGGGAGCCAAAGACATGGTATGGTGTGCCATCTCATGCT
GCAGAGCAACTGGAGGAGGTGATGAGAGAGCTGGCCCCCGAGTTATTTGAATCCCAGCCTGATCTTCTGCATCAGTTAGTTACCATCATG
AACCCCAACGTGCTAATGGAGCATGGTGTGCCTGTGTACAGGACCAATCAGTGTGCTGGCGAGTTTGTTGTGACATTTCCTCGTGCCTAT
CACTCTGGATTTAACCAGGGCTACAACTTTGCTGAAGCTGTGAACTTCTGTACTGCTGACTGGTTGCCCATTGGACGTCAATGTGTAAAT
CATTACCGACGCCTAAGGCGCCACTGTGTCTTTTCACACGAGGAACTAATTTTCAAGATGGCAGCAGATCCAGAATGCTTAGATGTGGGG
CTGGCTGCCATGGTCTGCAAAGAATTGACTCTCATGACTGAAGAAGAAACACGATTAAGAGAGTCTGTTGTACAGATGGGTGTCCTGATG
TCAGAAGAAGAAGTGTTTGAACTTGTTCCTGATGATGAGCGGCAGTGTTCAGCATGCAGAACCACATGTTTTCTCTCTGCTCTCACATGT
TCCTGTAATCCTGAGCGGCTTGTATGTCTCTACCATCCAACTGATCTGTGCCCCTGCCCCATGCAGAAGAAATGTCTTAGATATCGCTAC
CCATTAGAAGACCTCCCTTCTCTGCTATATGGTGTAAAAGTCAGGGCACAGTCCTATGACACTTGGGTCAGTCGTGTTACAGAAGCATTG
TCTGCTAACTTCAACCACAAAAAAGATTTGATTGAATTGCGAGTAATGCTGGAAGATGCTGAGGATAGGAAATACCCAGAGAATGATCTC
TTTCGAAAACTCAGGGATGCTGTAAAAGAAGCTGAGACCTGTGCTTCTGTGGCTCAGCTGCTTCTGAGCAAAAAGCAGAAACACAGACAG
AGCCCAGATAGTGGGAGGACTCGGACCAAACTGACAGTGGAAGAATTGAAGGCCTTTGTCCAACAACTTTTTAGTCTTCCGTGTGTCATC
AGCCAAGCTCGGCAAGTAAAGAATCTGCTAGATGATGTGGAAGAGTTTCATGAACGTGCTCAGGAGGCCATGATGGATGAAACCCCAGAT
TCTTCCAAACTCCAGATGTTGATAGATATGGGCTCTAGTCTCTATGTGGAACTCCCTGAATTACCACGACTGAAGCAAGAGCTACAACAG
GCTCGGTGGTTGGACGAAGTAAGACTGACCTTATCAGATCCGCAACAAGTCACTTTGGATGTCATGAAGAAGCTGATAGACTCTGGGGTA
GGGTTGGCACCCCACCATGCTGTGGAGAAAGCAATGGCTGAACTACAGGAGCTCCTTACAGTCTCTGAACGATGGGAAGAAAAGGCTAAG
GTCTGCCTACAGGCAAGACCGAGGCACAGTGTGGCAAGTTTAGAAAGCATTGTGAATGAAGCCAAGAACATTCCAGCCTTTCTACCCAAT
GTGTTGTCCTTGAAAGAAGCCTTACAAAAGGCTCGAGAATGGACCGCTAAAGTGGAAGCTATTCAGAGTGGCAGCAATTACGCTTATTTG
GAGCAGCTTGAGAGCTTGTCTGCGAAAGGACGCCCTATTCCTGTGCGTCTTGAAGCACTGCCGCAAGTGGAATCACAGGTAGCAGCAGCA
CGGGCATGGAGAGAACGGACTGGGCGGACGTTTCTTAAGAAGAATTCTAGCCATACATTGTTACAGGTGCTGAGCCCCCGGACCGACATT
GGTGTATATGGGAGTGGCAAAAATAGGAGGAAAAAAGTAAAAGAACTAATAGAAAAAGAAAAAGAAAAGGATCTGGACCTGGAGCCTCTG
AGTGATCTGGAGGAAGGATTGGAGGAAACCAGAGATACAGCCATGGTGGTGGCAGTTTTCAAAGAACGGGAGCAAAAAGAGATTGAAGCC
ATGCATTCTCTCAGAGCAGCCAACCTAGCCAAGATGACAATGGTGGACCGCATAGAAGAAGTAAAATTTTGCATTTGCCGCAAGACAGCC
AGTGGGTTTATGCTACAGTGTGAGCTCTGCAAAGACTGGTTCCATAACAGCTGTGTTCCTCTTCCTAAATCAAGTTCCCAAAAAAAAGGA
TCCAGCTGGCAAGCTAAAGAAGTAAAATTCCTTTGCCCTCTTTGTATGCGGTCTCGAAGGCCCAGGCTAGAGACTATTCTGTCACTCCTG
GTATCCCTTCAGAAGTTGCCCGTACGGTTGCCTGAAGGAGAGGCCCTGCAGTGTTTGACAGAACGTGCTATGAGTTGGCAAGATAGAGCG
CGGCAGGCTCTAGCCACAGATGAACTATCCTCTGCCCTGGCCAAACTATCTGTGTTGAGCCAGCGTATGGTGGAACAGGCGGCTCGAGAA
AAAACTGAAAAGATCATCAGTGCAGAACTCCAAAAAGCAGCTGCCAATCCAGACTTACAGGGACACTTACCTAGTTTCCAGCAGTCTGCT
TTTAACCGGGTGGTGAGCAGTGTGTCATCTTCTCCTCGACAAACAATGGACTATGATGATGAAGAAACAGACTCTGATGAAGACATTCGA
GAGACATATGGCTACGACATGAAGGACACAGCCAGTGTGAAGTCCTCTAGTAGTCTTGAACCCAATCTTTTTTGTGATGAAGAGATTCCC
ATCAAATCCGAGGAGGTGGTGACCCACATGTGGACAGCACCTTCATTTTGTGCAGAGCATGCTTATTCTTCTGCTTCTAAGAGTTGTTCT
CAAGGTTCTAGCACCCCAAGGAAACAACCTCGGAAGAGCCCTTTGGTGCCCCGAAGTTTGGAACCTCCAGTGCTGGAGTTGTCACCTGGA
GCTAAGGCACAACTGGAAGAACTTATGATGGTTGGAGATCTCCTGGAAGTATCTCTGGACGAGACTCAACACATATGGCGGATTTTGCAG

>In-frame_KDM5A_ENST00000399788_chr12_404739_-_NINJ2_ENST00000397265_chr12_675344_-_4455nt
ATGGCGGGCGTGGGGCCGGGGGGCTACGCGGCGGAGTTCGTGCCACCGCCAGAGTGCCCCGTCTTTGAGCCGAGTTGGGAGGAGTTCACA
GATCCGCTCAGCTTTATCGGCCGCATCCGGCCTTTGGCGGAGAAAACCGGCATCTGCAAAATTCGGCCGCCCAAGGACTGGCAGCCTCCA
TTTGCCTGTGAAGTAAAAAGCTTTCGTTTCACTCCAAGAGTCCAGCGCCTGAATGAACTTGAGGCAATGACCAGAGTGAGATTGGATTTC
TTGGATCAACTAGCAAAATTTTGGGAACTTCAAGGATCTACTCTGAAGATCCCTGTGGTAGAGAGAAAAATCCTGGATCTGTATGCTTTG
AGCAAGATTGTTGCCAGCAAAGGAGGTTTTGAAATGGTCACCAAAGAGAAGAAATGGTCTAAAGTGGGTAGTCGCTTGGGATATCTGCCA
GGAAAAGGAACTGGGTCTCTTTTGAAGTCACATTATGAAAGAATTCTCTACCCATATGAGCTTTTCCAGTCTGGTGTGAGCCTTATGGGT
GTGCAGATGCCTAATTTAGATCTTAAAGAAAAAGTGGAGCCTGAGGTTCTCAGCACTGATACCCAAACTTCCCCAGAGCCAGGCACAAGG
ATGAACATTCTGCCGAAGAGAACAAGACGTGTGAAGACTCAGTCAGAATCTGGAGATGTGAGTAGAAACACGGAACTGAAGAAACTTCAG
ATTTTTGGGGCTGGGCCCAAGGTTGTGGGCTTGGCAATGGGAACAAAAGATAAAGAAGATGAGGTCACCCGAAGACGAAAAGTTACCAAC
AGGTCAGACGCATTTAACATGCAAATGAGACAACGGAAAGGCACTCTCTCTGTTAACTTTGTTGATCTCTATGTTTGTATGTTTTGTGGT
CGGGGAAACAATGAAGATAAATTGCTTTTGTGTGATGGATGTGATGACAGCTATCATACATTTTGTCTAATTCCTCCACTACCTGATGTG
CCCAAAGGAGACTGGAGGTGTCCTAAATGTGTCGCCGAGGAATGTAGCAAACCTCGAGAAGCCTTTGGATTTGAACAAGCTGTACGAGAG
TATACACTTCAGAGCTTTGGAGAGATGGCAGATAATTTTAAGTCTGATTATTTTAATATGCCAGTCCATATGGTTCCCACAGAACTAGTA
GAAAAGGAATTTTGGCGGCTGGTAAGCAGCATTGAAGAAGATGTTATTGTGGAATATGGAGCAGATATCTCCTCAAAAGACTTTGGAAGT
GGATTTCCGGTGAAGGATGGGCGGAGAAAGATTCTGCCAGAAGAAGAGGAATATGCACTTTCTGGTTGGAATTTGAATAACATGCCTGTC
CTGGAACAGTCTGTTCTTGCACATATTAATGTGGACATCTCTGGTATGAAAGTGCCGTGGCTCTATGTGGGAATGTGCTTCTCTTCTTTT
TGCTGGCACATTGAGGATCACTGGAGTTATTCCATCAACTACTTGCACTGGGGGGAGCCAAAGACATGGTATGGTGTGCCATCTCATGCT
GCAGAGCAACTGGAGGAGGTGATGAGAGAGCTGGCCCCCGAGTTATTTGAATCCCAGCCTGATCTTCTGCATCAGTTAGTTACCATCATG
AACCCCAACGTGCTAATGGAGCATGGTGTGCCTGTGTACAGGACCAATCAGTGTGCTGGCGAGTTTGTTGTGACATTTCCTCGTGCCTAT
CACTCTGGATTTAACCAGGGCTACAACTTTGCTGAAGCTGTGAACTTCTGTACTGCTGACTGGTTGCCCATTGGACGTCAATGTGTAAAT
CATTACCGACGCCTAAGGCGCCACTGTGTCTTTTCACACGAGGAACTAATTTTCAAGATGGCAGCAGATCCAGAATGCTTAGATGTGGGG
CTGGCTGCCATGGTCTGCAAAGAATTGACTCTCATGACTGAAGAAGAAACACGATTAAGAGAGTCTGTTGTACAGATGGGTGTCCTGATG
TCAGAAGAAGAAGTGTTTGAACTTGTTCCTGATGATGAGCGGCAGTGTTCAGCATGCAGAACCACATGTTTTCTCTCTGCTCTCACATGT
TCCTGTAATCCTGAGCGGCTTGTATGTCTCTACCATCCAACTGATCTGTGCCCCTGCCCCATGCAGAAGAAATGTCTTAGATATCGCTAC
CCATTAGAAGACCTCCCTTCTCTGCTATATGGTGTAAAAGTCAGGGCACAGTCCTATGACACTTGGGTCAGTCGTGTTACAGAAGCATTG
TCTGCTAACTTCAACCACAAAAAAGATTTGATTGAATTGCGAGTAATGCTGGAAGATGCTGAGGATAGGAAATACCCAGAGAATGATCTC
TTTCGAAAACTCAGGGATGCTGTAAAAGAAGCTGAGACCTGTGCTTCTGTGGCTCAGCTGCTTCTGAGCAAAAAGCAGAAACACAGACAG
AGCCCAGATAGTGGGAGGACTCGGACCAAACTGACAGTGGAAGAATTGAAGGCCTTTGTCCAACAACTTTTTAGTCTTCCGTGTGTCATC
AGCCAAGCTCGGCAAGTAAAGAATCTGCTAGATGATGTGGAAGAGTTTCATGAACGTGCTCAGGAGGCCATGATGGATGAAACCCCAGAT
TCTTCCAAACTCCAGATGTTGATAGATATGGGCTCTAGTCTCTATGTGGAACTCCCTGAATTACCACGACTGAAGCAAGAGCTACAACAG
GCTCGGTGGTTGGACGAAGTAAGACTGACCTTATCAGATCCGCAACAAGTCACTTTGGATGTCATGAAGAAGCTGATAGACTCTGGGGTA
GGGTTGGCACCCCACCATGCTGTGGAGAAAGCAATGGCTGAACTACAGGAGCTCCTTACAGTCTCTGAACGATGGGAAGAAAAGGCTAAG
GTCTGCCTACAGGCAAGACCGAGGCACAGTGTGGCAAGTTTAGAAAGCATTGTGAATGAAGCCAAGAACATTCCAGCCTTTCTACCCAAT
GTGTTGTCCTTGAAAGAAGCCTTACAAAAGGCTCGAGAATGGACCGCTAAAGTGGAAGCTATTCAGAGTGGCAGCAATTACGCTTATTTG
GAGCAGCTTGAGAGCTTGTCTGCGAAAGGACGCCCTATTCCTGTGCGTCTTGAAGCACTGCCGCAAGTGGAATCACAGGTAGCAGCAGCA
CGGGCATGGAGAGAACGGACTGGGCGGACGTTTCTTAAGAAGAATTCTAGCCATACATTGTTACAGGTGCTGAGCCCCCGGACCGACATT
GGTGTATATGGGAGTGGCAAAAATAGGAGGAAAAAAGTAAAAGAACTAATAGAAAAAGAAAAAGAAAAGGATCTGGACCTGGAGCCTCTG
AGTGATCTGGAGGAAGGATTGGAGGAAACCAGAGATACAGCCATGGTGGTGGCAGTTTTCAAAGAACGGGAGCAAAAAGAGATTGAAGCC
ATGCATTCTCTCAGAGCAGCCAACCTAGCCAAGATGACAATGGTGGACCGCATAGAAGAAGTAAAATTTTGCATTTGCCGCAAGACAGCC
AGTGGGTTTATGCTACAGTGTGAGCTCTGCAAAGACTGGTTCCATAACAGCTGTGTTCCTCTTCCTAAATCAAGTTCCCAAAAAAAAGGA
TCCAGCTGGCAAGCTAAAGAAGTAAAATTCCTTTGCCCTCTTTGTATGCGGTCTCGAAGGCCCAGGCTAGAGACTATTCTGTCACTCCTG
GTATCCCTTCAGAAGTTGCCCGTACGGTTGCCTGAAGGAGAGGCCCTGCAGTGTTTGACAGAACGTGCTATGAGTTGGCAAGATAGAGCG
CGGCAGGCTCTAGCCACAGATGAACTATCCTCTGCCCTGGCCAAACTATCTGTGTTGAGCCAGCGTATGGTGGAACAGGCGGCTCGAGAA
AAAACTGAAAAGATCATCAGTGCAGAACTCCAAAAAGCAGCTGCCAATCCAGACTTACAGGGACACTTACCTAGTTTCCAGCAGTCTGCT
TTTAACCGGGTGGTGAGCAGTGTGTCATCTTCTCCTCGACAAACAATGGACTATGATGATGAAGAAACAGACTCTGATGAAGACATTCGA
GAGACATATGGCTACGACATGAAGGACACAGCCAGTGTGAAGTCCTCTAGTAGTCTTGAACCCAATCTTTTTTGTGATGAAGAGATTCCC
ATCAAATCCGAGGAGGTGGTGACCCACATGTGGACAGCACCTTCATTTTGTGCAGAGCATGCTTATTCTTCTGCTTCTAAGAGTTGTTCT
CAAGGTTCTAGCACCCCAAGGAAACAACCTCGGAAGAGCCCTTTGGTGCCCCGAAGTTTGGAACCTCCAGTGCTGGAGTTGTCACCTGGA
GCTAAGGCACAACTGGAAGAACTTATGATGGTTGGAGATCTCCTGGAAGTATCTCTGGACGAGACTCAACACATATGGCGGATTTTGCAG

>In-frame_KDM5A_ENST00000382815_chr12_404739_-_NINJ2_ENST00000305108_chr12_675344_-_4455nt
ATGGCGGGCGTGGGGCCGGGGGGCTACGCGGCGGAGTTCGTGCCACCGCCAGAGTGCCCCGTCTTTGAGCCGAGTTGGGAGGAGTTCACA
GATCCGCTCAGCTTTATCGGCCGCATCCGGCCTTTGGCGGAGAAAACCGGCATCTGCAAAATTCGGCCGCCCAAGGACTGGCAGCCTCCA
TTTGCCTGTGAAGTAAAAAGCTTTCGTTTCACTCCAAGAGTCCAGCGCCTGAATGAACTTGAGGCAATGACCAGAGTGAGATTGGATTTC
TTGGATCAACTAGCAAAATTTTGGGAACTTCAAGGATCTACTCTGAAGATCCCTGTGGTAGAGAGAAAAATCCTGGATCTGTATGCTTTG
AGCAAGATTGTTGCCAGCAAAGGAGGTTTTGAAATGGTCACCAAAGAGAAGAAATGGTCTAAAGTGGGTAGTCGCTTGGGATATCTGCCA
GGAAAAGGAACTGGGTCTCTTTTGAAGTCACATTATGAAAGAATTCTCTACCCATATGAGCTTTTCCAGTCTGGTGTGAGCCTTATGGGT
GTGCAGATGCCTAATTTAGATCTTAAAGAAAAAGTGGAGCCTGAGGTTCTCAGCACTGATACCCAAACTTCCCCAGAGCCAGGCACAAGG
ATGAACATTCTGCCGAAGAGAACAAGACGTGTGAAGACTCAGTCAGAATCTGGAGATGTGAGTAGAAACACGGAACTGAAGAAACTTCAG
ATTTTTGGGGCTGGGCCCAAGGTTGTGGGCTTGGCAATGGGAACAAAAGATAAAGAAGATGAGGTCACCCGAAGACGAAAAGTTACCAAC
AGGTCAGACGCATTTAACATGCAAATGAGACAACGGAAAGGCACTCTCTCTGTTAACTTTGTTGATCTCTATGTTTGTATGTTTTGTGGT
CGGGGAAACAATGAAGATAAATTGCTTTTGTGTGATGGATGTGATGACAGCTATCATACATTTTGTCTAATTCCTCCACTACCTGATGTG
CCCAAAGGAGACTGGAGGTGTCCTAAATGTGTCGCCGAGGAATGTAGCAAACCTCGAGAAGCCTTTGGATTTGAACAAGCTGTACGAGAG
TATACACTTCAGAGCTTTGGAGAGATGGCAGATAATTTTAAGTCTGATTATTTTAATATGCCAGTCCATATGGTTCCCACAGAACTAGTA
GAAAAGGAATTTTGGCGGCTGGTAAGCAGCATTGAAGAAGATGTTATTGTGGAATATGGAGCAGATATCTCCTCAAAAGACTTTGGAAGT
GGATTTCCGGTGAAGGATGGGCGGAGAAAGATTCTGCCAGAAGAAGAGGAATATGCACTTTCTGGTTGGAATTTGAATAACATGCCTGTC
CTGGAACAGTCTGTTCTTGCACATATTAATGTGGACATCTCTGGTATGAAAGTGCCGTGGCTCTATGTGGGAATGTGCTTCTCTTCTTTT
TGCTGGCACATTGAGGATCACTGGAGTTATTCCATCAACTACTTGCACTGGGGGGAGCCAAAGACATGGTATGGTGTGCCATCTCATGCT
GCAGAGCAACTGGAGGAGGTGATGAGAGAGCTGGCCCCCGAGTTATTTGAATCCCAGCCTGATCTTCTGCATCAGTTAGTTACCATCATG
AACCCCAACGTGCTAATGGAGCATGGTGTGCCTGTGTACAGGACCAATCAGTGTGCTGGCGAGTTTGTTGTGACATTTCCTCGTGCCTAT
CACTCTGGATTTAACCAGGGCTACAACTTTGCTGAAGCTGTGAACTTCTGTACTGCTGACTGGTTGCCCATTGGACGTCAATGTGTAAAT
CATTACCGACGCCTAAGGCGCCACTGTGTCTTTTCACACGAGGAACTAATTTTCAAGATGGCAGCAGATCCAGAATGCTTAGATGTGGGG
CTGGCTGCCATGGTCTGCAAAGAATTGACTCTCATGACTGAAGAAGAAACACGATTAAGAGAGTCTGTTGTACAGATGGGTGTCCTGATG
TCAGAAGAAGAAGTGTTTGAACTTGTTCCTGATGATGAGCGGCAGTGTTCAGCATGCAGAACCACATGTTTTCTCTCTGCTCTCACATGT
TCCTGTAATCCTGAGCGGCTTGTATGTCTCTACCATCCAACTGATCTGTGCCCCTGCCCCATGCAGAAGAAATGTCTTAGATATCGCTAC
CCATTAGAAGACCTCCCTTCTCTGCTATATGGTGTAAAAGTCAGGGCACAGTCCTATGACACTTGGGTCAGTCGTGTTACAGAAGCATTG
TCTGCTAACTTCAACCACAAAAAAGATTTGATTGAATTGCGAGTAATGCTGGAAGATGCTGAGGATAGGAAATACCCAGAGAATGATCTC
TTTCGAAAACTCAGGGATGCTGTAAAAGAAGCTGAGACCTGTGCTTCTGTGGCTCAGCTGCTTCTGAGCAAAAAGCAGAAACACAGACAG
AGCCCAGATAGTGGGAGGACTCGGACCAAACTGACAGTGGAAGAATTGAAGGCCTTTGTCCAACAACTTTTTAGTCTTCCGTGTGTCATC
AGCCAAGCTCGGCAAGTAAAGAATCTGCTAGATGATGTGGAAGAGTTTCATGAACGTGCTCAGGAGGCCATGATGGATGAAACCCCAGAT
TCTTCCAAACTCCAGATGTTGATAGATATGGGCTCTAGTCTCTATGTGGAACTCCCTGAATTACCACGACTGAAGCAAGAGCTACAACAG
GCTCGGTGGTTGGACGAAGTAAGACTGACCTTATCAGATCCGCAACAAGTCACTTTGGATGTCATGAAGAAGCTGATAGACTCTGGGGTA
GGGTTGGCACCCCACCATGCTGTGGAGAAAGCAATGGCTGAACTACAGGAGCTCCTTACAGTCTCTGAACGATGGGAAGAAAAGGCTAAG
GTCTGCCTACAGGCAAGACCGAGGCACAGTGTGGCAAGTTTAGAAAGCATTGTGAATGAAGCCAAGAACATTCCAGCCTTTCTACCCAAT
GTGTTGTCCTTGAAAGAAGCCTTACAAAAGGCTCGAGAATGGACCGCTAAAGTGGAAGCTATTCAGAGTGGCAGCAATTACGCTTATTTG
GAGCAGCTTGAGAGCTTGTCTGCGAAAGGACGCCCTATTCCTGTGCGTCTTGAAGCACTGCCGCAAGTGGAATCACAGGTAGCAGCAGCA
CGGGCATGGAGAGAACGGACTGGGCGGACGTTTCTTAAGAAGAATTCTAGCCATACATTGTTACAGGTGCTGAGCCCCCGGACCGACATT
GGTGTATATGGGAGTGGCAAAAATAGGAGGAAAAAAGTAAAAGAACTAATAGAAAAAGAAAAAGAAAAGGATCTGGACCTGGAGCCTCTG
AGTGATCTGGAGGAAGGATTGGAGGAAACCAGAGATACAGCCATGGTGGTGGCAGTTTTCAAAGAACGGGAGCAAAAAGAGATTGAAGCC
ATGCATTCTCTCAGAGCAGCCAACCTAGCCAAGATGACAATGGTGGACCGCATAGAAGAAGTAAAATTTTGCATTTGCCGCAAGACAGCC
AGTGGGTTTATGCTACAGTGTGAGCTCTGCAAAGACTGGTTCCATAACAGCTGTGTTCCTCTTCCTAAATCAAGTTCCCAAAAAAAAGGA
TCCAGCTGGCAAGCTAAAGAAGTAAAATTCCTTTGCCCTCTTTGTATGCGGTCTCGAAGGCCCAGGCTAGAGACTATTCTGTCACTCCTG
GTATCCCTTCAGAAGTTGCCCGTACGGTTGCCTGAAGGAGAGGCCCTGCAGTGTTTGACAGAACGTGCTATGAGTTGGCAAGATAGAGCG
CGGCAGGCTCTAGCCACAGATGAACTATCCTCTGCCCTGGCCAAACTATCTGTGTTGAGCCAGCGTATGGTGGAACAGGCGGCTCGAGAA
AAAACTGAAAAGATCATCAGTGCAGAACTCCAAAAAGCAGCTGCCAATCCAGACTTACAGGGACACTTACCTAGTTTCCAGCAGTCTGCT
TTTAACCGGGTGGTGAGCAGTGTGTCATCTTCTCCTCGACAAACAATGGACTATGATGATGAAGAAACAGACTCTGATGAAGACATTCGA
GAGACATATGGCTACGACATGAAGGACACAGCCAGTGTGAAGTCCTCTAGTAGTCTTGAACCCAATCTTTTTTGTGATGAAGAGATTCCC
ATCAAATCCGAGGAGGTGGTGACCCACATGTGGACAGCACCTTCATTTTGTGCAGAGCATGCTTATTCTTCTGCTTCTAAGAGTTGTTCT
CAAGGTTCTAGCACCCCAAGGAAACAACCTCGGAAGAGCCCTTTGGTGCCCCGAAGTTTGGAACCTCCAGTGCTGGAGTTGTCACCTGGA
GCTAAGGCACAACTGGAAGAACTTATGATGGTTGGAGATCTCCTGGAAGTATCTCTGGACGAGACTCAACACATATGGCGGATTTTGCAG

>In-frame_KDM5A_ENST00000382815_chr12_404739_-_NINJ2_ENST00000397265_chr12_675344_-_4455nt
ATGGCGGGCGTGGGGCCGGGGGGCTACGCGGCGGAGTTCGTGCCACCGCCAGAGTGCCCCGTCTTTGAGCCGAGTTGGGAGGAGTTCACA
GATCCGCTCAGCTTTATCGGCCGCATCCGGCCTTTGGCGGAGAAAACCGGCATCTGCAAAATTCGGCCGCCCAAGGACTGGCAGCCTCCA
TTTGCCTGTGAAGTAAAAAGCTTTCGTTTCACTCCAAGAGTCCAGCGCCTGAATGAACTTGAGGCAATGACCAGAGTGAGATTGGATTTC
TTGGATCAACTAGCAAAATTTTGGGAACTTCAAGGATCTACTCTGAAGATCCCTGTGGTAGAGAGAAAAATCCTGGATCTGTATGCTTTG
AGCAAGATTGTTGCCAGCAAAGGAGGTTTTGAAATGGTCACCAAAGAGAAGAAATGGTCTAAAGTGGGTAGTCGCTTGGGATATCTGCCA
GGAAAAGGAACTGGGTCTCTTTTGAAGTCACATTATGAAAGAATTCTCTACCCATATGAGCTTTTCCAGTCTGGTGTGAGCCTTATGGGT
GTGCAGATGCCTAATTTAGATCTTAAAGAAAAAGTGGAGCCTGAGGTTCTCAGCACTGATACCCAAACTTCCCCAGAGCCAGGCACAAGG
ATGAACATTCTGCCGAAGAGAACAAGACGTGTGAAGACTCAGTCAGAATCTGGAGATGTGAGTAGAAACACGGAACTGAAGAAACTTCAG
ATTTTTGGGGCTGGGCCCAAGGTTGTGGGCTTGGCAATGGGAACAAAAGATAAAGAAGATGAGGTCACCCGAAGACGAAAAGTTACCAAC
AGGTCAGACGCATTTAACATGCAAATGAGACAACGGAAAGGCACTCTCTCTGTTAACTTTGTTGATCTCTATGTTTGTATGTTTTGTGGT
CGGGGAAACAATGAAGATAAATTGCTTTTGTGTGATGGATGTGATGACAGCTATCATACATTTTGTCTAATTCCTCCACTACCTGATGTG
CCCAAAGGAGACTGGAGGTGTCCTAAATGTGTCGCCGAGGAATGTAGCAAACCTCGAGAAGCCTTTGGATTTGAACAAGCTGTACGAGAG
TATACACTTCAGAGCTTTGGAGAGATGGCAGATAATTTTAAGTCTGATTATTTTAATATGCCAGTCCATATGGTTCCCACAGAACTAGTA
GAAAAGGAATTTTGGCGGCTGGTAAGCAGCATTGAAGAAGATGTTATTGTGGAATATGGAGCAGATATCTCCTCAAAAGACTTTGGAAGT
GGATTTCCGGTGAAGGATGGGCGGAGAAAGATTCTGCCAGAAGAAGAGGAATATGCACTTTCTGGTTGGAATTTGAATAACATGCCTGTC
CTGGAACAGTCTGTTCTTGCACATATTAATGTGGACATCTCTGGTATGAAAGTGCCGTGGCTCTATGTGGGAATGTGCTTCTCTTCTTTT
TGCTGGCACATTGAGGATCACTGGAGTTATTCCATCAACTACTTGCACTGGGGGGAGCCAAAGACATGGTATGGTGTGCCATCTCATGCT
GCAGAGCAACTGGAGGAGGTGATGAGAGAGCTGGCCCCCGAGTTATTTGAATCCCAGCCTGATCTTCTGCATCAGTTAGTTACCATCATG
AACCCCAACGTGCTAATGGAGCATGGTGTGCCTGTGTACAGGACCAATCAGTGTGCTGGCGAGTTTGTTGTGACATTTCCTCGTGCCTAT
CACTCTGGATTTAACCAGGGCTACAACTTTGCTGAAGCTGTGAACTTCTGTACTGCTGACTGGTTGCCCATTGGACGTCAATGTGTAAAT
CATTACCGACGCCTAAGGCGCCACTGTGTCTTTTCACACGAGGAACTAATTTTCAAGATGGCAGCAGATCCAGAATGCTTAGATGTGGGG
CTGGCTGCCATGGTCTGCAAAGAATTGACTCTCATGACTGAAGAAGAAACACGATTAAGAGAGTCTGTTGTACAGATGGGTGTCCTGATG
TCAGAAGAAGAAGTGTTTGAACTTGTTCCTGATGATGAGCGGCAGTGTTCAGCATGCAGAACCACATGTTTTCTCTCTGCTCTCACATGT
TCCTGTAATCCTGAGCGGCTTGTATGTCTCTACCATCCAACTGATCTGTGCCCCTGCCCCATGCAGAAGAAATGTCTTAGATATCGCTAC
CCATTAGAAGACCTCCCTTCTCTGCTATATGGTGTAAAAGTCAGGGCACAGTCCTATGACACTTGGGTCAGTCGTGTTACAGAAGCATTG
TCTGCTAACTTCAACCACAAAAAAGATTTGATTGAATTGCGAGTAATGCTGGAAGATGCTGAGGATAGGAAATACCCAGAGAATGATCTC
TTTCGAAAACTCAGGGATGCTGTAAAAGAAGCTGAGACCTGTGCTTCTGTGGCTCAGCTGCTTCTGAGCAAAAAGCAGAAACACAGACAG
AGCCCAGATAGTGGGAGGACTCGGACCAAACTGACAGTGGAAGAATTGAAGGCCTTTGTCCAACAACTTTTTAGTCTTCCGTGTGTCATC
AGCCAAGCTCGGCAAGTAAAGAATCTGCTAGATGATGTGGAAGAGTTTCATGAACGTGCTCAGGAGGCCATGATGGATGAAACCCCAGAT
TCTTCCAAACTCCAGATGTTGATAGATATGGGCTCTAGTCTCTATGTGGAACTCCCTGAATTACCACGACTGAAGCAAGAGCTACAACAG
GCTCGGTGGTTGGACGAAGTAAGACTGACCTTATCAGATCCGCAACAAGTCACTTTGGATGTCATGAAGAAGCTGATAGACTCTGGGGTA
GGGTTGGCACCCCACCATGCTGTGGAGAAAGCAATGGCTGAACTACAGGAGCTCCTTACAGTCTCTGAACGATGGGAAGAAAAGGCTAAG
GTCTGCCTACAGGCAAGACCGAGGCACAGTGTGGCAAGTTTAGAAAGCATTGTGAATGAAGCCAAGAACATTCCAGCCTTTCTACCCAAT
GTGTTGTCCTTGAAAGAAGCCTTACAAAAGGCTCGAGAATGGACCGCTAAAGTGGAAGCTATTCAGAGTGGCAGCAATTACGCTTATTTG
GAGCAGCTTGAGAGCTTGTCTGCGAAAGGACGCCCTATTCCTGTGCGTCTTGAAGCACTGCCGCAAGTGGAATCACAGGTAGCAGCAGCA
CGGGCATGGAGAGAACGGACTGGGCGGACGTTTCTTAAGAAGAATTCTAGCCATACATTGTTACAGGTGCTGAGCCCCCGGACCGACATT
GGTGTATATGGGAGTGGCAAAAATAGGAGGAAAAAAGTAAAAGAACTAATAGAAAAAGAAAAAGAAAAGGATCTGGACCTGGAGCCTCTG
AGTGATCTGGAGGAAGGATTGGAGGAAACCAGAGATACAGCCATGGTGGTGGCAGTTTTCAAAGAACGGGAGCAAAAAGAGATTGAAGCC
ATGCATTCTCTCAGAGCAGCCAACCTAGCCAAGATGACAATGGTGGACCGCATAGAAGAAGTAAAATTTTGCATTTGCCGCAAGACAGCC
AGTGGGTTTATGCTACAGTGTGAGCTCTGCAAAGACTGGTTCCATAACAGCTGTGTTCCTCTTCCTAAATCAAGTTCCCAAAAAAAAGGA
TCCAGCTGGCAAGCTAAAGAAGTAAAATTCCTTTGCCCTCTTTGTATGCGGTCTCGAAGGCCCAGGCTAGAGACTATTCTGTCACTCCTG
GTATCCCTTCAGAAGTTGCCCGTACGGTTGCCTGAAGGAGAGGCCCTGCAGTGTTTGACAGAACGTGCTATGAGTTGGCAAGATAGAGCG
CGGCAGGCTCTAGCCACAGATGAACTATCCTCTGCCCTGGCCAAACTATCTGTGTTGAGCCAGCGTATGGTGGAACAGGCGGCTCGAGAA
AAAACTGAAAAGATCATCAGTGCAGAACTCCAAAAAGCAGCTGCCAATCCAGACTTACAGGGACACTTACCTAGTTTCCAGCAGTCTGCT
TTTAACCGGGTGGTGAGCAGTGTGTCATCTTCTCCTCGACAAACAATGGACTATGATGATGAAGAAACAGACTCTGATGAAGACATTCGA
GAGACATATGGCTACGACATGAAGGACACAGCCAGTGTGAAGTCCTCTAGTAGTCTTGAACCCAATCTTTTTTGTGATGAAGAGATTCCC
ATCAAATCCGAGGAGGTGGTGACCCACATGTGGACAGCACCTTCATTTTGTGCAGAGCATGCTTATTCTTCTGCTTCTAAGAGTTGTTCT
CAAGGTTCTAGCACCCCAAGGAAACAACCTCGGAAGAGCCCTTTGGTGCCCCGAAGTTTGGAACCTCCAGTGCTGGAGTTGTCACCTGGA
GCTAAGGCACAACTGGAAGAACTTATGATGGTTGGAGATCTCCTGGAAGTATCTCTGGACGAGACTCAACACATATGGCGGATTTTGCAG

>In-frame_KDM5A_ENST00000399788_chr12_459787_-_NINJ2_ENST00000305108_chr12_675344_-_1308nt
ATGGCGGGCGTGGGGCCGGGGGGCTACGCGGCGGAGTTCGTGCCACCGCCAGAGTGCCCCGTCTTTGAGCCGAGTTGGGAGGAGTTCACA
GATCCGCTCAGCTTTATCGGCCGCATCCGGCCTTTGGCGGAGAAAACCGGCATCTGCAAAATTCGGCCGCCCAAGGACTGGCAGCCTCCA
TTTGCCTGTGAAGTAAAAAGCTTTCGTTTCACTCCAAGAGTCCAGCGCCTGAATGAACTTGAGGCAATGACCAGAGTGAGATTGGATTTC
TTGGATCAACTAGCAAAATTTTGGGAACTTCAAGGATCTACTCTGAAGATCCCTGTGGTAGAGAGAAAAATCCTGGATCTGTATGCTTTG
AGCAAGATTGTTGCCAGCAAAGGAGGTTTTGAAATGGTCACCAAAGAGAAGAAATGGTCTAAAGTGGGTAGTCGCTTGGGATATCTGCCA
GGAAAAGGAACTGGGTCTCTTTTGAAGTCACATTATGAAAGAATTCTCTACCCATATGAGCTTTTCCAGTCTGGTGTGAGCCTTATGGGT
GTGCAGATGCCTAATTTAGATCTTAAAGAAAAAGTGGAGCCTGAGGTTCTCAGCACTGATACCCAAACTTCCCCAGAGCCAGGCACAAGG
ATGAACATTCTGCCGAAGAGAACAAGACGTGTGAAGACTCAGTCAGAATCTGGAGATGTGAGTAGAAACACGGAACTGAAGAAACTTCAG
ATTTTTGGGGCTGGGCCCAAGGTTGTGGGCTTGGCAATGGGAACAAAAGATAAAGAAGATGAGGTCACCCGAAGACGAAAAGTTACCAAC
AGGTCAGACGCATTTAACATGCAAATGAGACAACGGAAAGGCACTCTCTCTGTTAACTTTGTTGATCTCTATGTTTGTATGTTTTGTGGT
CGGGGAAACAATGAAGATAAATTGCTTTTGTGTGATGGATGTGATGACAGCTATCATACATTTTGTCTAATTCCTCCACTACCTGATGTG
CCCAAAGGAGACTGGAGGTGTCCTAAATGTGTCGCCGAGGAATGTAGCAAACCTCGAGAAGCCTTTGGATTTGAACAAGCTGTACGAGAG
TATACACTTCAGAGCTTTGGAGAGATGGCAGATAATTTTAAGTCTGATTATTTTAATATGCCAGTCCATATGGTTCCCACAGAACTAGTA
GAAAAGGAATTTTGGCGGCTGGTAAGCAGCATTGAAGAAGATGTTATTGTGGAATATGGAGCAGATATCTCCTCAAAAGACTTTGGAAGT

>In-frame_KDM5A_ENST00000399788_chr12_459787_-_NINJ2_ENST00000397265_chr12_675344_-_1308nt
ATGGCGGGCGTGGGGCCGGGGGGCTACGCGGCGGAGTTCGTGCCACCGCCAGAGTGCCCCGTCTTTGAGCCGAGTTGGGAGGAGTTCACA
GATCCGCTCAGCTTTATCGGCCGCATCCGGCCTTTGGCGGAGAAAACCGGCATCTGCAAAATTCGGCCGCCCAAGGACTGGCAGCCTCCA
TTTGCCTGTGAAGTAAAAAGCTTTCGTTTCACTCCAAGAGTCCAGCGCCTGAATGAACTTGAGGCAATGACCAGAGTGAGATTGGATTTC
TTGGATCAACTAGCAAAATTTTGGGAACTTCAAGGATCTACTCTGAAGATCCCTGTGGTAGAGAGAAAAATCCTGGATCTGTATGCTTTG
AGCAAGATTGTTGCCAGCAAAGGAGGTTTTGAAATGGTCACCAAAGAGAAGAAATGGTCTAAAGTGGGTAGTCGCTTGGGATATCTGCCA
GGAAAAGGAACTGGGTCTCTTTTGAAGTCACATTATGAAAGAATTCTCTACCCATATGAGCTTTTCCAGTCTGGTGTGAGCCTTATGGGT
GTGCAGATGCCTAATTTAGATCTTAAAGAAAAAGTGGAGCCTGAGGTTCTCAGCACTGATACCCAAACTTCCCCAGAGCCAGGCACAAGG
ATGAACATTCTGCCGAAGAGAACAAGACGTGTGAAGACTCAGTCAGAATCTGGAGATGTGAGTAGAAACACGGAACTGAAGAAACTTCAG
ATTTTTGGGGCTGGGCCCAAGGTTGTGGGCTTGGCAATGGGAACAAAAGATAAAGAAGATGAGGTCACCCGAAGACGAAAAGTTACCAAC
AGGTCAGACGCATTTAACATGCAAATGAGACAACGGAAAGGCACTCTCTCTGTTAACTTTGTTGATCTCTATGTTTGTATGTTTTGTGGT
CGGGGAAACAATGAAGATAAATTGCTTTTGTGTGATGGATGTGATGACAGCTATCATACATTTTGTCTAATTCCTCCACTACCTGATGTG
CCCAAAGGAGACTGGAGGTGTCCTAAATGTGTCGCCGAGGAATGTAGCAAACCTCGAGAAGCCTTTGGATTTGAACAAGCTGTACGAGAG
TATACACTTCAGAGCTTTGGAGAGATGGCAGATAATTTTAAGTCTGATTATTTTAATATGCCAGTCCATATGGTTCCCACAGAACTAGTA
GAAAAGGAATTTTGGCGGCTGGTAAGCAGCATTGAAGAAGATGTTATTGTGGAATATGGAGCAGATATCTCCTCAAAAGACTTTGGAAGT

>In-frame_KDM5A_ENST00000382815_chr12_459787_-_NINJ2_ENST00000305108_chr12_675344_-_1308nt
ATGGCGGGCGTGGGGCCGGGGGGCTACGCGGCGGAGTTCGTGCCACCGCCAGAGTGCCCCGTCTTTGAGCCGAGTTGGGAGGAGTTCACA
GATCCGCTCAGCTTTATCGGCCGCATCCGGCCTTTGGCGGAGAAAACCGGCATCTGCAAAATTCGGCCGCCCAAGGACTGGCAGCCTCCA
TTTGCCTGTGAAGTAAAAAGCTTTCGTTTCACTCCAAGAGTCCAGCGCCTGAATGAACTTGAGGCAATGACCAGAGTGAGATTGGATTTC
TTGGATCAACTAGCAAAATTTTGGGAACTTCAAGGATCTACTCTGAAGATCCCTGTGGTAGAGAGAAAAATCCTGGATCTGTATGCTTTG
AGCAAGATTGTTGCCAGCAAAGGAGGTTTTGAAATGGTCACCAAAGAGAAGAAATGGTCTAAAGTGGGTAGTCGCTTGGGATATCTGCCA
GGAAAAGGAACTGGGTCTCTTTTGAAGTCACATTATGAAAGAATTCTCTACCCATATGAGCTTTTCCAGTCTGGTGTGAGCCTTATGGGT
GTGCAGATGCCTAATTTAGATCTTAAAGAAAAAGTGGAGCCTGAGGTTCTCAGCACTGATACCCAAACTTCCCCAGAGCCAGGCACAAGG
ATGAACATTCTGCCGAAGAGAACAAGACGTGTGAAGACTCAGTCAGAATCTGGAGATGTGAGTAGAAACACGGAACTGAAGAAACTTCAG
ATTTTTGGGGCTGGGCCCAAGGTTGTGGGCTTGGCAATGGGAACAAAAGATAAAGAAGATGAGGTCACCCGAAGACGAAAAGTTACCAAC
AGGTCAGACGCATTTAACATGCAAATGAGACAACGGAAAGGCACTCTCTCTGTTAACTTTGTTGATCTCTATGTTTGTATGTTTTGTGGT
CGGGGAAACAATGAAGATAAATTGCTTTTGTGTGATGGATGTGATGACAGCTATCATACATTTTGTCTAATTCCTCCACTACCTGATGTG
CCCAAAGGAGACTGGAGGTGTCCTAAATGTGTCGCCGAGGAATGTAGCAAACCTCGAGAAGCCTTTGGATTTGAACAAGCTGTACGAGAG
TATACACTTCAGAGCTTTGGAGAGATGGCAGATAATTTTAAGTCTGATTATTTTAATATGCCAGTCCATATGGTTCCCACAGAACTAGTA
GAAAAGGAATTTTGGCGGCTGGTAAGCAGCATTGAAGAAGATGTTATTGTGGAATATGGAGCAGATATCTCCTCAAAAGACTTTGGAAGT

>In-frame_KDM5A_ENST00000382815_chr12_459787_-_NINJ2_ENST00000397265_chr12_675344_-_1308nt
ATGGCGGGCGTGGGGCCGGGGGGCTACGCGGCGGAGTTCGTGCCACCGCCAGAGTGCCCCGTCTTTGAGCCGAGTTGGGAGGAGTTCACA
GATCCGCTCAGCTTTATCGGCCGCATCCGGCCTTTGGCGGAGAAAACCGGCATCTGCAAAATTCGGCCGCCCAAGGACTGGCAGCCTCCA
TTTGCCTGTGAAGTAAAAAGCTTTCGTTTCACTCCAAGAGTCCAGCGCCTGAATGAACTTGAGGCAATGACCAGAGTGAGATTGGATTTC
TTGGATCAACTAGCAAAATTTTGGGAACTTCAAGGATCTACTCTGAAGATCCCTGTGGTAGAGAGAAAAATCCTGGATCTGTATGCTTTG
AGCAAGATTGTTGCCAGCAAAGGAGGTTTTGAAATGGTCACCAAAGAGAAGAAATGGTCTAAAGTGGGTAGTCGCTTGGGATATCTGCCA
GGAAAAGGAACTGGGTCTCTTTTGAAGTCACATTATGAAAGAATTCTCTACCCATATGAGCTTTTCCAGTCTGGTGTGAGCCTTATGGGT
GTGCAGATGCCTAATTTAGATCTTAAAGAAAAAGTGGAGCCTGAGGTTCTCAGCACTGATACCCAAACTTCCCCAGAGCCAGGCACAAGG
ATGAACATTCTGCCGAAGAGAACAAGACGTGTGAAGACTCAGTCAGAATCTGGAGATGTGAGTAGAAACACGGAACTGAAGAAACTTCAG
ATTTTTGGGGCTGGGCCCAAGGTTGTGGGCTTGGCAATGGGAACAAAAGATAAAGAAGATGAGGTCACCCGAAGACGAAAAGTTACCAAC
AGGTCAGACGCATTTAACATGCAAATGAGACAACGGAAAGGCACTCTCTCTGTTAACTTTGTTGATCTCTATGTTTGTATGTTTTGTGGT
CGGGGAAACAATGAAGATAAATTGCTTTTGTGTGATGGATGTGATGACAGCTATCATACATTTTGTCTAATTCCTCCACTACCTGATGTG
CCCAAAGGAGACTGGAGGTGTCCTAAATGTGTCGCCGAGGAATGTAGCAAACCTCGAGAAGCCTTTGGATTTGAACAAGCTGTACGAGAG
TATACACTTCAGAGCTTTGGAGAGATGGCAGATAATTTTAAGTCTGATTATTTTAATATGCCAGTCCATATGGTTCCCACAGAACTAGTA
GAAAAGGAATTTTGGCGGCTGGTAAGCAGCATTGAAGAAGATGTTATTGTGGAATATGGAGCAGATATCTCCTCAAAAGACTTTGGAAGT


* Fusion transcript sequences (Full-length transcript).
>In-frame_KDM5A_ENST00000399788_chr12_404739_-_NINJ2_ENST00000305108_chr12_675344_-_5618nt
GCAGAACTTTGGCGGGCAAGGAGACAAACAGCCACACTGTGCTGCCGGGGAAGAGAAGAAGAAGGAAAGGCCAGACACACAGGCGTCGTG
CAGCTGCGGAAGGATTCCGTTTCCTGCAGGGGGCGGAGGGATTTGACAGCACGGTAACTTCCGGAAAAGTCCTGAACCTCAGTGGAAAAG
CCTTGCAAGAAACAATAACAAACGGGAGGAGGAAGCGATTCTGGGGTTTCTGTGTTGAACGGTTCTTGTCCGCGAAGATGCGCTTCGGCC
TCTGTCAGGGGACTTGAACGGGCTTAGTGGGCTTCAGCCAGCTTTTCTCCACCGGTTCCCCACGGGGACCCCCCCCCCCCCCCGGCCGTT
GCAATGGCGGGCGTGGGGCCGGGGGGCTACGCGGCGGAGTTCGTGCCACCGCCAGAGTGCCCCGTCTTTGAGCCGAGTTGGGAGGAGTTC
ACAGATCCGCTCAGCTTTATCGGCCGCATCCGGCCTTTGGCGGAGAAAACCGGCATCTGCAAAATTCGGCCGCCCAAGGACTGGCAGCCT
CCATTTGCCTGTGAAGTAAAAAGCTTTCGTTTCACTCCAAGAGTCCAGCGCCTGAATGAACTTGAGGCAATGACCAGAGTGAGATTGGAT
TTCTTGGATCAACTAGCAAAATTTTGGGAACTTCAAGGATCTACTCTGAAGATCCCTGTGGTAGAGAGAAAAATCCTGGATCTGTATGCT
TTGAGCAAGATTGTTGCCAGCAAAGGAGGTTTTGAAATGGTCACCAAAGAGAAGAAATGGTCTAAAGTGGGTAGTCGCTTGGGATATCTG
CCAGGAAAAGGAACTGGGTCTCTTTTGAAGTCACATTATGAAAGAATTCTCTACCCATATGAGCTTTTCCAGTCTGGTGTGAGCCTTATG
GGTGTGCAGATGCCTAATTTAGATCTTAAAGAAAAAGTGGAGCCTGAGGTTCTCAGCACTGATACCCAAACTTCCCCAGAGCCAGGCACA
AGGATGAACATTCTGCCGAAGAGAACAAGACGTGTGAAGACTCAGTCAGAATCTGGAGATGTGAGTAGAAACACGGAACTGAAGAAACTT
CAGATTTTTGGGGCTGGGCCCAAGGTTGTGGGCTTGGCAATGGGAACAAAAGATAAAGAAGATGAGGTCACCCGAAGACGAAAAGTTACC
AACAGGTCAGACGCATTTAACATGCAAATGAGACAACGGAAAGGCACTCTCTCTGTTAACTTTGTTGATCTCTATGTTTGTATGTTTTGT
GGTCGGGGAAACAATGAAGATAAATTGCTTTTGTGTGATGGATGTGATGACAGCTATCATACATTTTGTCTAATTCCTCCACTACCTGAT
GTGCCCAAAGGAGACTGGAGGTGTCCTAAATGTGTCGCCGAGGAATGTAGCAAACCTCGAGAAGCCTTTGGATTTGAACAAGCTGTACGA
GAGTATACACTTCAGAGCTTTGGAGAGATGGCAGATAATTTTAAGTCTGATTATTTTAATATGCCAGTCCATATGGTTCCCACAGAACTA
GTAGAAAAGGAATTTTGGCGGCTGGTAAGCAGCATTGAAGAAGATGTTATTGTGGAATATGGAGCAGATATCTCCTCAAAAGACTTTGGA
AGTGGATTTCCGGTGAAGGATGGGCGGAGAAAGATTCTGCCAGAAGAAGAGGAATATGCACTTTCTGGTTGGAATTTGAATAACATGCCT
GTCCTGGAACAGTCTGTTCTTGCACATATTAATGTGGACATCTCTGGTATGAAAGTGCCGTGGCTCTATGTGGGAATGTGCTTCTCTTCT
TTTTGCTGGCACATTGAGGATCACTGGAGTTATTCCATCAACTACTTGCACTGGGGGGAGCCAAAGACATGGTATGGTGTGCCATCTCAT
GCTGCAGAGCAACTGGAGGAGGTGATGAGAGAGCTGGCCCCCGAGTTATTTGAATCCCAGCCTGATCTTCTGCATCAGTTAGTTACCATC
ATGAACCCCAACGTGCTAATGGAGCATGGTGTGCCTGTGTACAGGACCAATCAGTGTGCTGGCGAGTTTGTTGTGACATTTCCTCGTGCC
TATCACTCTGGATTTAACCAGGGCTACAACTTTGCTGAAGCTGTGAACTTCTGTACTGCTGACTGGTTGCCCATTGGACGTCAATGTGTA
AATCATTACCGACGCCTAAGGCGCCACTGTGTCTTTTCACACGAGGAACTAATTTTCAAGATGGCAGCAGATCCAGAATGCTTAGATGTG
GGGCTGGCTGCCATGGTCTGCAAAGAATTGACTCTCATGACTGAAGAAGAAACACGATTAAGAGAGTCTGTTGTACAGATGGGTGTCCTG
ATGTCAGAAGAAGAAGTGTTTGAACTTGTTCCTGATGATGAGCGGCAGTGTTCAGCATGCAGAACCACATGTTTTCTCTCTGCTCTCACA
TGTTCCTGTAATCCTGAGCGGCTTGTATGTCTCTACCATCCAACTGATCTGTGCCCCTGCCCCATGCAGAAGAAATGTCTTAGATATCGC
TACCCATTAGAAGACCTCCCTTCTCTGCTATATGGTGTAAAAGTCAGGGCACAGTCCTATGACACTTGGGTCAGTCGTGTTACAGAAGCA
TTGTCTGCTAACTTCAACCACAAAAAAGATTTGATTGAATTGCGAGTAATGCTGGAAGATGCTGAGGATAGGAAATACCCAGAGAATGAT
CTCTTTCGAAAACTCAGGGATGCTGTAAAAGAAGCTGAGACCTGTGCTTCTGTGGCTCAGCTGCTTCTGAGCAAAAAGCAGAAACACAGA
CAGAGCCCAGATAGTGGGAGGACTCGGACCAAACTGACAGTGGAAGAATTGAAGGCCTTTGTCCAACAACTTTTTAGTCTTCCGTGTGTC
ATCAGCCAAGCTCGGCAAGTAAAGAATCTGCTAGATGATGTGGAAGAGTTTCATGAACGTGCTCAGGAGGCCATGATGGATGAAACCCCA
GATTCTTCCAAACTCCAGATGTTGATAGATATGGGCTCTAGTCTCTATGTGGAACTCCCTGAATTACCACGACTGAAGCAAGAGCTACAA
CAGGCTCGGTGGTTGGACGAAGTAAGACTGACCTTATCAGATCCGCAACAAGTCACTTTGGATGTCATGAAGAAGCTGATAGACTCTGGG
GTAGGGTTGGCACCCCACCATGCTGTGGAGAAAGCAATGGCTGAACTACAGGAGCTCCTTACAGTCTCTGAACGATGGGAAGAAAAGGCT
AAGGTCTGCCTACAGGCAAGACCGAGGCACAGTGTGGCAAGTTTAGAAAGCATTGTGAATGAAGCCAAGAACATTCCAGCCTTTCTACCC
AATGTGTTGTCCTTGAAAGAAGCCTTACAAAAGGCTCGAGAATGGACCGCTAAAGTGGAAGCTATTCAGAGTGGCAGCAATTACGCTTAT
TTGGAGCAGCTTGAGAGCTTGTCTGCGAAAGGACGCCCTATTCCTGTGCGTCTTGAAGCACTGCCGCAAGTGGAATCACAGGTAGCAGCA
GCACGGGCATGGAGAGAACGGACTGGGCGGACGTTTCTTAAGAAGAATTCTAGCCATACATTGTTACAGGTGCTGAGCCCCCGGACCGAC
ATTGGTGTATATGGGAGTGGCAAAAATAGGAGGAAAAAAGTAAAAGAACTAATAGAAAAAGAAAAAGAAAAGGATCTGGACCTGGAGCCT
CTGAGTGATCTGGAGGAAGGATTGGAGGAAACCAGAGATACAGCCATGGTGGTGGCAGTTTTCAAAGAACGGGAGCAAAAAGAGATTGAA
GCCATGCATTCTCTCAGAGCAGCCAACCTAGCCAAGATGACAATGGTGGACCGCATAGAAGAAGTAAAATTTTGCATTTGCCGCAAGACA
GCCAGTGGGTTTATGCTACAGTGTGAGCTCTGCAAAGACTGGTTCCATAACAGCTGTGTTCCTCTTCCTAAATCAAGTTCCCAAAAAAAA
GGATCCAGCTGGCAAGCTAAAGAAGTAAAATTCCTTTGCCCTCTTTGTATGCGGTCTCGAAGGCCCAGGCTAGAGACTATTCTGTCACTC
CTGGTATCCCTTCAGAAGTTGCCCGTACGGTTGCCTGAAGGAGAGGCCCTGCAGTGTTTGACAGAACGTGCTATGAGTTGGCAAGATAGA
GCGCGGCAGGCTCTAGCCACAGATGAACTATCCTCTGCCCTGGCCAAACTATCTGTGTTGAGCCAGCGTATGGTGGAACAGGCGGCTCGA
GAAAAAACTGAAAAGATCATCAGTGCAGAACTCCAAAAAGCAGCTGCCAATCCAGACTTACAGGGACACTTACCTAGTTTCCAGCAGTCT
GCTTTTAACCGGGTGGTGAGCAGTGTGTCATCTTCTCCTCGACAAACAATGGACTATGATGATGAAGAAACAGACTCTGATGAAGACATT
CGAGAGACATATGGCTACGACATGAAGGACACAGCCAGTGTGAAGTCCTCTAGTAGTCTTGAACCCAATCTTTTTTGTGATGAAGAGATT
CCCATCAAATCCGAGGAGGTGGTGACCCACATGTGGACAGCACCTTCATTTTGTGCAGAGCATGCTTATTCTTCTGCTTCTAAGAGTTGT
TCTCAAGGTTCTAGCACCCCAAGGAAACAACCTCGGAAGAGCCCTTTGGTGCCCCGAAGTTTGGAACCTCCAGTGCTGGAGTTGTCACCT
GGAGCTAAGGCACAACTGGAAGAACTTATGATGGTTGGAGATCTCCTGGAAGTATCTCTGGACGAGACTCAACACATATGGCGGATTTTG
CAGGCCACACACCCACCCTCTGAAGACAGATTCTTGCATATCATGGAGCCTGGAAGCTCCGACCCCAGGAGCCAGCCCATCAACCTGAAC
CATTACGCCACCAAGAAGAGCGTGGCGGAGAGCATGCTGGACGTGGCCCTGTTCATGTCCAACGCCATGCGGCTGAAGGCGGTGCTGGAG
CAGGGACCATCCTCTCACTACTACACCACCCTGGTCACCCTCATCAGCCTCTCTCTGCTCCTGCAGGTGGTCATCGGTGTCCTGCTCGTG
GTCATTGCACGGCTGAACCTGAATGAGGTAGAAAAGCAGTGGCGACTCAACCAGCTCAACAACGCAGCCACCATCTTGGTCTTCTTCACT
GTGGTCATCAATGTTTTCATTACAGCCTTCGGGGCACATAAAACAGGGTTCCTGGCTGCCAGGGCCTCAAGGAATCCTCTCTGAATGCAG
CCTGGGACCCAGGTTCTGGGCCTGGAACTTCTGCCTCCTTCCTCCGTGATCTGCCAGGCTCGTGGGCACTTTCCACAGCCCAGGAGAGCT
TCTGAAAGGACAGTATAGCTGCCCTTGCTCCCTACCCACAGCACCTGAGTTAAAAAGTGATTTTTATGTTATTGGTCTAAGGGACTTCCA
TCTTGGTCTGAAGTCCTGAGCTCAGACGCAGGTACTGCCAGCCATACCTTCCTGGTAGCATCTGCTGGACCTAAGTAAGGCATGTCTGTC
TAAGGCCAAGTCTGCCCGGCTTAAGGATGCTGGTTCTGACTCTACCCCACTGCTTCCTTCTGCTCCAGGCCTCAATTTTCCCTTCTTGTA

>In-frame_KDM5A_ENST00000399788_chr12_404739_-_NINJ2_ENST00000397265_chr12_675344_-_5538nt
GCAGAACTTTGGCGGGCAAGGAGACAAACAGCCACACTGTGCTGCCGGGGAAGAGAAGAAGAAGGAAAGGCCAGACACACAGGCGTCGTG
CAGCTGCGGAAGGATTCCGTTTCCTGCAGGGGGCGGAGGGATTTGACAGCACGGTAACTTCCGGAAAAGTCCTGAACCTCAGTGGAAAAG
CCTTGCAAGAAACAATAACAAACGGGAGGAGGAAGCGATTCTGGGGTTTCTGTGTTGAACGGTTCTTGTCCGCGAAGATGCGCTTCGGCC
TCTGTCAGGGGACTTGAACGGGCTTAGTGGGCTTCAGCCAGCTTTTCTCCACCGGTTCCCCACGGGGACCCCCCCCCCCCCCCGGCCGTT
GCAATGGCGGGCGTGGGGCCGGGGGGCTACGCGGCGGAGTTCGTGCCACCGCCAGAGTGCCCCGTCTTTGAGCCGAGTTGGGAGGAGTTC
ACAGATCCGCTCAGCTTTATCGGCCGCATCCGGCCTTTGGCGGAGAAAACCGGCATCTGCAAAATTCGGCCGCCCAAGGACTGGCAGCCT
CCATTTGCCTGTGAAGTAAAAAGCTTTCGTTTCACTCCAAGAGTCCAGCGCCTGAATGAACTTGAGGCAATGACCAGAGTGAGATTGGAT
TTCTTGGATCAACTAGCAAAATTTTGGGAACTTCAAGGATCTACTCTGAAGATCCCTGTGGTAGAGAGAAAAATCCTGGATCTGTATGCT
TTGAGCAAGATTGTTGCCAGCAAAGGAGGTTTTGAAATGGTCACCAAAGAGAAGAAATGGTCTAAAGTGGGTAGTCGCTTGGGATATCTG
CCAGGAAAAGGAACTGGGTCTCTTTTGAAGTCACATTATGAAAGAATTCTCTACCCATATGAGCTTTTCCAGTCTGGTGTGAGCCTTATG
GGTGTGCAGATGCCTAATTTAGATCTTAAAGAAAAAGTGGAGCCTGAGGTTCTCAGCACTGATACCCAAACTTCCCCAGAGCCAGGCACA
AGGATGAACATTCTGCCGAAGAGAACAAGACGTGTGAAGACTCAGTCAGAATCTGGAGATGTGAGTAGAAACACGGAACTGAAGAAACTT
CAGATTTTTGGGGCTGGGCCCAAGGTTGTGGGCTTGGCAATGGGAACAAAAGATAAAGAAGATGAGGTCACCCGAAGACGAAAAGTTACC
AACAGGTCAGACGCATTTAACATGCAAATGAGACAACGGAAAGGCACTCTCTCTGTTAACTTTGTTGATCTCTATGTTTGTATGTTTTGT
GGTCGGGGAAACAATGAAGATAAATTGCTTTTGTGTGATGGATGTGATGACAGCTATCATACATTTTGTCTAATTCCTCCACTACCTGAT
GTGCCCAAAGGAGACTGGAGGTGTCCTAAATGTGTCGCCGAGGAATGTAGCAAACCTCGAGAAGCCTTTGGATTTGAACAAGCTGTACGA
GAGTATACACTTCAGAGCTTTGGAGAGATGGCAGATAATTTTAAGTCTGATTATTTTAATATGCCAGTCCATATGGTTCCCACAGAACTA
GTAGAAAAGGAATTTTGGCGGCTGGTAAGCAGCATTGAAGAAGATGTTATTGTGGAATATGGAGCAGATATCTCCTCAAAAGACTTTGGA
AGTGGATTTCCGGTGAAGGATGGGCGGAGAAAGATTCTGCCAGAAGAAGAGGAATATGCACTTTCTGGTTGGAATTTGAATAACATGCCT
GTCCTGGAACAGTCTGTTCTTGCACATATTAATGTGGACATCTCTGGTATGAAAGTGCCGTGGCTCTATGTGGGAATGTGCTTCTCTTCT
TTTTGCTGGCACATTGAGGATCACTGGAGTTATTCCATCAACTACTTGCACTGGGGGGAGCCAAAGACATGGTATGGTGTGCCATCTCAT
GCTGCAGAGCAACTGGAGGAGGTGATGAGAGAGCTGGCCCCCGAGTTATTTGAATCCCAGCCTGATCTTCTGCATCAGTTAGTTACCATC
ATGAACCCCAACGTGCTAATGGAGCATGGTGTGCCTGTGTACAGGACCAATCAGTGTGCTGGCGAGTTTGTTGTGACATTTCCTCGTGCC
TATCACTCTGGATTTAACCAGGGCTACAACTTTGCTGAAGCTGTGAACTTCTGTACTGCTGACTGGTTGCCCATTGGACGTCAATGTGTA
AATCATTACCGACGCCTAAGGCGCCACTGTGTCTTTTCACACGAGGAACTAATTTTCAAGATGGCAGCAGATCCAGAATGCTTAGATGTG
GGGCTGGCTGCCATGGTCTGCAAAGAATTGACTCTCATGACTGAAGAAGAAACACGATTAAGAGAGTCTGTTGTACAGATGGGTGTCCTG
ATGTCAGAAGAAGAAGTGTTTGAACTTGTTCCTGATGATGAGCGGCAGTGTTCAGCATGCAGAACCACATGTTTTCTCTCTGCTCTCACA
TGTTCCTGTAATCCTGAGCGGCTTGTATGTCTCTACCATCCAACTGATCTGTGCCCCTGCCCCATGCAGAAGAAATGTCTTAGATATCGC
TACCCATTAGAAGACCTCCCTTCTCTGCTATATGGTGTAAAAGTCAGGGCACAGTCCTATGACACTTGGGTCAGTCGTGTTACAGAAGCA
TTGTCTGCTAACTTCAACCACAAAAAAGATTTGATTGAATTGCGAGTAATGCTGGAAGATGCTGAGGATAGGAAATACCCAGAGAATGAT
CTCTTTCGAAAACTCAGGGATGCTGTAAAAGAAGCTGAGACCTGTGCTTCTGTGGCTCAGCTGCTTCTGAGCAAAAAGCAGAAACACAGA
CAGAGCCCAGATAGTGGGAGGACTCGGACCAAACTGACAGTGGAAGAATTGAAGGCCTTTGTCCAACAACTTTTTAGTCTTCCGTGTGTC
ATCAGCCAAGCTCGGCAAGTAAAGAATCTGCTAGATGATGTGGAAGAGTTTCATGAACGTGCTCAGGAGGCCATGATGGATGAAACCCCA
GATTCTTCCAAACTCCAGATGTTGATAGATATGGGCTCTAGTCTCTATGTGGAACTCCCTGAATTACCACGACTGAAGCAAGAGCTACAA
CAGGCTCGGTGGTTGGACGAAGTAAGACTGACCTTATCAGATCCGCAACAAGTCACTTTGGATGTCATGAAGAAGCTGATAGACTCTGGG
GTAGGGTTGGCACCCCACCATGCTGTGGAGAAAGCAATGGCTGAACTACAGGAGCTCCTTACAGTCTCTGAACGATGGGAAGAAAAGGCT
AAGGTCTGCCTACAGGCAAGACCGAGGCACAGTGTGGCAAGTTTAGAAAGCATTGTGAATGAAGCCAAGAACATTCCAGCCTTTCTACCC
AATGTGTTGTCCTTGAAAGAAGCCTTACAAAAGGCTCGAGAATGGACCGCTAAAGTGGAAGCTATTCAGAGTGGCAGCAATTACGCTTAT
TTGGAGCAGCTTGAGAGCTTGTCTGCGAAAGGACGCCCTATTCCTGTGCGTCTTGAAGCACTGCCGCAAGTGGAATCACAGGTAGCAGCA
GCACGGGCATGGAGAGAACGGACTGGGCGGACGTTTCTTAAGAAGAATTCTAGCCATACATTGTTACAGGTGCTGAGCCCCCGGACCGAC
ATTGGTGTATATGGGAGTGGCAAAAATAGGAGGAAAAAAGTAAAAGAACTAATAGAAAAAGAAAAAGAAAAGGATCTGGACCTGGAGCCT
CTGAGTGATCTGGAGGAAGGATTGGAGGAAACCAGAGATACAGCCATGGTGGTGGCAGTTTTCAAAGAACGGGAGCAAAAAGAGATTGAA
GCCATGCATTCTCTCAGAGCAGCCAACCTAGCCAAGATGACAATGGTGGACCGCATAGAAGAAGTAAAATTTTGCATTTGCCGCAAGACA
GCCAGTGGGTTTATGCTACAGTGTGAGCTCTGCAAAGACTGGTTCCATAACAGCTGTGTTCCTCTTCCTAAATCAAGTTCCCAAAAAAAA
GGATCCAGCTGGCAAGCTAAAGAAGTAAAATTCCTTTGCCCTCTTTGTATGCGGTCTCGAAGGCCCAGGCTAGAGACTATTCTGTCACTC
CTGGTATCCCTTCAGAAGTTGCCCGTACGGTTGCCTGAAGGAGAGGCCCTGCAGTGTTTGACAGAACGTGCTATGAGTTGGCAAGATAGA
GCGCGGCAGGCTCTAGCCACAGATGAACTATCCTCTGCCCTGGCCAAACTATCTGTGTTGAGCCAGCGTATGGTGGAACAGGCGGCTCGA
GAAAAAACTGAAAAGATCATCAGTGCAGAACTCCAAAAAGCAGCTGCCAATCCAGACTTACAGGGACACTTACCTAGTTTCCAGCAGTCT
GCTTTTAACCGGGTGGTGAGCAGTGTGTCATCTTCTCCTCGACAAACAATGGACTATGATGATGAAGAAACAGACTCTGATGAAGACATT
CGAGAGACATATGGCTACGACATGAAGGACACAGCCAGTGTGAAGTCCTCTAGTAGTCTTGAACCCAATCTTTTTTGTGATGAAGAGATT
CCCATCAAATCCGAGGAGGTGGTGACCCACATGTGGACAGCACCTTCATTTTGTGCAGAGCATGCTTATTCTTCTGCTTCTAAGAGTTGT
TCTCAAGGTTCTAGCACCCCAAGGAAACAACCTCGGAAGAGCCCTTTGGTGCCCCGAAGTTTGGAACCTCCAGTGCTGGAGTTGTCACCT
GGAGCTAAGGCACAACTGGAAGAACTTATGATGGTTGGAGATCTCCTGGAAGTATCTCTGGACGAGACTCAACACATATGGCGGATTTTG
CAGGCCACACACCCACCCTCTGAAGACAGATTCTTGCATATCATGGAGCCTGGAAGCTCCGACCCCAGGAGCCAGCCCATCAACCTGAAC
CATTACGCCACCAAGAAGAGCGTGGCGGAGAGCATGCTGGACGTGGCCCTGTTCATGTCCAACGCCATGCGGCTGAAGGCGGTGCTGGAG
CAGGGACCATCCTCTCACTACTACACCACCCTGGTCACCCTCATCAGCCTCTCTCTGCTCCTGCAGGTGGTCATCGGTGTCCTGCTCGTG
GTCATTGCACGGCTGAACCTGAATGAGGTAGAAAAGCAGTGGCGACTCAACCAGCTCAACAACGCAGCCACCATCTTGGTCTTCTTCACT
GTGGTCATCAATGTTTTCATTACAGCCTTCGGGGCACATAAAACAGGGTTCCTGGCTGCCAGGGCCTCAAGGAATCCTCTCTGAATGCAG
CCTGGGACCCAGGTTCTGGGCCTGGAACTTCTGCCTCCTTCCTCCGTGATCTGCCAGGCTCGTGGGCACTTTCCACAGCCCAGGAGAGCT
TCTGAAAGGACAGTATAGCTGCCCTTGCTCCCTACCCACAGCACCTGAGTTAAAAAGTGATTTTTATGTTATTGGTCTAAGGGACTTCCA
TCTTGGTCTGAAGTCCTGAGCTCAGACGCAGGTACTGCCAGCCATACCTTCCTGGTAGCATCTGCTGGACCTAAGTAAGGCATGTCTGTC

>In-frame_KDM5A_ENST00000382815_chr12_404739_-_NINJ2_ENST00000305108_chr12_675344_-_5618nt
GCAGAACTTTGGCGGGCAAGGAGACAAACAGCCACACTGTGCTGCCGGGGAAGAGAAGAAGAAGGAAAGGCCAGACACACAGGCGTCGTG
CAGCTGCGGAAGGATTCCGTTTCCTGCAGGGGGCGGAGGGATTTGACAGCACGGTAACTTCCGGAAAAGTCCTGAACCTCAGTGGAAAAG
CCTTGCAAGAAACAATAACAAACGGGAGGAGGAAGCGATTCTGGGGTTTCTGTGTTGAACGGTTCTTGTCCGCGAAGATGCGCTTCGGCC
TCTGTCAGGGGACTTGAACGGGCTTAGTGGGCTTCAGCCAGCTTTTCTCCACCGGTTCCCCACGGGGACCCCCCCCCCCCCCCGGCCGTT
GCAATGGCGGGCGTGGGGCCGGGGGGCTACGCGGCGGAGTTCGTGCCACCGCCAGAGTGCCCCGTCTTTGAGCCGAGTTGGGAGGAGTTC
ACAGATCCGCTCAGCTTTATCGGCCGCATCCGGCCTTTGGCGGAGAAAACCGGCATCTGCAAAATTCGGCCGCCCAAGGACTGGCAGCCT
CCATTTGCCTGTGAAGTAAAAAGCTTTCGTTTCACTCCAAGAGTCCAGCGCCTGAATGAACTTGAGGCAATGACCAGAGTGAGATTGGAT
TTCTTGGATCAACTAGCAAAATTTTGGGAACTTCAAGGATCTACTCTGAAGATCCCTGTGGTAGAGAGAAAAATCCTGGATCTGTATGCT
TTGAGCAAGATTGTTGCCAGCAAAGGAGGTTTTGAAATGGTCACCAAAGAGAAGAAATGGTCTAAAGTGGGTAGTCGCTTGGGATATCTG
CCAGGAAAAGGAACTGGGTCTCTTTTGAAGTCACATTATGAAAGAATTCTCTACCCATATGAGCTTTTCCAGTCTGGTGTGAGCCTTATG
GGTGTGCAGATGCCTAATTTAGATCTTAAAGAAAAAGTGGAGCCTGAGGTTCTCAGCACTGATACCCAAACTTCCCCAGAGCCAGGCACA
AGGATGAACATTCTGCCGAAGAGAACAAGACGTGTGAAGACTCAGTCAGAATCTGGAGATGTGAGTAGAAACACGGAACTGAAGAAACTT
CAGATTTTTGGGGCTGGGCCCAAGGTTGTGGGCTTGGCAATGGGAACAAAAGATAAAGAAGATGAGGTCACCCGAAGACGAAAAGTTACC
AACAGGTCAGACGCATTTAACATGCAAATGAGACAACGGAAAGGCACTCTCTCTGTTAACTTTGTTGATCTCTATGTTTGTATGTTTTGT
GGTCGGGGAAACAATGAAGATAAATTGCTTTTGTGTGATGGATGTGATGACAGCTATCATACATTTTGTCTAATTCCTCCACTACCTGAT
GTGCCCAAAGGAGACTGGAGGTGTCCTAAATGTGTCGCCGAGGAATGTAGCAAACCTCGAGAAGCCTTTGGATTTGAACAAGCTGTACGA
GAGTATACACTTCAGAGCTTTGGAGAGATGGCAGATAATTTTAAGTCTGATTATTTTAATATGCCAGTCCATATGGTTCCCACAGAACTA
GTAGAAAAGGAATTTTGGCGGCTGGTAAGCAGCATTGAAGAAGATGTTATTGTGGAATATGGAGCAGATATCTCCTCAAAAGACTTTGGA
AGTGGATTTCCGGTGAAGGATGGGCGGAGAAAGATTCTGCCAGAAGAAGAGGAATATGCACTTTCTGGTTGGAATTTGAATAACATGCCT
GTCCTGGAACAGTCTGTTCTTGCACATATTAATGTGGACATCTCTGGTATGAAAGTGCCGTGGCTCTATGTGGGAATGTGCTTCTCTTCT
TTTTGCTGGCACATTGAGGATCACTGGAGTTATTCCATCAACTACTTGCACTGGGGGGAGCCAAAGACATGGTATGGTGTGCCATCTCAT
GCTGCAGAGCAACTGGAGGAGGTGATGAGAGAGCTGGCCCCCGAGTTATTTGAATCCCAGCCTGATCTTCTGCATCAGTTAGTTACCATC
ATGAACCCCAACGTGCTAATGGAGCATGGTGTGCCTGTGTACAGGACCAATCAGTGTGCTGGCGAGTTTGTTGTGACATTTCCTCGTGCC
TATCACTCTGGATTTAACCAGGGCTACAACTTTGCTGAAGCTGTGAACTTCTGTACTGCTGACTGGTTGCCCATTGGACGTCAATGTGTA
AATCATTACCGACGCCTAAGGCGCCACTGTGTCTTTTCACACGAGGAACTAATTTTCAAGATGGCAGCAGATCCAGAATGCTTAGATGTG
GGGCTGGCTGCCATGGTCTGCAAAGAATTGACTCTCATGACTGAAGAAGAAACACGATTAAGAGAGTCTGTTGTACAGATGGGTGTCCTG
ATGTCAGAAGAAGAAGTGTTTGAACTTGTTCCTGATGATGAGCGGCAGTGTTCAGCATGCAGAACCACATGTTTTCTCTCTGCTCTCACA
TGTTCCTGTAATCCTGAGCGGCTTGTATGTCTCTACCATCCAACTGATCTGTGCCCCTGCCCCATGCAGAAGAAATGTCTTAGATATCGC
TACCCATTAGAAGACCTCCCTTCTCTGCTATATGGTGTAAAAGTCAGGGCACAGTCCTATGACACTTGGGTCAGTCGTGTTACAGAAGCA
TTGTCTGCTAACTTCAACCACAAAAAAGATTTGATTGAATTGCGAGTAATGCTGGAAGATGCTGAGGATAGGAAATACCCAGAGAATGAT
CTCTTTCGAAAACTCAGGGATGCTGTAAAAGAAGCTGAGACCTGTGCTTCTGTGGCTCAGCTGCTTCTGAGCAAAAAGCAGAAACACAGA
CAGAGCCCAGATAGTGGGAGGACTCGGACCAAACTGACAGTGGAAGAATTGAAGGCCTTTGTCCAACAACTTTTTAGTCTTCCGTGTGTC
ATCAGCCAAGCTCGGCAAGTAAAGAATCTGCTAGATGATGTGGAAGAGTTTCATGAACGTGCTCAGGAGGCCATGATGGATGAAACCCCA
GATTCTTCCAAACTCCAGATGTTGATAGATATGGGCTCTAGTCTCTATGTGGAACTCCCTGAATTACCACGACTGAAGCAAGAGCTACAA
CAGGCTCGGTGGTTGGACGAAGTAAGACTGACCTTATCAGATCCGCAACAAGTCACTTTGGATGTCATGAAGAAGCTGATAGACTCTGGG
GTAGGGTTGGCACCCCACCATGCTGTGGAGAAAGCAATGGCTGAACTACAGGAGCTCCTTACAGTCTCTGAACGATGGGAAGAAAAGGCT
AAGGTCTGCCTACAGGCAAGACCGAGGCACAGTGTGGCAAGTTTAGAAAGCATTGTGAATGAAGCCAAGAACATTCCAGCCTTTCTACCC
AATGTGTTGTCCTTGAAAGAAGCCTTACAAAAGGCTCGAGAATGGACCGCTAAAGTGGAAGCTATTCAGAGTGGCAGCAATTACGCTTAT
TTGGAGCAGCTTGAGAGCTTGTCTGCGAAAGGACGCCCTATTCCTGTGCGTCTTGAAGCACTGCCGCAAGTGGAATCACAGGTAGCAGCA
GCACGGGCATGGAGAGAACGGACTGGGCGGACGTTTCTTAAGAAGAATTCTAGCCATACATTGTTACAGGTGCTGAGCCCCCGGACCGAC
ATTGGTGTATATGGGAGTGGCAAAAATAGGAGGAAAAAAGTAAAAGAACTAATAGAAAAAGAAAAAGAAAAGGATCTGGACCTGGAGCCT
CTGAGTGATCTGGAGGAAGGATTGGAGGAAACCAGAGATACAGCCATGGTGGTGGCAGTTTTCAAAGAACGGGAGCAAAAAGAGATTGAA
GCCATGCATTCTCTCAGAGCAGCCAACCTAGCCAAGATGACAATGGTGGACCGCATAGAAGAAGTAAAATTTTGCATTTGCCGCAAGACA
GCCAGTGGGTTTATGCTACAGTGTGAGCTCTGCAAAGACTGGTTCCATAACAGCTGTGTTCCTCTTCCTAAATCAAGTTCCCAAAAAAAA
GGATCCAGCTGGCAAGCTAAAGAAGTAAAATTCCTTTGCCCTCTTTGTATGCGGTCTCGAAGGCCCAGGCTAGAGACTATTCTGTCACTC
CTGGTATCCCTTCAGAAGTTGCCCGTACGGTTGCCTGAAGGAGAGGCCCTGCAGTGTTTGACAGAACGTGCTATGAGTTGGCAAGATAGA
GCGCGGCAGGCTCTAGCCACAGATGAACTATCCTCTGCCCTGGCCAAACTATCTGTGTTGAGCCAGCGTATGGTGGAACAGGCGGCTCGA
GAAAAAACTGAAAAGATCATCAGTGCAGAACTCCAAAAAGCAGCTGCCAATCCAGACTTACAGGGACACTTACCTAGTTTCCAGCAGTCT
GCTTTTAACCGGGTGGTGAGCAGTGTGTCATCTTCTCCTCGACAAACAATGGACTATGATGATGAAGAAACAGACTCTGATGAAGACATT
CGAGAGACATATGGCTACGACATGAAGGACACAGCCAGTGTGAAGTCCTCTAGTAGTCTTGAACCCAATCTTTTTTGTGATGAAGAGATT
CCCATCAAATCCGAGGAGGTGGTGACCCACATGTGGACAGCACCTTCATTTTGTGCAGAGCATGCTTATTCTTCTGCTTCTAAGAGTTGT
TCTCAAGGTTCTAGCACCCCAAGGAAACAACCTCGGAAGAGCCCTTTGGTGCCCCGAAGTTTGGAACCTCCAGTGCTGGAGTTGTCACCT
GGAGCTAAGGCACAACTGGAAGAACTTATGATGGTTGGAGATCTCCTGGAAGTATCTCTGGACGAGACTCAACACATATGGCGGATTTTG
CAGGCCACACACCCACCCTCTGAAGACAGATTCTTGCATATCATGGAGCCTGGAAGCTCCGACCCCAGGAGCCAGCCCATCAACCTGAAC
CATTACGCCACCAAGAAGAGCGTGGCGGAGAGCATGCTGGACGTGGCCCTGTTCATGTCCAACGCCATGCGGCTGAAGGCGGTGCTGGAG
CAGGGACCATCCTCTCACTACTACACCACCCTGGTCACCCTCATCAGCCTCTCTCTGCTCCTGCAGGTGGTCATCGGTGTCCTGCTCGTG
GTCATTGCACGGCTGAACCTGAATGAGGTAGAAAAGCAGTGGCGACTCAACCAGCTCAACAACGCAGCCACCATCTTGGTCTTCTTCACT
GTGGTCATCAATGTTTTCATTACAGCCTTCGGGGCACATAAAACAGGGTTCCTGGCTGCCAGGGCCTCAAGGAATCCTCTCTGAATGCAG
CCTGGGACCCAGGTTCTGGGCCTGGAACTTCTGCCTCCTTCCTCCGTGATCTGCCAGGCTCGTGGGCACTTTCCACAGCCCAGGAGAGCT
TCTGAAAGGACAGTATAGCTGCCCTTGCTCCCTACCCACAGCACCTGAGTTAAAAAGTGATTTTTATGTTATTGGTCTAAGGGACTTCCA
TCTTGGTCTGAAGTCCTGAGCTCAGACGCAGGTACTGCCAGCCATACCTTCCTGGTAGCATCTGCTGGACCTAAGTAAGGCATGTCTGTC
TAAGGCCAAGTCTGCCCGGCTTAAGGATGCTGGTTCTGACTCTACCCCACTGCTTCCTTCTGCTCCAGGCCTCAATTTTCCCTTCTTGTA

>In-frame_KDM5A_ENST00000382815_chr12_404739_-_NINJ2_ENST00000397265_chr12_675344_-_5538nt
GCAGAACTTTGGCGGGCAAGGAGACAAACAGCCACACTGTGCTGCCGGGGAAGAGAAGAAGAAGGAAAGGCCAGACACACAGGCGTCGTG
CAGCTGCGGAAGGATTCCGTTTCCTGCAGGGGGCGGAGGGATTTGACAGCACGGTAACTTCCGGAAAAGTCCTGAACCTCAGTGGAAAAG
CCTTGCAAGAAACAATAACAAACGGGAGGAGGAAGCGATTCTGGGGTTTCTGTGTTGAACGGTTCTTGTCCGCGAAGATGCGCTTCGGCC
TCTGTCAGGGGACTTGAACGGGCTTAGTGGGCTTCAGCCAGCTTTTCTCCACCGGTTCCCCACGGGGACCCCCCCCCCCCCCCGGCCGTT
GCAATGGCGGGCGTGGGGCCGGGGGGCTACGCGGCGGAGTTCGTGCCACCGCCAGAGTGCCCCGTCTTTGAGCCGAGTTGGGAGGAGTTC
ACAGATCCGCTCAGCTTTATCGGCCGCATCCGGCCTTTGGCGGAGAAAACCGGCATCTGCAAAATTCGGCCGCCCAAGGACTGGCAGCCT
CCATTTGCCTGTGAAGTAAAAAGCTTTCGTTTCACTCCAAGAGTCCAGCGCCTGAATGAACTTGAGGCAATGACCAGAGTGAGATTGGAT
TTCTTGGATCAACTAGCAAAATTTTGGGAACTTCAAGGATCTACTCTGAAGATCCCTGTGGTAGAGAGAAAAATCCTGGATCTGTATGCT
TTGAGCAAGATTGTTGCCAGCAAAGGAGGTTTTGAAATGGTCACCAAAGAGAAGAAATGGTCTAAAGTGGGTAGTCGCTTGGGATATCTG
CCAGGAAAAGGAACTGGGTCTCTTTTGAAGTCACATTATGAAAGAATTCTCTACCCATATGAGCTTTTCCAGTCTGGTGTGAGCCTTATG
GGTGTGCAGATGCCTAATTTAGATCTTAAAGAAAAAGTGGAGCCTGAGGTTCTCAGCACTGATACCCAAACTTCCCCAGAGCCAGGCACA
AGGATGAACATTCTGCCGAAGAGAACAAGACGTGTGAAGACTCAGTCAGAATCTGGAGATGTGAGTAGAAACACGGAACTGAAGAAACTT
CAGATTTTTGGGGCTGGGCCCAAGGTTGTGGGCTTGGCAATGGGAACAAAAGATAAAGAAGATGAGGTCACCCGAAGACGAAAAGTTACC
AACAGGTCAGACGCATTTAACATGCAAATGAGACAACGGAAAGGCACTCTCTCTGTTAACTTTGTTGATCTCTATGTTTGTATGTTTTGT
GGTCGGGGAAACAATGAAGATAAATTGCTTTTGTGTGATGGATGTGATGACAGCTATCATACATTTTGTCTAATTCCTCCACTACCTGAT
GTGCCCAAAGGAGACTGGAGGTGTCCTAAATGTGTCGCCGAGGAATGTAGCAAACCTCGAGAAGCCTTTGGATTTGAACAAGCTGTACGA
GAGTATACACTTCAGAGCTTTGGAGAGATGGCAGATAATTTTAAGTCTGATTATTTTAATATGCCAGTCCATATGGTTCCCACAGAACTA
GTAGAAAAGGAATTTTGGCGGCTGGTAAGCAGCATTGAAGAAGATGTTATTGTGGAATATGGAGCAGATATCTCCTCAAAAGACTTTGGA
AGTGGATTTCCGGTGAAGGATGGGCGGAGAAAGATTCTGCCAGAAGAAGAGGAATATGCACTTTCTGGTTGGAATTTGAATAACATGCCT
GTCCTGGAACAGTCTGTTCTTGCACATATTAATGTGGACATCTCTGGTATGAAAGTGCCGTGGCTCTATGTGGGAATGTGCTTCTCTTCT
TTTTGCTGGCACATTGAGGATCACTGGAGTTATTCCATCAACTACTTGCACTGGGGGGAGCCAAAGACATGGTATGGTGTGCCATCTCAT
GCTGCAGAGCAACTGGAGGAGGTGATGAGAGAGCTGGCCCCCGAGTTATTTGAATCCCAGCCTGATCTTCTGCATCAGTTAGTTACCATC
ATGAACCCCAACGTGCTAATGGAGCATGGTGTGCCTGTGTACAGGACCAATCAGTGTGCTGGCGAGTTTGTTGTGACATTTCCTCGTGCC
TATCACTCTGGATTTAACCAGGGCTACAACTTTGCTGAAGCTGTGAACTTCTGTACTGCTGACTGGTTGCCCATTGGACGTCAATGTGTA
AATCATTACCGACGCCTAAGGCGCCACTGTGTCTTTTCACACGAGGAACTAATTTTCAAGATGGCAGCAGATCCAGAATGCTTAGATGTG
GGGCTGGCTGCCATGGTCTGCAAAGAATTGACTCTCATGACTGAAGAAGAAACACGATTAAGAGAGTCTGTTGTACAGATGGGTGTCCTG
ATGTCAGAAGAAGAAGTGTTTGAACTTGTTCCTGATGATGAGCGGCAGTGTTCAGCATGCAGAACCACATGTTTTCTCTCTGCTCTCACA
TGTTCCTGTAATCCTGAGCGGCTTGTATGTCTCTACCATCCAACTGATCTGTGCCCCTGCCCCATGCAGAAGAAATGTCTTAGATATCGC
TACCCATTAGAAGACCTCCCTTCTCTGCTATATGGTGTAAAAGTCAGGGCACAGTCCTATGACACTTGGGTCAGTCGTGTTACAGAAGCA
TTGTCTGCTAACTTCAACCACAAAAAAGATTTGATTGAATTGCGAGTAATGCTGGAAGATGCTGAGGATAGGAAATACCCAGAGAATGAT
CTCTTTCGAAAACTCAGGGATGCTGTAAAAGAAGCTGAGACCTGTGCTTCTGTGGCTCAGCTGCTTCTGAGCAAAAAGCAGAAACACAGA
CAGAGCCCAGATAGTGGGAGGACTCGGACCAAACTGACAGTGGAAGAATTGAAGGCCTTTGTCCAACAACTTTTTAGTCTTCCGTGTGTC
ATCAGCCAAGCTCGGCAAGTAAAGAATCTGCTAGATGATGTGGAAGAGTTTCATGAACGTGCTCAGGAGGCCATGATGGATGAAACCCCA
GATTCTTCCAAACTCCAGATGTTGATAGATATGGGCTCTAGTCTCTATGTGGAACTCCCTGAATTACCACGACTGAAGCAAGAGCTACAA
CAGGCTCGGTGGTTGGACGAAGTAAGACTGACCTTATCAGATCCGCAACAAGTCACTTTGGATGTCATGAAGAAGCTGATAGACTCTGGG
GTAGGGTTGGCACCCCACCATGCTGTGGAGAAAGCAATGGCTGAACTACAGGAGCTCCTTACAGTCTCTGAACGATGGGAAGAAAAGGCT
AAGGTCTGCCTACAGGCAAGACCGAGGCACAGTGTGGCAAGTTTAGAAAGCATTGTGAATGAAGCCAAGAACATTCCAGCCTTTCTACCC
AATGTGTTGTCCTTGAAAGAAGCCTTACAAAAGGCTCGAGAATGGACCGCTAAAGTGGAAGCTATTCAGAGTGGCAGCAATTACGCTTAT
TTGGAGCAGCTTGAGAGCTTGTCTGCGAAAGGACGCCCTATTCCTGTGCGTCTTGAAGCACTGCCGCAAGTGGAATCACAGGTAGCAGCA
GCACGGGCATGGAGAGAACGGACTGGGCGGACGTTTCTTAAGAAGAATTCTAGCCATACATTGTTACAGGTGCTGAGCCCCCGGACCGAC
ATTGGTGTATATGGGAGTGGCAAAAATAGGAGGAAAAAAGTAAAAGAACTAATAGAAAAAGAAAAAGAAAAGGATCTGGACCTGGAGCCT
CTGAGTGATCTGGAGGAAGGATTGGAGGAAACCAGAGATACAGCCATGGTGGTGGCAGTTTTCAAAGAACGGGAGCAAAAAGAGATTGAA
GCCATGCATTCTCTCAGAGCAGCCAACCTAGCCAAGATGACAATGGTGGACCGCATAGAAGAAGTAAAATTTTGCATTTGCCGCAAGACA
GCCAGTGGGTTTATGCTACAGTGTGAGCTCTGCAAAGACTGGTTCCATAACAGCTGTGTTCCTCTTCCTAAATCAAGTTCCCAAAAAAAA
GGATCCAGCTGGCAAGCTAAAGAAGTAAAATTCCTTTGCCCTCTTTGTATGCGGTCTCGAAGGCCCAGGCTAGAGACTATTCTGTCACTC
CTGGTATCCCTTCAGAAGTTGCCCGTACGGTTGCCTGAAGGAGAGGCCCTGCAGTGTTTGACAGAACGTGCTATGAGTTGGCAAGATAGA
GCGCGGCAGGCTCTAGCCACAGATGAACTATCCTCTGCCCTGGCCAAACTATCTGTGTTGAGCCAGCGTATGGTGGAACAGGCGGCTCGA
GAAAAAACTGAAAAGATCATCAGTGCAGAACTCCAAAAAGCAGCTGCCAATCCAGACTTACAGGGACACTTACCTAGTTTCCAGCAGTCT
GCTTTTAACCGGGTGGTGAGCAGTGTGTCATCTTCTCCTCGACAAACAATGGACTATGATGATGAAGAAACAGACTCTGATGAAGACATT
CGAGAGACATATGGCTACGACATGAAGGACACAGCCAGTGTGAAGTCCTCTAGTAGTCTTGAACCCAATCTTTTTTGTGATGAAGAGATT
CCCATCAAATCCGAGGAGGTGGTGACCCACATGTGGACAGCACCTTCATTTTGTGCAGAGCATGCTTATTCTTCTGCTTCTAAGAGTTGT
TCTCAAGGTTCTAGCACCCCAAGGAAACAACCTCGGAAGAGCCCTTTGGTGCCCCGAAGTTTGGAACCTCCAGTGCTGGAGTTGTCACCT
GGAGCTAAGGCACAACTGGAAGAACTTATGATGGTTGGAGATCTCCTGGAAGTATCTCTGGACGAGACTCAACACATATGGCGGATTTTG
CAGGCCACACACCCACCCTCTGAAGACAGATTCTTGCATATCATGGAGCCTGGAAGCTCCGACCCCAGGAGCCAGCCCATCAACCTGAAC
CATTACGCCACCAAGAAGAGCGTGGCGGAGAGCATGCTGGACGTGGCCCTGTTCATGTCCAACGCCATGCGGCTGAAGGCGGTGCTGGAG
CAGGGACCATCCTCTCACTACTACACCACCCTGGTCACCCTCATCAGCCTCTCTCTGCTCCTGCAGGTGGTCATCGGTGTCCTGCTCGTG
GTCATTGCACGGCTGAACCTGAATGAGGTAGAAAAGCAGTGGCGACTCAACCAGCTCAACAACGCAGCCACCATCTTGGTCTTCTTCACT
GTGGTCATCAATGTTTTCATTACAGCCTTCGGGGCACATAAAACAGGGTTCCTGGCTGCCAGGGCCTCAAGGAATCCTCTCTGAATGCAG
CCTGGGACCCAGGTTCTGGGCCTGGAACTTCTGCCTCCTTCCTCCGTGATCTGCCAGGCTCGTGGGCACTTTCCACAGCCCAGGAGAGCT
TCTGAAAGGACAGTATAGCTGCCCTTGCTCCCTACCCACAGCACCTGAGTTAAAAAGTGATTTTTATGTTATTGGTCTAAGGGACTTCCA
TCTTGGTCTGAAGTCCTGAGCTCAGACGCAGGTACTGCCAGCCATACCTTCCTGGTAGCATCTGCTGGACCTAAGTAAGGCATGTCTGTC

>In-frame_KDM5A_ENST00000399788_chr12_430161_-_NINJ2_ENST00000305108_chr12_675344_-_3704nt
GCAGAACTTTGGCGGGCAAGGAGACAAACAGCCACACTGTGCTGCCGGGGAAGAGAAGAAGAAGGAAAGGCCAGACACACAGGCGTCGTG
CAGCTGCGGAAGGATTCCGTTTCCTGCAGGGGGCGGAGGGATTTGACAGCACGGTAACTTCCGGAAAAGTCCTGAACCTCAGTGGAAAAG
CCTTGCAAGAAACAATAACAAACGGGAGGAGGAAGCGATTCTGGGGTTTCTGTGTTGAACGGTTCTTGTCCGCGAAGATGCGCTTCGGCC
TCTGTCAGGGGACTTGAACGGGCTTAGTGGGCTTCAGCCAGCTTTTCTCCACCGGTTCCCCACGGGGACCCCCCCCCCCCCCCGGCCGTT
GCAATGGCGGGCGTGGGGCCGGGGGGCTACGCGGCGGAGTTCGTGCCACCGCCAGAGTGCCCCGTCTTTGAGCCGAGTTGGGAGGAGTTC
ACAGATCCGCTCAGCTTTATCGGCCGCATCCGGCCTTTGGCGGAGAAAACCGGCATCTGCAAAATTCGGCCGCCCAAGGACTGGCAGCCT
CCATTTGCCTGTGAAGTAAAAAGCTTTCGTTTCACTCCAAGAGTCCAGCGCCTGAATGAACTTGAGGCAATGACCAGAGTGAGATTGGAT
TTCTTGGATCAACTAGCAAAATTTTGGGAACTTCAAGGATCTACTCTGAAGATCCCTGTGGTAGAGAGAAAAATCCTGGATCTGTATGCT
TTGAGCAAGATTGTTGCCAGCAAAGGAGGTTTTGAAATGGTCACCAAAGAGAAGAAATGGTCTAAAGTGGGTAGTCGCTTGGGATATCTG
CCAGGAAAAGGAACTGGGTCTCTTTTGAAGTCACATTATGAAAGAATTCTCTACCCATATGAGCTTTTCCAGTCTGGTGTGAGCCTTATG
GGTGTGCAGATGCCTAATTTAGATCTTAAAGAAAAAGTGGAGCCTGAGGTTCTCAGCACTGATACCCAAACTTCCCCAGAGCCAGGCACA
AGGATGAACATTCTGCCGAAGAGAACAAGACGTGTGAAGACTCAGTCAGAATCTGGAGATGTGAGTAGAAACACGGAACTGAAGAAACTT
CAGATTTTTGGGGCTGGGCCCAAGGTTGTGGGCTTGGCAATGGGAACAAAAGATAAAGAAGATGAGGTCACCCGAAGACGAAAAGTTACC
AACAGGTCAGACGCATTTAACATGCAAATGAGACAACGGAAAGGCACTCTCTCTGTTAACTTTGTTGATCTCTATGTTTGTATGTTTTGT
GGTCGGGGAAACAATGAAGATAAATTGCTTTTGTGTGATGGATGTGATGACAGCTATCATACATTTTGTCTAATTCCTCCACTACCTGAT
GTGCCCAAAGGAGACTGGAGGTGTCCTAAATGTGTCGCCGAGGAATGTAGCAAACCTCGAGAAGCCTTTGGATTTGAACAAGCTGTACGA
GAGTATACACTTCAGAGCTTTGGAGAGATGGCAGATAATTTTAAGTCTGATTATTTTAATATGCCAGTCCATATGGTTCCCACAGAACTA
GTAGAAAAGGAATTTTGGCGGCTGGTAAGCAGCATTGAAGAAGATGTTATTGTGGAATATGGAGCAGATATCTCCTCAAAAGACTTTGGA
AGTGGATTTCCGGTGAAGGATGGGCGGAGAAAGATTCTGCCAGAAGAAGAGGAATATGCACTTTCTGGTTGGAATTTGAATAACATGCCT
GTCCTGGAACAGTCTGTTCTTGCACATATTAATGTGGACATCTCTGGTATGAAAGTGCCGTGGCTCTATGTGGGAATGTGCTTCTCTTCT
TTTTGCTGGCACATTGAGGATCACTGGAGTTATTCCATCAACTACTTGCACTGGGGGGAGCCAAAGACATGGTATGGTGTGCCATCTCAT
GCTGCAGAGCAACTGGAGGAGGTGATGAGAGAGCTGGCCCCCGAGTTATTTGAATCCCAGCCTGATCTTCTGCATCAGTTAGTTACCATC
ATGAACCCCAACGTGCTAATGGAGCATGGTGTGCCTGTGTACAGGACCAATCAGTGTGCTGGCGAGTTTGTTGTGACATTTCCTCGTGCC
TATCACTCTGGATTTAACCAGGGCTACAACTTTGCTGAAGCTGTGAACTTCTGTACTGCTGACTGGTTGCCCATTGGACGTCAATGTGTA
AATCATTACCGACGCCTAAGGCGCCACTGTGTCTTTTCACACGAGGAACTAATTTTCAAGATGGCAGCAGATCCAGAATGCTTAGATGTG
GGGCTGGCTGCCATGGTCTGCAAAGAATTGACTCTCATGACTGAAGAAGAAACACGATTAAGAGAGTCTGTTGTACAGATGGGTGTCCTG
ATGTCAGAAGAAGAAGTGTTTGAACTTGTTCCTGATGATGAGCGGCAGTGTTCAGCATGCAGAACCACATGTTTTCTCTCTGCTCTCACA
TGTTCCTGTAATCCTGAGCGGCTTGTATGTCTCTACCATCCAACTGATCTGTGCCCCTGCCCCATGCAGAAGAAATGTCTTAGATATCGC
TACCCATTAGAAGACCTCCCTTCTCTGCTATATGGTGTAAAAGTCAGGGCACAGTCCTATGACACTTGGGTCAGTCGTGTTACAGAAGCA
TTGTCTGCTAACTTCAACCACAAAAAAGATTTGATTGAATTGCGAGTAATGCTGGAAGATGCTGAGGATAGGAAATACCCAGAGAATGAT
CTCTTTCGAAAACTCAGGGATGCTGTAAAAGAAGCTGAGACCTGTGCTTCTGTGGCTCAGCTGCTTCTGAGCAAAAAGCAGAAACACAGA
CAGAGCCCAGATAGTGGGAGGACTCGGACCAAACTGACAGTGGAAGAATTGAAGGCCTTTGTCCAACAACTTTTTAGTCTTCCGTGTGTC
ATCAGCCAAGCTCGGCAAGTAAAGCCTGGAAGCTCCGACCCCAGGAGCCAGCCCATCAACCTGAACCATTACGCCACCAAGAAGAGCGTG
GCGGAGAGCATGCTGGACGTGGCCCTGTTCATGTCCAACGCCATGCGGCTGAAGGCGGTGCTGGAGCAGGGACCATCCTCTCACTACTAC
ACCACCCTGGTCACCCTCATCAGCCTCTCTCTGCTCCTGCAGGTGGTCATCGGTGTCCTGCTCGTGGTCATTGCACGGCTGAACCTGAAT
GAGGTAGAAAAGCAGTGGCGACTCAACCAGCTCAACAACGCAGCCACCATCTTGGTCTTCTTCACTGTGGTCATCAATGTTTTCATTACA
GCCTTCGGGGCACATAAAACAGGGTTCCTGGCTGCCAGGGCCTCAAGGAATCCTCTCTGAATGCAGCCTGGGACCCAGGTTCTGGGCCTG
GAACTTCTGCCTCCTTCCTCCGTGATCTGCCAGGCTCGTGGGCACTTTCCACAGCCCAGGAGAGCTTCTGAAAGGACAGTATAGCTGCCC
TTGCTCCCTACCCACAGCACCTGAGTTAAAAAGTGATTTTTATGTTATTGGTCTAAGGGACTTCCATCTTGGTCTGAAGTCCTGAGCTCA
GACGCAGGTACTGCCAGCCATACCTTCCTGGTAGCATCTGCTGGACCTAAGTAAGGCATGTCTGTCTAAGGCCAAGTCTGCCCGGCTTAA
GGATGCTGGTTCTGACTCTACCCCACTGCTTCCTTCTGCTCCAGGCCTCAATTTTCCCTTCTTGTAAAATGGAATCTATATCTATAAAGG

>In-frame_KDM5A_ENST00000399788_chr12_430161_-_NINJ2_ENST00000397265_chr12_675344_-_3624nt
GCAGAACTTTGGCGGGCAAGGAGACAAACAGCCACACTGTGCTGCCGGGGAAGAGAAGAAGAAGGAAAGGCCAGACACACAGGCGTCGTG
CAGCTGCGGAAGGATTCCGTTTCCTGCAGGGGGCGGAGGGATTTGACAGCACGGTAACTTCCGGAAAAGTCCTGAACCTCAGTGGAAAAG
CCTTGCAAGAAACAATAACAAACGGGAGGAGGAAGCGATTCTGGGGTTTCTGTGTTGAACGGTTCTTGTCCGCGAAGATGCGCTTCGGCC
TCTGTCAGGGGACTTGAACGGGCTTAGTGGGCTTCAGCCAGCTTTTCTCCACCGGTTCCCCACGGGGACCCCCCCCCCCCCCCGGCCGTT
GCAATGGCGGGCGTGGGGCCGGGGGGCTACGCGGCGGAGTTCGTGCCACCGCCAGAGTGCCCCGTCTTTGAGCCGAGTTGGGAGGAGTTC
ACAGATCCGCTCAGCTTTATCGGCCGCATCCGGCCTTTGGCGGAGAAAACCGGCATCTGCAAAATTCGGCCGCCCAAGGACTGGCAGCCT
CCATTTGCCTGTGAAGTAAAAAGCTTTCGTTTCACTCCAAGAGTCCAGCGCCTGAATGAACTTGAGGCAATGACCAGAGTGAGATTGGAT
TTCTTGGATCAACTAGCAAAATTTTGGGAACTTCAAGGATCTACTCTGAAGATCCCTGTGGTAGAGAGAAAAATCCTGGATCTGTATGCT
TTGAGCAAGATTGTTGCCAGCAAAGGAGGTTTTGAAATGGTCACCAAAGAGAAGAAATGGTCTAAAGTGGGTAGTCGCTTGGGATATCTG
CCAGGAAAAGGAACTGGGTCTCTTTTGAAGTCACATTATGAAAGAATTCTCTACCCATATGAGCTTTTCCAGTCTGGTGTGAGCCTTATG
GGTGTGCAGATGCCTAATTTAGATCTTAAAGAAAAAGTGGAGCCTGAGGTTCTCAGCACTGATACCCAAACTTCCCCAGAGCCAGGCACA
AGGATGAACATTCTGCCGAAGAGAACAAGACGTGTGAAGACTCAGTCAGAATCTGGAGATGTGAGTAGAAACACGGAACTGAAGAAACTT
CAGATTTTTGGGGCTGGGCCCAAGGTTGTGGGCTTGGCAATGGGAACAAAAGATAAAGAAGATGAGGTCACCCGAAGACGAAAAGTTACC
AACAGGTCAGACGCATTTAACATGCAAATGAGACAACGGAAAGGCACTCTCTCTGTTAACTTTGTTGATCTCTATGTTTGTATGTTTTGT
GGTCGGGGAAACAATGAAGATAAATTGCTTTTGTGTGATGGATGTGATGACAGCTATCATACATTTTGTCTAATTCCTCCACTACCTGAT
GTGCCCAAAGGAGACTGGAGGTGTCCTAAATGTGTCGCCGAGGAATGTAGCAAACCTCGAGAAGCCTTTGGATTTGAACAAGCTGTACGA
GAGTATACACTTCAGAGCTTTGGAGAGATGGCAGATAATTTTAAGTCTGATTATTTTAATATGCCAGTCCATATGGTTCCCACAGAACTA
GTAGAAAAGGAATTTTGGCGGCTGGTAAGCAGCATTGAAGAAGATGTTATTGTGGAATATGGAGCAGATATCTCCTCAAAAGACTTTGGA
AGTGGATTTCCGGTGAAGGATGGGCGGAGAAAGATTCTGCCAGAAGAAGAGGAATATGCACTTTCTGGTTGGAATTTGAATAACATGCCT
GTCCTGGAACAGTCTGTTCTTGCACATATTAATGTGGACATCTCTGGTATGAAAGTGCCGTGGCTCTATGTGGGAATGTGCTTCTCTTCT
TTTTGCTGGCACATTGAGGATCACTGGAGTTATTCCATCAACTACTTGCACTGGGGGGAGCCAAAGACATGGTATGGTGTGCCATCTCAT
GCTGCAGAGCAACTGGAGGAGGTGATGAGAGAGCTGGCCCCCGAGTTATTTGAATCCCAGCCTGATCTTCTGCATCAGTTAGTTACCATC
ATGAACCCCAACGTGCTAATGGAGCATGGTGTGCCTGTGTACAGGACCAATCAGTGTGCTGGCGAGTTTGTTGTGACATTTCCTCGTGCC
TATCACTCTGGATTTAACCAGGGCTACAACTTTGCTGAAGCTGTGAACTTCTGTACTGCTGACTGGTTGCCCATTGGACGTCAATGTGTA
AATCATTACCGACGCCTAAGGCGCCACTGTGTCTTTTCACACGAGGAACTAATTTTCAAGATGGCAGCAGATCCAGAATGCTTAGATGTG
GGGCTGGCTGCCATGGTCTGCAAAGAATTGACTCTCATGACTGAAGAAGAAACACGATTAAGAGAGTCTGTTGTACAGATGGGTGTCCTG
ATGTCAGAAGAAGAAGTGTTTGAACTTGTTCCTGATGATGAGCGGCAGTGTTCAGCATGCAGAACCACATGTTTTCTCTCTGCTCTCACA
TGTTCCTGTAATCCTGAGCGGCTTGTATGTCTCTACCATCCAACTGATCTGTGCCCCTGCCCCATGCAGAAGAAATGTCTTAGATATCGC
TACCCATTAGAAGACCTCCCTTCTCTGCTATATGGTGTAAAAGTCAGGGCACAGTCCTATGACACTTGGGTCAGTCGTGTTACAGAAGCA
TTGTCTGCTAACTTCAACCACAAAAAAGATTTGATTGAATTGCGAGTAATGCTGGAAGATGCTGAGGATAGGAAATACCCAGAGAATGAT
CTCTTTCGAAAACTCAGGGATGCTGTAAAAGAAGCTGAGACCTGTGCTTCTGTGGCTCAGCTGCTTCTGAGCAAAAAGCAGAAACACAGA
CAGAGCCCAGATAGTGGGAGGACTCGGACCAAACTGACAGTGGAAGAATTGAAGGCCTTTGTCCAACAACTTTTTAGTCTTCCGTGTGTC
ATCAGCCAAGCTCGGCAAGTAAAGCCTGGAAGCTCCGACCCCAGGAGCCAGCCCATCAACCTGAACCATTACGCCACCAAGAAGAGCGTG
GCGGAGAGCATGCTGGACGTGGCCCTGTTCATGTCCAACGCCATGCGGCTGAAGGCGGTGCTGGAGCAGGGACCATCCTCTCACTACTAC
ACCACCCTGGTCACCCTCATCAGCCTCTCTCTGCTCCTGCAGGTGGTCATCGGTGTCCTGCTCGTGGTCATTGCACGGCTGAACCTGAAT
GAGGTAGAAAAGCAGTGGCGACTCAACCAGCTCAACAACGCAGCCACCATCTTGGTCTTCTTCACTGTGGTCATCAATGTTTTCATTACA
GCCTTCGGGGCACATAAAACAGGGTTCCTGGCTGCCAGGGCCTCAAGGAATCCTCTCTGAATGCAGCCTGGGACCCAGGTTCTGGGCCTG
GAACTTCTGCCTCCTTCCTCCGTGATCTGCCAGGCTCGTGGGCACTTTCCACAGCCCAGGAGAGCTTCTGAAAGGACAGTATAGCTGCCC
TTGCTCCCTACCCACAGCACCTGAGTTAAAAAGTGATTTTTATGTTATTGGTCTAAGGGACTTCCATCTTGGTCTGAAGTCCTGAGCTCA
GACGCAGGTACTGCCAGCCATACCTTCCTGGTAGCATCTGCTGGACCTAAGTAAGGCATGTCTGTCTAAGGCCAAGTCTGCCCGGCTTAA

>In-frame_KDM5A_ENST00000382815_chr12_430161_-_NINJ2_ENST00000305108_chr12_675344_-_3704nt
GCAGAACTTTGGCGGGCAAGGAGACAAACAGCCACACTGTGCTGCCGGGGAAGAGAAGAAGAAGGAAAGGCCAGACACACAGGCGTCGTG
CAGCTGCGGAAGGATTCCGTTTCCTGCAGGGGGCGGAGGGATTTGACAGCACGGTAACTTCCGGAAAAGTCCTGAACCTCAGTGGAAAAG
CCTTGCAAGAAACAATAACAAACGGGAGGAGGAAGCGATTCTGGGGTTTCTGTGTTGAACGGTTCTTGTCCGCGAAGATGCGCTTCGGCC
TCTGTCAGGGGACTTGAACGGGCTTAGTGGGCTTCAGCCAGCTTTTCTCCACCGGTTCCCCACGGGGACCCCCCCCCCCCCCCGGCCGTT
GCAATGGCGGGCGTGGGGCCGGGGGGCTACGCGGCGGAGTTCGTGCCACCGCCAGAGTGCCCCGTCTTTGAGCCGAGTTGGGAGGAGTTC
ACAGATCCGCTCAGCTTTATCGGCCGCATCCGGCCTTTGGCGGAGAAAACCGGCATCTGCAAAATTCGGCCGCCCAAGGACTGGCAGCCT
CCATTTGCCTGTGAAGTAAAAAGCTTTCGTTTCACTCCAAGAGTCCAGCGCCTGAATGAACTTGAGGCAATGACCAGAGTGAGATTGGAT
TTCTTGGATCAACTAGCAAAATTTTGGGAACTTCAAGGATCTACTCTGAAGATCCCTGTGGTAGAGAGAAAAATCCTGGATCTGTATGCT
TTGAGCAAGATTGTTGCCAGCAAAGGAGGTTTTGAAATGGTCACCAAAGAGAAGAAATGGTCTAAAGTGGGTAGTCGCTTGGGATATCTG
CCAGGAAAAGGAACTGGGTCTCTTTTGAAGTCACATTATGAAAGAATTCTCTACCCATATGAGCTTTTCCAGTCTGGTGTGAGCCTTATG
GGTGTGCAGATGCCTAATTTAGATCTTAAAGAAAAAGTGGAGCCTGAGGTTCTCAGCACTGATACCCAAACTTCCCCAGAGCCAGGCACA
AGGATGAACATTCTGCCGAAGAGAACAAGACGTGTGAAGACTCAGTCAGAATCTGGAGATGTGAGTAGAAACACGGAACTGAAGAAACTT
CAGATTTTTGGGGCTGGGCCCAAGGTTGTGGGCTTGGCAATGGGAACAAAAGATAAAGAAGATGAGGTCACCCGAAGACGAAAAGTTACC
AACAGGTCAGACGCATTTAACATGCAAATGAGACAACGGAAAGGCACTCTCTCTGTTAACTTTGTTGATCTCTATGTTTGTATGTTTTGT
GGTCGGGGAAACAATGAAGATAAATTGCTTTTGTGTGATGGATGTGATGACAGCTATCATACATTTTGTCTAATTCCTCCACTACCTGAT
GTGCCCAAAGGAGACTGGAGGTGTCCTAAATGTGTCGCCGAGGAATGTAGCAAACCTCGAGAAGCCTTTGGATTTGAACAAGCTGTACGA
GAGTATACACTTCAGAGCTTTGGAGAGATGGCAGATAATTTTAAGTCTGATTATTTTAATATGCCAGTCCATATGGTTCCCACAGAACTA
GTAGAAAAGGAATTTTGGCGGCTGGTAAGCAGCATTGAAGAAGATGTTATTGTGGAATATGGAGCAGATATCTCCTCAAAAGACTTTGGA
AGTGGATTTCCGGTGAAGGATGGGCGGAGAAAGATTCTGCCAGAAGAAGAGGAATATGCACTTTCTGGTTGGAATTTGAATAACATGCCT
GTCCTGGAACAGTCTGTTCTTGCACATATTAATGTGGACATCTCTGGTATGAAAGTGCCGTGGCTCTATGTGGGAATGTGCTTCTCTTCT
TTTTGCTGGCACATTGAGGATCACTGGAGTTATTCCATCAACTACTTGCACTGGGGGGAGCCAAAGACATGGTATGGTGTGCCATCTCAT
GCTGCAGAGCAACTGGAGGAGGTGATGAGAGAGCTGGCCCCCGAGTTATTTGAATCCCAGCCTGATCTTCTGCATCAGTTAGTTACCATC
ATGAACCCCAACGTGCTAATGGAGCATGGTGTGCCTGTGTACAGGACCAATCAGTGTGCTGGCGAGTTTGTTGTGACATTTCCTCGTGCC
TATCACTCTGGATTTAACCAGGGCTACAACTTTGCTGAAGCTGTGAACTTCTGTACTGCTGACTGGTTGCCCATTGGACGTCAATGTGTA
AATCATTACCGACGCCTAAGGCGCCACTGTGTCTTTTCACACGAGGAACTAATTTTCAAGATGGCAGCAGATCCAGAATGCTTAGATGTG
GGGCTGGCTGCCATGGTCTGCAAAGAATTGACTCTCATGACTGAAGAAGAAACACGATTAAGAGAGTCTGTTGTACAGATGGGTGTCCTG
ATGTCAGAAGAAGAAGTGTTTGAACTTGTTCCTGATGATGAGCGGCAGTGTTCAGCATGCAGAACCACATGTTTTCTCTCTGCTCTCACA
TGTTCCTGTAATCCTGAGCGGCTTGTATGTCTCTACCATCCAACTGATCTGTGCCCCTGCCCCATGCAGAAGAAATGTCTTAGATATCGC
TACCCATTAGAAGACCTCCCTTCTCTGCTATATGGTGTAAAAGTCAGGGCACAGTCCTATGACACTTGGGTCAGTCGTGTTACAGAAGCA
TTGTCTGCTAACTTCAACCACAAAAAAGATTTGATTGAATTGCGAGTAATGCTGGAAGATGCTGAGGATAGGAAATACCCAGAGAATGAT
CTCTTTCGAAAACTCAGGGATGCTGTAAAAGAAGCTGAGACCTGTGCTTCTGTGGCTCAGCTGCTTCTGAGCAAAAAGCAGAAACACAGA
CAGAGCCCAGATAGTGGGAGGACTCGGACCAAACTGACAGTGGAAGAATTGAAGGCCTTTGTCCAACAACTTTTTAGTCTTCCGTGTGTC
ATCAGCCAAGCTCGGCAAGTAAAGCCTGGAAGCTCCGACCCCAGGAGCCAGCCCATCAACCTGAACCATTACGCCACCAAGAAGAGCGTG
GCGGAGAGCATGCTGGACGTGGCCCTGTTCATGTCCAACGCCATGCGGCTGAAGGCGGTGCTGGAGCAGGGACCATCCTCTCACTACTAC
ACCACCCTGGTCACCCTCATCAGCCTCTCTCTGCTCCTGCAGGTGGTCATCGGTGTCCTGCTCGTGGTCATTGCACGGCTGAACCTGAAT
GAGGTAGAAAAGCAGTGGCGACTCAACCAGCTCAACAACGCAGCCACCATCTTGGTCTTCTTCACTGTGGTCATCAATGTTTTCATTACA
GCCTTCGGGGCACATAAAACAGGGTTCCTGGCTGCCAGGGCCTCAAGGAATCCTCTCTGAATGCAGCCTGGGACCCAGGTTCTGGGCCTG
GAACTTCTGCCTCCTTCCTCCGTGATCTGCCAGGCTCGTGGGCACTTTCCACAGCCCAGGAGAGCTTCTGAAAGGACAGTATAGCTGCCC
TTGCTCCCTACCCACAGCACCTGAGTTAAAAAGTGATTTTTATGTTATTGGTCTAAGGGACTTCCATCTTGGTCTGAAGTCCTGAGCTCA
GACGCAGGTACTGCCAGCCATACCTTCCTGGTAGCATCTGCTGGACCTAAGTAAGGCATGTCTGTCTAAGGCCAAGTCTGCCCGGCTTAA
GGATGCTGGTTCTGACTCTACCCCACTGCTTCCTTCTGCTCCAGGCCTCAATTTTCCCTTCTTGTAAAATGGAATCTATATCTATAAAGG

>In-frame_KDM5A_ENST00000382815_chr12_430161_-_NINJ2_ENST00000397265_chr12_675344_-_3624nt
GCAGAACTTTGGCGGGCAAGGAGACAAACAGCCACACTGTGCTGCCGGGGAAGAGAAGAAGAAGGAAAGGCCAGACACACAGGCGTCGTG
CAGCTGCGGAAGGATTCCGTTTCCTGCAGGGGGCGGAGGGATTTGACAGCACGGTAACTTCCGGAAAAGTCCTGAACCTCAGTGGAAAAG
CCTTGCAAGAAACAATAACAAACGGGAGGAGGAAGCGATTCTGGGGTTTCTGTGTTGAACGGTTCTTGTCCGCGAAGATGCGCTTCGGCC
TCTGTCAGGGGACTTGAACGGGCTTAGTGGGCTTCAGCCAGCTTTTCTCCACCGGTTCCCCACGGGGACCCCCCCCCCCCCCCGGCCGTT
GCAATGGCGGGCGTGGGGCCGGGGGGCTACGCGGCGGAGTTCGTGCCACCGCCAGAGTGCCCCGTCTTTGAGCCGAGTTGGGAGGAGTTC
ACAGATCCGCTCAGCTTTATCGGCCGCATCCGGCCTTTGGCGGAGAAAACCGGCATCTGCAAAATTCGGCCGCCCAAGGACTGGCAGCCT
CCATTTGCCTGTGAAGTAAAAAGCTTTCGTTTCACTCCAAGAGTCCAGCGCCTGAATGAACTTGAGGCAATGACCAGAGTGAGATTGGAT
TTCTTGGATCAACTAGCAAAATTTTGGGAACTTCAAGGATCTACTCTGAAGATCCCTGTGGTAGAGAGAAAAATCCTGGATCTGTATGCT
TTGAGCAAGATTGTTGCCAGCAAAGGAGGTTTTGAAATGGTCACCAAAGAGAAGAAATGGTCTAAAGTGGGTAGTCGCTTGGGATATCTG
CCAGGAAAAGGAACTGGGTCTCTTTTGAAGTCACATTATGAAAGAATTCTCTACCCATATGAGCTTTTCCAGTCTGGTGTGAGCCTTATG
GGTGTGCAGATGCCTAATTTAGATCTTAAAGAAAAAGTGGAGCCTGAGGTTCTCAGCACTGATACCCAAACTTCCCCAGAGCCAGGCACA
AGGATGAACATTCTGCCGAAGAGAACAAGACGTGTGAAGACTCAGTCAGAATCTGGAGATGTGAGTAGAAACACGGAACTGAAGAAACTT
CAGATTTTTGGGGCTGGGCCCAAGGTTGTGGGCTTGGCAATGGGAACAAAAGATAAAGAAGATGAGGTCACCCGAAGACGAAAAGTTACC
AACAGGTCAGACGCATTTAACATGCAAATGAGACAACGGAAAGGCACTCTCTCTGTTAACTTTGTTGATCTCTATGTTTGTATGTTTTGT
GGTCGGGGAAACAATGAAGATAAATTGCTTTTGTGTGATGGATGTGATGACAGCTATCATACATTTTGTCTAATTCCTCCACTACCTGAT
GTGCCCAAAGGAGACTGGAGGTGTCCTAAATGTGTCGCCGAGGAATGTAGCAAACCTCGAGAAGCCTTTGGATTTGAACAAGCTGTACGA
GAGTATACACTTCAGAGCTTTGGAGAGATGGCAGATAATTTTAAGTCTGATTATTTTAATATGCCAGTCCATATGGTTCCCACAGAACTA
GTAGAAAAGGAATTTTGGCGGCTGGTAAGCAGCATTGAAGAAGATGTTATTGTGGAATATGGAGCAGATATCTCCTCAAAAGACTTTGGA
AGTGGATTTCCGGTGAAGGATGGGCGGAGAAAGATTCTGCCAGAAGAAGAGGAATATGCACTTTCTGGTTGGAATTTGAATAACATGCCT
GTCCTGGAACAGTCTGTTCTTGCACATATTAATGTGGACATCTCTGGTATGAAAGTGCCGTGGCTCTATGTGGGAATGTGCTTCTCTTCT
TTTTGCTGGCACATTGAGGATCACTGGAGTTATTCCATCAACTACTTGCACTGGGGGGAGCCAAAGACATGGTATGGTGTGCCATCTCAT
GCTGCAGAGCAACTGGAGGAGGTGATGAGAGAGCTGGCCCCCGAGTTATTTGAATCCCAGCCTGATCTTCTGCATCAGTTAGTTACCATC
ATGAACCCCAACGTGCTAATGGAGCATGGTGTGCCTGTGTACAGGACCAATCAGTGTGCTGGCGAGTTTGTTGTGACATTTCCTCGTGCC
TATCACTCTGGATTTAACCAGGGCTACAACTTTGCTGAAGCTGTGAACTTCTGTACTGCTGACTGGTTGCCCATTGGACGTCAATGTGTA
AATCATTACCGACGCCTAAGGCGCCACTGTGTCTTTTCACACGAGGAACTAATTTTCAAGATGGCAGCAGATCCAGAATGCTTAGATGTG
GGGCTGGCTGCCATGGTCTGCAAAGAATTGACTCTCATGACTGAAGAAGAAACACGATTAAGAGAGTCTGTTGTACAGATGGGTGTCCTG
ATGTCAGAAGAAGAAGTGTTTGAACTTGTTCCTGATGATGAGCGGCAGTGTTCAGCATGCAGAACCACATGTTTTCTCTCTGCTCTCACA
TGTTCCTGTAATCCTGAGCGGCTTGTATGTCTCTACCATCCAACTGATCTGTGCCCCTGCCCCATGCAGAAGAAATGTCTTAGATATCGC
TACCCATTAGAAGACCTCCCTTCTCTGCTATATGGTGTAAAAGTCAGGGCACAGTCCTATGACACTTGGGTCAGTCGTGTTACAGAAGCA
TTGTCTGCTAACTTCAACCACAAAAAAGATTTGATTGAATTGCGAGTAATGCTGGAAGATGCTGAGGATAGGAAATACCCAGAGAATGAT
CTCTTTCGAAAACTCAGGGATGCTGTAAAAGAAGCTGAGACCTGTGCTTCTGTGGCTCAGCTGCTTCTGAGCAAAAAGCAGAAACACAGA
CAGAGCCCAGATAGTGGGAGGACTCGGACCAAACTGACAGTGGAAGAATTGAAGGCCTTTGTCCAACAACTTTTTAGTCTTCCGTGTGTC
ATCAGCCAAGCTCGGCAAGTAAAGCCTGGAAGCTCCGACCCCAGGAGCCAGCCCATCAACCTGAACCATTACGCCACCAAGAAGAGCGTG
GCGGAGAGCATGCTGGACGTGGCCCTGTTCATGTCCAACGCCATGCGGCTGAAGGCGGTGCTGGAGCAGGGACCATCCTCTCACTACTAC
ACCACCCTGGTCACCCTCATCAGCCTCTCTCTGCTCCTGCAGGTGGTCATCGGTGTCCTGCTCGTGGTCATTGCACGGCTGAACCTGAAT
GAGGTAGAAAAGCAGTGGCGACTCAACCAGCTCAACAACGCAGCCACCATCTTGGTCTTCTTCACTGTGGTCATCAATGTTTTCATTACA
GCCTTCGGGGCACATAAAACAGGGTTCCTGGCTGCCAGGGCCTCAAGGAATCCTCTCTGAATGCAGCCTGGGACCCAGGTTCTGGGCCTG
GAACTTCTGCCTCCTTCCTCCGTGATCTGCCAGGCTCGTGGGCACTTTCCACAGCCCAGGAGAGCTTCTGAAAGGACAGTATAGCTGCCC
TTGCTCCCTACCCACAGCACCTGAGTTAAAAAGTGATTTTTATGTTATTGGTCTAAGGGACTTCCATCTTGGTCTGAAGTCCTGAGCTCA
GACGCAGGTACTGCCAGCCATACCTTCCTGGTAGCATCTGCTGGACCTAAGTAAGGCATGTCTGTCTAAGGCCAAGTCTGCCCGGCTTAA

>In-frame_KDM5A_ENST00000399788_chr12_404739_-_NINJ2_ENST00000305108_chr12_675344_-_5618nt
GCAGAACTTTGGCGGGCAAGGAGACAAACAGCCACACTGTGCTGCCGGGGAAGAGAAGAAGAAGGAAAGGCCAGACACACAGGCGTCGTG
CAGCTGCGGAAGGATTCCGTTTCCTGCAGGGGGCGGAGGGATTTGACAGCACGGTAACTTCCGGAAAAGTCCTGAACCTCAGTGGAAAAG
CCTTGCAAGAAACAATAACAAACGGGAGGAGGAAGCGATTCTGGGGTTTCTGTGTTGAACGGTTCTTGTCCGCGAAGATGCGCTTCGGCC
TCTGTCAGGGGACTTGAACGGGCTTAGTGGGCTTCAGCCAGCTTTTCTCCACCGGTTCCCCACGGGGACCCCCCCCCCCCCCCGGCCGTT
GCAATGGCGGGCGTGGGGCCGGGGGGCTACGCGGCGGAGTTCGTGCCACCGCCAGAGTGCCCCGTCTTTGAGCCGAGTTGGGAGGAGTTC
ACAGATCCGCTCAGCTTTATCGGCCGCATCCGGCCTTTGGCGGAGAAAACCGGCATCTGCAAAATTCGGCCGCCCAAGGACTGGCAGCCT
CCATTTGCCTGTGAAGTAAAAAGCTTTCGTTTCACTCCAAGAGTCCAGCGCCTGAATGAACTTGAGGCAATGACCAGAGTGAGATTGGAT
TTCTTGGATCAACTAGCAAAATTTTGGGAACTTCAAGGATCTACTCTGAAGATCCCTGTGGTAGAGAGAAAAATCCTGGATCTGTATGCT
TTGAGCAAGATTGTTGCCAGCAAAGGAGGTTTTGAAATGGTCACCAAAGAGAAGAAATGGTCTAAAGTGGGTAGTCGCTTGGGATATCTG
CCAGGAAAAGGAACTGGGTCTCTTTTGAAGTCACATTATGAAAGAATTCTCTACCCATATGAGCTTTTCCAGTCTGGTGTGAGCCTTATG
GGTGTGCAGATGCCTAATTTAGATCTTAAAGAAAAAGTGGAGCCTGAGGTTCTCAGCACTGATACCCAAACTTCCCCAGAGCCAGGCACA
AGGATGAACATTCTGCCGAAGAGAACAAGACGTGTGAAGACTCAGTCAGAATCTGGAGATGTGAGTAGAAACACGGAACTGAAGAAACTT
CAGATTTTTGGGGCTGGGCCCAAGGTTGTGGGCTTGGCAATGGGAACAAAAGATAAAGAAGATGAGGTCACCCGAAGACGAAAAGTTACC
AACAGGTCAGACGCATTTAACATGCAAATGAGACAACGGAAAGGCACTCTCTCTGTTAACTTTGTTGATCTCTATGTTTGTATGTTTTGT
GGTCGGGGAAACAATGAAGATAAATTGCTTTTGTGTGATGGATGTGATGACAGCTATCATACATTTTGTCTAATTCCTCCACTACCTGAT
GTGCCCAAAGGAGACTGGAGGTGTCCTAAATGTGTCGCCGAGGAATGTAGCAAACCTCGAGAAGCCTTTGGATTTGAACAAGCTGTACGA
GAGTATACACTTCAGAGCTTTGGAGAGATGGCAGATAATTTTAAGTCTGATTATTTTAATATGCCAGTCCATATGGTTCCCACAGAACTA
GTAGAAAAGGAATTTTGGCGGCTGGTAAGCAGCATTGAAGAAGATGTTATTGTGGAATATGGAGCAGATATCTCCTCAAAAGACTTTGGA
AGTGGATTTCCGGTGAAGGATGGGCGGAGAAAGATTCTGCCAGAAGAAGAGGAATATGCACTTTCTGGTTGGAATTTGAATAACATGCCT
GTCCTGGAACAGTCTGTTCTTGCACATATTAATGTGGACATCTCTGGTATGAAAGTGCCGTGGCTCTATGTGGGAATGTGCTTCTCTTCT
TTTTGCTGGCACATTGAGGATCACTGGAGTTATTCCATCAACTACTTGCACTGGGGGGAGCCAAAGACATGGTATGGTGTGCCATCTCAT
GCTGCAGAGCAACTGGAGGAGGTGATGAGAGAGCTGGCCCCCGAGTTATTTGAATCCCAGCCTGATCTTCTGCATCAGTTAGTTACCATC
ATGAACCCCAACGTGCTAATGGAGCATGGTGTGCCTGTGTACAGGACCAATCAGTGTGCTGGCGAGTTTGTTGTGACATTTCCTCGTGCC
TATCACTCTGGATTTAACCAGGGCTACAACTTTGCTGAAGCTGTGAACTTCTGTACTGCTGACTGGTTGCCCATTGGACGTCAATGTGTA
AATCATTACCGACGCCTAAGGCGCCACTGTGTCTTTTCACACGAGGAACTAATTTTCAAGATGGCAGCAGATCCAGAATGCTTAGATGTG
GGGCTGGCTGCCATGGTCTGCAAAGAATTGACTCTCATGACTGAAGAAGAAACACGATTAAGAGAGTCTGTTGTACAGATGGGTGTCCTG
ATGTCAGAAGAAGAAGTGTTTGAACTTGTTCCTGATGATGAGCGGCAGTGTTCAGCATGCAGAACCACATGTTTTCTCTCTGCTCTCACA
TGTTCCTGTAATCCTGAGCGGCTTGTATGTCTCTACCATCCAACTGATCTGTGCCCCTGCCCCATGCAGAAGAAATGTCTTAGATATCGC
TACCCATTAGAAGACCTCCCTTCTCTGCTATATGGTGTAAAAGTCAGGGCACAGTCCTATGACACTTGGGTCAGTCGTGTTACAGAAGCA
TTGTCTGCTAACTTCAACCACAAAAAAGATTTGATTGAATTGCGAGTAATGCTGGAAGATGCTGAGGATAGGAAATACCCAGAGAATGAT
CTCTTTCGAAAACTCAGGGATGCTGTAAAAGAAGCTGAGACCTGTGCTTCTGTGGCTCAGCTGCTTCTGAGCAAAAAGCAGAAACACAGA
CAGAGCCCAGATAGTGGGAGGACTCGGACCAAACTGACAGTGGAAGAATTGAAGGCCTTTGTCCAACAACTTTTTAGTCTTCCGTGTGTC
ATCAGCCAAGCTCGGCAAGTAAAGAATCTGCTAGATGATGTGGAAGAGTTTCATGAACGTGCTCAGGAGGCCATGATGGATGAAACCCCA
GATTCTTCCAAACTCCAGATGTTGATAGATATGGGCTCTAGTCTCTATGTGGAACTCCCTGAATTACCACGACTGAAGCAAGAGCTACAA
CAGGCTCGGTGGTTGGACGAAGTAAGACTGACCTTATCAGATCCGCAACAAGTCACTTTGGATGTCATGAAGAAGCTGATAGACTCTGGG
GTAGGGTTGGCACCCCACCATGCTGTGGAGAAAGCAATGGCTGAACTACAGGAGCTCCTTACAGTCTCTGAACGATGGGAAGAAAAGGCT
AAGGTCTGCCTACAGGCAAGACCGAGGCACAGTGTGGCAAGTTTAGAAAGCATTGTGAATGAAGCCAAGAACATTCCAGCCTTTCTACCC
AATGTGTTGTCCTTGAAAGAAGCCTTACAAAAGGCTCGAGAATGGACCGCTAAAGTGGAAGCTATTCAGAGTGGCAGCAATTACGCTTAT
TTGGAGCAGCTTGAGAGCTTGTCTGCGAAAGGACGCCCTATTCCTGTGCGTCTTGAAGCACTGCCGCAAGTGGAATCACAGGTAGCAGCA
GCACGGGCATGGAGAGAACGGACTGGGCGGACGTTTCTTAAGAAGAATTCTAGCCATACATTGTTACAGGTGCTGAGCCCCCGGACCGAC
ATTGGTGTATATGGGAGTGGCAAAAATAGGAGGAAAAAAGTAAAAGAACTAATAGAAAAAGAAAAAGAAAAGGATCTGGACCTGGAGCCT
CTGAGTGATCTGGAGGAAGGATTGGAGGAAACCAGAGATACAGCCATGGTGGTGGCAGTTTTCAAAGAACGGGAGCAAAAAGAGATTGAA
GCCATGCATTCTCTCAGAGCAGCCAACCTAGCCAAGATGACAATGGTGGACCGCATAGAAGAAGTAAAATTTTGCATTTGCCGCAAGACA
GCCAGTGGGTTTATGCTACAGTGTGAGCTCTGCAAAGACTGGTTCCATAACAGCTGTGTTCCTCTTCCTAAATCAAGTTCCCAAAAAAAA
GGATCCAGCTGGCAAGCTAAAGAAGTAAAATTCCTTTGCCCTCTTTGTATGCGGTCTCGAAGGCCCAGGCTAGAGACTATTCTGTCACTC
CTGGTATCCCTTCAGAAGTTGCCCGTACGGTTGCCTGAAGGAGAGGCCCTGCAGTGTTTGACAGAACGTGCTATGAGTTGGCAAGATAGA
GCGCGGCAGGCTCTAGCCACAGATGAACTATCCTCTGCCCTGGCCAAACTATCTGTGTTGAGCCAGCGTATGGTGGAACAGGCGGCTCGA
GAAAAAACTGAAAAGATCATCAGTGCAGAACTCCAAAAAGCAGCTGCCAATCCAGACTTACAGGGACACTTACCTAGTTTCCAGCAGTCT
GCTTTTAACCGGGTGGTGAGCAGTGTGTCATCTTCTCCTCGACAAACAATGGACTATGATGATGAAGAAACAGACTCTGATGAAGACATT
CGAGAGACATATGGCTACGACATGAAGGACACAGCCAGTGTGAAGTCCTCTAGTAGTCTTGAACCCAATCTTTTTTGTGATGAAGAGATT
CCCATCAAATCCGAGGAGGTGGTGACCCACATGTGGACAGCACCTTCATTTTGTGCAGAGCATGCTTATTCTTCTGCTTCTAAGAGTTGT
TCTCAAGGTTCTAGCACCCCAAGGAAACAACCTCGGAAGAGCCCTTTGGTGCCCCGAAGTTTGGAACCTCCAGTGCTGGAGTTGTCACCT
GGAGCTAAGGCACAACTGGAAGAACTTATGATGGTTGGAGATCTCCTGGAAGTATCTCTGGACGAGACTCAACACATATGGCGGATTTTG
CAGGCCACACACCCACCCTCTGAAGACAGATTCTTGCATATCATGGAGCCTGGAAGCTCCGACCCCAGGAGCCAGCCCATCAACCTGAAC
CATTACGCCACCAAGAAGAGCGTGGCGGAGAGCATGCTGGACGTGGCCCTGTTCATGTCCAACGCCATGCGGCTGAAGGCGGTGCTGGAG
CAGGGACCATCCTCTCACTACTACACCACCCTGGTCACCCTCATCAGCCTCTCTCTGCTCCTGCAGGTGGTCATCGGTGTCCTGCTCGTG
GTCATTGCACGGCTGAACCTGAATGAGGTAGAAAAGCAGTGGCGACTCAACCAGCTCAACAACGCAGCCACCATCTTGGTCTTCTTCACT
GTGGTCATCAATGTTTTCATTACAGCCTTCGGGGCACATAAAACAGGGTTCCTGGCTGCCAGGGCCTCAAGGAATCCTCTCTGAATGCAG
CCTGGGACCCAGGTTCTGGGCCTGGAACTTCTGCCTCCTTCCTCCGTGATCTGCCAGGCTCGTGGGCACTTTCCACAGCCCAGGAGAGCT
TCTGAAAGGACAGTATAGCTGCCCTTGCTCCCTACCCACAGCACCTGAGTTAAAAAGTGATTTTTATGTTATTGGTCTAAGGGACTTCCA
TCTTGGTCTGAAGTCCTGAGCTCAGACGCAGGTACTGCCAGCCATACCTTCCTGGTAGCATCTGCTGGACCTAAGTAAGGCATGTCTGTC
TAAGGCCAAGTCTGCCCGGCTTAAGGATGCTGGTTCTGACTCTACCCCACTGCTTCCTTCTGCTCCAGGCCTCAATTTTCCCTTCTTGTA

>In-frame_KDM5A_ENST00000399788_chr12_404739_-_NINJ2_ENST00000397265_chr12_675344_-_5538nt
GCAGAACTTTGGCGGGCAAGGAGACAAACAGCCACACTGTGCTGCCGGGGAAGAGAAGAAGAAGGAAAGGCCAGACACACAGGCGTCGTG
CAGCTGCGGAAGGATTCCGTTTCCTGCAGGGGGCGGAGGGATTTGACAGCACGGTAACTTCCGGAAAAGTCCTGAACCTCAGTGGAAAAG
CCTTGCAAGAAACAATAACAAACGGGAGGAGGAAGCGATTCTGGGGTTTCTGTGTTGAACGGTTCTTGTCCGCGAAGATGCGCTTCGGCC
TCTGTCAGGGGACTTGAACGGGCTTAGTGGGCTTCAGCCAGCTTTTCTCCACCGGTTCCCCACGGGGACCCCCCCCCCCCCCCGGCCGTT
GCAATGGCGGGCGTGGGGCCGGGGGGCTACGCGGCGGAGTTCGTGCCACCGCCAGAGTGCCCCGTCTTTGAGCCGAGTTGGGAGGAGTTC
ACAGATCCGCTCAGCTTTATCGGCCGCATCCGGCCTTTGGCGGAGAAAACCGGCATCTGCAAAATTCGGCCGCCCAAGGACTGGCAGCCT
CCATTTGCCTGTGAAGTAAAAAGCTTTCGTTTCACTCCAAGAGTCCAGCGCCTGAATGAACTTGAGGCAATGACCAGAGTGAGATTGGAT
TTCTTGGATCAACTAGCAAAATTTTGGGAACTTCAAGGATCTACTCTGAAGATCCCTGTGGTAGAGAGAAAAATCCTGGATCTGTATGCT
TTGAGCAAGATTGTTGCCAGCAAAGGAGGTTTTGAAATGGTCACCAAAGAGAAGAAATGGTCTAAAGTGGGTAGTCGCTTGGGATATCTG
CCAGGAAAAGGAACTGGGTCTCTTTTGAAGTCACATTATGAAAGAATTCTCTACCCATATGAGCTTTTCCAGTCTGGTGTGAGCCTTATG
GGTGTGCAGATGCCTAATTTAGATCTTAAAGAAAAAGTGGAGCCTGAGGTTCTCAGCACTGATACCCAAACTTCCCCAGAGCCAGGCACA
AGGATGAACATTCTGCCGAAGAGAACAAGACGTGTGAAGACTCAGTCAGAATCTGGAGATGTGAGTAGAAACACGGAACTGAAGAAACTT
CAGATTTTTGGGGCTGGGCCCAAGGTTGTGGGCTTGGCAATGGGAACAAAAGATAAAGAAGATGAGGTCACCCGAAGACGAAAAGTTACC
AACAGGTCAGACGCATTTAACATGCAAATGAGACAACGGAAAGGCACTCTCTCTGTTAACTTTGTTGATCTCTATGTTTGTATGTTTTGT
GGTCGGGGAAACAATGAAGATAAATTGCTTTTGTGTGATGGATGTGATGACAGCTATCATACATTTTGTCTAATTCCTCCACTACCTGAT
GTGCCCAAAGGAGACTGGAGGTGTCCTAAATGTGTCGCCGAGGAATGTAGCAAACCTCGAGAAGCCTTTGGATTTGAACAAGCTGTACGA
GAGTATACACTTCAGAGCTTTGGAGAGATGGCAGATAATTTTAAGTCTGATTATTTTAATATGCCAGTCCATATGGTTCCCACAGAACTA
GTAGAAAAGGAATTTTGGCGGCTGGTAAGCAGCATTGAAGAAGATGTTATTGTGGAATATGGAGCAGATATCTCCTCAAAAGACTTTGGA
AGTGGATTTCCGGTGAAGGATGGGCGGAGAAAGATTCTGCCAGAAGAAGAGGAATATGCACTTTCTGGTTGGAATTTGAATAACATGCCT
GTCCTGGAACAGTCTGTTCTTGCACATATTAATGTGGACATCTCTGGTATGAAAGTGCCGTGGCTCTATGTGGGAATGTGCTTCTCTTCT
TTTTGCTGGCACATTGAGGATCACTGGAGTTATTCCATCAACTACTTGCACTGGGGGGAGCCAAAGACATGGTATGGTGTGCCATCTCAT
GCTGCAGAGCAACTGGAGGAGGTGATGAGAGAGCTGGCCCCCGAGTTATTTGAATCCCAGCCTGATCTTCTGCATCAGTTAGTTACCATC
ATGAACCCCAACGTGCTAATGGAGCATGGTGTGCCTGTGTACAGGACCAATCAGTGTGCTGGCGAGTTTGTTGTGACATTTCCTCGTGCC
TATCACTCTGGATTTAACCAGGGCTACAACTTTGCTGAAGCTGTGAACTTCTGTACTGCTGACTGGTTGCCCATTGGACGTCAATGTGTA
AATCATTACCGACGCCTAAGGCGCCACTGTGTCTTTTCACACGAGGAACTAATTTTCAAGATGGCAGCAGATCCAGAATGCTTAGATGTG
GGGCTGGCTGCCATGGTCTGCAAAGAATTGACTCTCATGACTGAAGAAGAAACACGATTAAGAGAGTCTGTTGTACAGATGGGTGTCCTG
ATGTCAGAAGAAGAAGTGTTTGAACTTGTTCCTGATGATGAGCGGCAGTGTTCAGCATGCAGAACCACATGTTTTCTCTCTGCTCTCACA
TGTTCCTGTAATCCTGAGCGGCTTGTATGTCTCTACCATCCAACTGATCTGTGCCCCTGCCCCATGCAGAAGAAATGTCTTAGATATCGC
TACCCATTAGAAGACCTCCCTTCTCTGCTATATGGTGTAAAAGTCAGGGCACAGTCCTATGACACTTGGGTCAGTCGTGTTACAGAAGCA
TTGTCTGCTAACTTCAACCACAAAAAAGATTTGATTGAATTGCGAGTAATGCTGGAAGATGCTGAGGATAGGAAATACCCAGAGAATGAT
CTCTTTCGAAAACTCAGGGATGCTGTAAAAGAAGCTGAGACCTGTGCTTCTGTGGCTCAGCTGCTTCTGAGCAAAAAGCAGAAACACAGA
CAGAGCCCAGATAGTGGGAGGACTCGGACCAAACTGACAGTGGAAGAATTGAAGGCCTTTGTCCAACAACTTTTTAGTCTTCCGTGTGTC
ATCAGCCAAGCTCGGCAAGTAAAGAATCTGCTAGATGATGTGGAAGAGTTTCATGAACGTGCTCAGGAGGCCATGATGGATGAAACCCCA
GATTCTTCCAAACTCCAGATGTTGATAGATATGGGCTCTAGTCTCTATGTGGAACTCCCTGAATTACCACGACTGAAGCAAGAGCTACAA
CAGGCTCGGTGGTTGGACGAAGTAAGACTGACCTTATCAGATCCGCAACAAGTCACTTTGGATGTCATGAAGAAGCTGATAGACTCTGGG
GTAGGGTTGGCACCCCACCATGCTGTGGAGAAAGCAATGGCTGAACTACAGGAGCTCCTTACAGTCTCTGAACGATGGGAAGAAAAGGCT
AAGGTCTGCCTACAGGCAAGACCGAGGCACAGTGTGGCAAGTTTAGAAAGCATTGTGAATGAAGCCAAGAACATTCCAGCCTTTCTACCC
AATGTGTTGTCCTTGAAAGAAGCCTTACAAAAGGCTCGAGAATGGACCGCTAAAGTGGAAGCTATTCAGAGTGGCAGCAATTACGCTTAT
TTGGAGCAGCTTGAGAGCTTGTCTGCGAAAGGACGCCCTATTCCTGTGCGTCTTGAAGCACTGCCGCAAGTGGAATCACAGGTAGCAGCA
GCACGGGCATGGAGAGAACGGACTGGGCGGACGTTTCTTAAGAAGAATTCTAGCCATACATTGTTACAGGTGCTGAGCCCCCGGACCGAC
ATTGGTGTATATGGGAGTGGCAAAAATAGGAGGAAAAAAGTAAAAGAACTAATAGAAAAAGAAAAAGAAAAGGATCTGGACCTGGAGCCT
CTGAGTGATCTGGAGGAAGGATTGGAGGAAACCAGAGATACAGCCATGGTGGTGGCAGTTTTCAAAGAACGGGAGCAAAAAGAGATTGAA
GCCATGCATTCTCTCAGAGCAGCCAACCTAGCCAAGATGACAATGGTGGACCGCATAGAAGAAGTAAAATTTTGCATTTGCCGCAAGACA
GCCAGTGGGTTTATGCTACAGTGTGAGCTCTGCAAAGACTGGTTCCATAACAGCTGTGTTCCTCTTCCTAAATCAAGTTCCCAAAAAAAA
GGATCCAGCTGGCAAGCTAAAGAAGTAAAATTCCTTTGCCCTCTTTGTATGCGGTCTCGAAGGCCCAGGCTAGAGACTATTCTGTCACTC
CTGGTATCCCTTCAGAAGTTGCCCGTACGGTTGCCTGAAGGAGAGGCCCTGCAGTGTTTGACAGAACGTGCTATGAGTTGGCAAGATAGA
GCGCGGCAGGCTCTAGCCACAGATGAACTATCCTCTGCCCTGGCCAAACTATCTGTGTTGAGCCAGCGTATGGTGGAACAGGCGGCTCGA
GAAAAAACTGAAAAGATCATCAGTGCAGAACTCCAAAAAGCAGCTGCCAATCCAGACTTACAGGGACACTTACCTAGTTTCCAGCAGTCT
GCTTTTAACCGGGTGGTGAGCAGTGTGTCATCTTCTCCTCGACAAACAATGGACTATGATGATGAAGAAACAGACTCTGATGAAGACATT
CGAGAGACATATGGCTACGACATGAAGGACACAGCCAGTGTGAAGTCCTCTAGTAGTCTTGAACCCAATCTTTTTTGTGATGAAGAGATT
CCCATCAAATCCGAGGAGGTGGTGACCCACATGTGGACAGCACCTTCATTTTGTGCAGAGCATGCTTATTCTTCTGCTTCTAAGAGTTGT
TCTCAAGGTTCTAGCACCCCAAGGAAACAACCTCGGAAGAGCCCTTTGGTGCCCCGAAGTTTGGAACCTCCAGTGCTGGAGTTGTCACCT
GGAGCTAAGGCACAACTGGAAGAACTTATGATGGTTGGAGATCTCCTGGAAGTATCTCTGGACGAGACTCAACACATATGGCGGATTTTG
CAGGCCACACACCCACCCTCTGAAGACAGATTCTTGCATATCATGGAGCCTGGAAGCTCCGACCCCAGGAGCCAGCCCATCAACCTGAAC
CATTACGCCACCAAGAAGAGCGTGGCGGAGAGCATGCTGGACGTGGCCCTGTTCATGTCCAACGCCATGCGGCTGAAGGCGGTGCTGGAG
CAGGGACCATCCTCTCACTACTACACCACCCTGGTCACCCTCATCAGCCTCTCTCTGCTCCTGCAGGTGGTCATCGGTGTCCTGCTCGTG
GTCATTGCACGGCTGAACCTGAATGAGGTAGAAAAGCAGTGGCGACTCAACCAGCTCAACAACGCAGCCACCATCTTGGTCTTCTTCACT
GTGGTCATCAATGTTTTCATTACAGCCTTCGGGGCACATAAAACAGGGTTCCTGGCTGCCAGGGCCTCAAGGAATCCTCTCTGAATGCAG
CCTGGGACCCAGGTTCTGGGCCTGGAACTTCTGCCTCCTTCCTCCGTGATCTGCCAGGCTCGTGGGCACTTTCCACAGCCCAGGAGAGCT
TCTGAAAGGACAGTATAGCTGCCCTTGCTCCCTACCCACAGCACCTGAGTTAAAAAGTGATTTTTATGTTATTGGTCTAAGGGACTTCCA
TCTTGGTCTGAAGTCCTGAGCTCAGACGCAGGTACTGCCAGCCATACCTTCCTGGTAGCATCTGCTGGACCTAAGTAAGGCATGTCTGTC

>In-frame_KDM5A_ENST00000382815_chr12_404739_-_NINJ2_ENST00000305108_chr12_675344_-_5618nt
GCAGAACTTTGGCGGGCAAGGAGACAAACAGCCACACTGTGCTGCCGGGGAAGAGAAGAAGAAGGAAAGGCCAGACACACAGGCGTCGTG
CAGCTGCGGAAGGATTCCGTTTCCTGCAGGGGGCGGAGGGATTTGACAGCACGGTAACTTCCGGAAAAGTCCTGAACCTCAGTGGAAAAG
CCTTGCAAGAAACAATAACAAACGGGAGGAGGAAGCGATTCTGGGGTTTCTGTGTTGAACGGTTCTTGTCCGCGAAGATGCGCTTCGGCC
TCTGTCAGGGGACTTGAACGGGCTTAGTGGGCTTCAGCCAGCTTTTCTCCACCGGTTCCCCACGGGGACCCCCCCCCCCCCCCGGCCGTT
GCAATGGCGGGCGTGGGGCCGGGGGGCTACGCGGCGGAGTTCGTGCCACCGCCAGAGTGCCCCGTCTTTGAGCCGAGTTGGGAGGAGTTC
ACAGATCCGCTCAGCTTTATCGGCCGCATCCGGCCTTTGGCGGAGAAAACCGGCATCTGCAAAATTCGGCCGCCCAAGGACTGGCAGCCT
CCATTTGCCTGTGAAGTAAAAAGCTTTCGTTTCACTCCAAGAGTCCAGCGCCTGAATGAACTTGAGGCAATGACCAGAGTGAGATTGGAT
TTCTTGGATCAACTAGCAAAATTTTGGGAACTTCAAGGATCTACTCTGAAGATCCCTGTGGTAGAGAGAAAAATCCTGGATCTGTATGCT
TTGAGCAAGATTGTTGCCAGCAAAGGAGGTTTTGAAATGGTCACCAAAGAGAAGAAATGGTCTAAAGTGGGTAGTCGCTTGGGATATCTG
CCAGGAAAAGGAACTGGGTCTCTTTTGAAGTCACATTATGAAAGAATTCTCTACCCATATGAGCTTTTCCAGTCTGGTGTGAGCCTTATG
GGTGTGCAGATGCCTAATTTAGATCTTAAAGAAAAAGTGGAGCCTGAGGTTCTCAGCACTGATACCCAAACTTCCCCAGAGCCAGGCACA
AGGATGAACATTCTGCCGAAGAGAACAAGACGTGTGAAGACTCAGTCAGAATCTGGAGATGTGAGTAGAAACACGGAACTGAAGAAACTT
CAGATTTTTGGGGCTGGGCCCAAGGTTGTGGGCTTGGCAATGGGAACAAAAGATAAAGAAGATGAGGTCACCCGAAGACGAAAAGTTACC
AACAGGTCAGACGCATTTAACATGCAAATGAGACAACGGAAAGGCACTCTCTCTGTTAACTTTGTTGATCTCTATGTTTGTATGTTTTGT
GGTCGGGGAAACAATGAAGATAAATTGCTTTTGTGTGATGGATGTGATGACAGCTATCATACATTTTGTCTAATTCCTCCACTACCTGAT
GTGCCCAAAGGAGACTGGAGGTGTCCTAAATGTGTCGCCGAGGAATGTAGCAAACCTCGAGAAGCCTTTGGATTTGAACAAGCTGTACGA
GAGTATACACTTCAGAGCTTTGGAGAGATGGCAGATAATTTTAAGTCTGATTATTTTAATATGCCAGTCCATATGGTTCCCACAGAACTA
GTAGAAAAGGAATTTTGGCGGCTGGTAAGCAGCATTGAAGAAGATGTTATTGTGGAATATGGAGCAGATATCTCCTCAAAAGACTTTGGA
AGTGGATTTCCGGTGAAGGATGGGCGGAGAAAGATTCTGCCAGAAGAAGAGGAATATGCACTTTCTGGTTGGAATTTGAATAACATGCCT
GTCCTGGAACAGTCTGTTCTTGCACATATTAATGTGGACATCTCTGGTATGAAAGTGCCGTGGCTCTATGTGGGAATGTGCTTCTCTTCT
TTTTGCTGGCACATTGAGGATCACTGGAGTTATTCCATCAACTACTTGCACTGGGGGGAGCCAAAGACATGGTATGGTGTGCCATCTCAT
GCTGCAGAGCAACTGGAGGAGGTGATGAGAGAGCTGGCCCCCGAGTTATTTGAATCCCAGCCTGATCTTCTGCATCAGTTAGTTACCATC
ATGAACCCCAACGTGCTAATGGAGCATGGTGTGCCTGTGTACAGGACCAATCAGTGTGCTGGCGAGTTTGTTGTGACATTTCCTCGTGCC
TATCACTCTGGATTTAACCAGGGCTACAACTTTGCTGAAGCTGTGAACTTCTGTACTGCTGACTGGTTGCCCATTGGACGTCAATGTGTA
AATCATTACCGACGCCTAAGGCGCCACTGTGTCTTTTCACACGAGGAACTAATTTTCAAGATGGCAGCAGATCCAGAATGCTTAGATGTG
GGGCTGGCTGCCATGGTCTGCAAAGAATTGACTCTCATGACTGAAGAAGAAACACGATTAAGAGAGTCTGTTGTACAGATGGGTGTCCTG
ATGTCAGAAGAAGAAGTGTTTGAACTTGTTCCTGATGATGAGCGGCAGTGTTCAGCATGCAGAACCACATGTTTTCTCTCTGCTCTCACA
TGTTCCTGTAATCCTGAGCGGCTTGTATGTCTCTACCATCCAACTGATCTGTGCCCCTGCCCCATGCAGAAGAAATGTCTTAGATATCGC
TACCCATTAGAAGACCTCCCTTCTCTGCTATATGGTGTAAAAGTCAGGGCACAGTCCTATGACACTTGGGTCAGTCGTGTTACAGAAGCA
TTGTCTGCTAACTTCAACCACAAAAAAGATTTGATTGAATTGCGAGTAATGCTGGAAGATGCTGAGGATAGGAAATACCCAGAGAATGAT
CTCTTTCGAAAACTCAGGGATGCTGTAAAAGAAGCTGAGACCTGTGCTTCTGTGGCTCAGCTGCTTCTGAGCAAAAAGCAGAAACACAGA
CAGAGCCCAGATAGTGGGAGGACTCGGACCAAACTGACAGTGGAAGAATTGAAGGCCTTTGTCCAACAACTTTTTAGTCTTCCGTGTGTC
ATCAGCCAAGCTCGGCAAGTAAAGAATCTGCTAGATGATGTGGAAGAGTTTCATGAACGTGCTCAGGAGGCCATGATGGATGAAACCCCA
GATTCTTCCAAACTCCAGATGTTGATAGATATGGGCTCTAGTCTCTATGTGGAACTCCCTGAATTACCACGACTGAAGCAAGAGCTACAA
CAGGCTCGGTGGTTGGACGAAGTAAGACTGACCTTATCAGATCCGCAACAAGTCACTTTGGATGTCATGAAGAAGCTGATAGACTCTGGG
GTAGGGTTGGCACCCCACCATGCTGTGGAGAAAGCAATGGCTGAACTACAGGAGCTCCTTACAGTCTCTGAACGATGGGAAGAAAAGGCT
AAGGTCTGCCTACAGGCAAGACCGAGGCACAGTGTGGCAAGTTTAGAAAGCATTGTGAATGAAGCCAAGAACATTCCAGCCTTTCTACCC
AATGTGTTGTCCTTGAAAGAAGCCTTACAAAAGGCTCGAGAATGGACCGCTAAAGTGGAAGCTATTCAGAGTGGCAGCAATTACGCTTAT
TTGGAGCAGCTTGAGAGCTTGTCTGCGAAAGGACGCCCTATTCCTGTGCGTCTTGAAGCACTGCCGCAAGTGGAATCACAGGTAGCAGCA
GCACGGGCATGGAGAGAACGGACTGGGCGGACGTTTCTTAAGAAGAATTCTAGCCATACATTGTTACAGGTGCTGAGCCCCCGGACCGAC
ATTGGTGTATATGGGAGTGGCAAAAATAGGAGGAAAAAAGTAAAAGAACTAATAGAAAAAGAAAAAGAAAAGGATCTGGACCTGGAGCCT
CTGAGTGATCTGGAGGAAGGATTGGAGGAAACCAGAGATACAGCCATGGTGGTGGCAGTTTTCAAAGAACGGGAGCAAAAAGAGATTGAA
GCCATGCATTCTCTCAGAGCAGCCAACCTAGCCAAGATGACAATGGTGGACCGCATAGAAGAAGTAAAATTTTGCATTTGCCGCAAGACA
GCCAGTGGGTTTATGCTACAGTGTGAGCTCTGCAAAGACTGGTTCCATAACAGCTGTGTTCCTCTTCCTAAATCAAGTTCCCAAAAAAAA
GGATCCAGCTGGCAAGCTAAAGAAGTAAAATTCCTTTGCCCTCTTTGTATGCGGTCTCGAAGGCCCAGGCTAGAGACTATTCTGTCACTC
CTGGTATCCCTTCAGAAGTTGCCCGTACGGTTGCCTGAAGGAGAGGCCCTGCAGTGTTTGACAGAACGTGCTATGAGTTGGCAAGATAGA
GCGCGGCAGGCTCTAGCCACAGATGAACTATCCTCTGCCCTGGCCAAACTATCTGTGTTGAGCCAGCGTATGGTGGAACAGGCGGCTCGA
GAAAAAACTGAAAAGATCATCAGTGCAGAACTCCAAAAAGCAGCTGCCAATCCAGACTTACAGGGACACTTACCTAGTTTCCAGCAGTCT
GCTTTTAACCGGGTGGTGAGCAGTGTGTCATCTTCTCCTCGACAAACAATGGACTATGATGATGAAGAAACAGACTCTGATGAAGACATT
CGAGAGACATATGGCTACGACATGAAGGACACAGCCAGTGTGAAGTCCTCTAGTAGTCTTGAACCCAATCTTTTTTGTGATGAAGAGATT
CCCATCAAATCCGAGGAGGTGGTGACCCACATGTGGACAGCACCTTCATTTTGTGCAGAGCATGCTTATTCTTCTGCTTCTAAGAGTTGT
TCTCAAGGTTCTAGCACCCCAAGGAAACAACCTCGGAAGAGCCCTTTGGTGCCCCGAAGTTTGGAACCTCCAGTGCTGGAGTTGTCACCT
GGAGCTAAGGCACAACTGGAAGAACTTATGATGGTTGGAGATCTCCTGGAAGTATCTCTGGACGAGACTCAACACATATGGCGGATTTTG
CAGGCCACACACCCACCCTCTGAAGACAGATTCTTGCATATCATGGAGCCTGGAAGCTCCGACCCCAGGAGCCAGCCCATCAACCTGAAC
CATTACGCCACCAAGAAGAGCGTGGCGGAGAGCATGCTGGACGTGGCCCTGTTCATGTCCAACGCCATGCGGCTGAAGGCGGTGCTGGAG
CAGGGACCATCCTCTCACTACTACACCACCCTGGTCACCCTCATCAGCCTCTCTCTGCTCCTGCAGGTGGTCATCGGTGTCCTGCTCGTG
GTCATTGCACGGCTGAACCTGAATGAGGTAGAAAAGCAGTGGCGACTCAACCAGCTCAACAACGCAGCCACCATCTTGGTCTTCTTCACT
GTGGTCATCAATGTTTTCATTACAGCCTTCGGGGCACATAAAACAGGGTTCCTGGCTGCCAGGGCCTCAAGGAATCCTCTCTGAATGCAG
CCTGGGACCCAGGTTCTGGGCCTGGAACTTCTGCCTCCTTCCTCCGTGATCTGCCAGGCTCGTGGGCACTTTCCACAGCCCAGGAGAGCT
TCTGAAAGGACAGTATAGCTGCCCTTGCTCCCTACCCACAGCACCTGAGTTAAAAAGTGATTTTTATGTTATTGGTCTAAGGGACTTCCA
TCTTGGTCTGAAGTCCTGAGCTCAGACGCAGGTACTGCCAGCCATACCTTCCTGGTAGCATCTGCTGGACCTAAGTAAGGCATGTCTGTC
TAAGGCCAAGTCTGCCCGGCTTAAGGATGCTGGTTCTGACTCTACCCCACTGCTTCCTTCTGCTCCAGGCCTCAATTTTCCCTTCTTGTA

>In-frame_KDM5A_ENST00000382815_chr12_404739_-_NINJ2_ENST00000397265_chr12_675344_-_5538nt
GCAGAACTTTGGCGGGCAAGGAGACAAACAGCCACACTGTGCTGCCGGGGAAGAGAAGAAGAAGGAAAGGCCAGACACACAGGCGTCGTG
CAGCTGCGGAAGGATTCCGTTTCCTGCAGGGGGCGGAGGGATTTGACAGCACGGTAACTTCCGGAAAAGTCCTGAACCTCAGTGGAAAAG
CCTTGCAAGAAACAATAACAAACGGGAGGAGGAAGCGATTCTGGGGTTTCTGTGTTGAACGGTTCTTGTCCGCGAAGATGCGCTTCGGCC
TCTGTCAGGGGACTTGAACGGGCTTAGTGGGCTTCAGCCAGCTTTTCTCCACCGGTTCCCCACGGGGACCCCCCCCCCCCCCCGGCCGTT
GCAATGGCGGGCGTGGGGCCGGGGGGCTACGCGGCGGAGTTCGTGCCACCGCCAGAGTGCCCCGTCTTTGAGCCGAGTTGGGAGGAGTTC
ACAGATCCGCTCAGCTTTATCGGCCGCATCCGGCCTTTGGCGGAGAAAACCGGCATCTGCAAAATTCGGCCGCCCAAGGACTGGCAGCCT
CCATTTGCCTGTGAAGTAAAAAGCTTTCGTTTCACTCCAAGAGTCCAGCGCCTGAATGAACTTGAGGCAATGACCAGAGTGAGATTGGAT
TTCTTGGATCAACTAGCAAAATTTTGGGAACTTCAAGGATCTACTCTGAAGATCCCTGTGGTAGAGAGAAAAATCCTGGATCTGTATGCT
TTGAGCAAGATTGTTGCCAGCAAAGGAGGTTTTGAAATGGTCACCAAAGAGAAGAAATGGTCTAAAGTGGGTAGTCGCTTGGGATATCTG
CCAGGAAAAGGAACTGGGTCTCTTTTGAAGTCACATTATGAAAGAATTCTCTACCCATATGAGCTTTTCCAGTCTGGTGTGAGCCTTATG
GGTGTGCAGATGCCTAATTTAGATCTTAAAGAAAAAGTGGAGCCTGAGGTTCTCAGCACTGATACCCAAACTTCCCCAGAGCCAGGCACA
AGGATGAACATTCTGCCGAAGAGAACAAGACGTGTGAAGACTCAGTCAGAATCTGGAGATGTGAGTAGAAACACGGAACTGAAGAAACTT
CAGATTTTTGGGGCTGGGCCCAAGGTTGTGGGCTTGGCAATGGGAACAAAAGATAAAGAAGATGAGGTCACCCGAAGACGAAAAGTTACC
AACAGGTCAGACGCATTTAACATGCAAATGAGACAACGGAAAGGCACTCTCTCTGTTAACTTTGTTGATCTCTATGTTTGTATGTTTTGT
GGTCGGGGAAACAATGAAGATAAATTGCTTTTGTGTGATGGATGTGATGACAGCTATCATACATTTTGTCTAATTCCTCCACTACCTGAT
GTGCCCAAAGGAGACTGGAGGTGTCCTAAATGTGTCGCCGAGGAATGTAGCAAACCTCGAGAAGCCTTTGGATTTGAACAAGCTGTACGA
GAGTATACACTTCAGAGCTTTGGAGAGATGGCAGATAATTTTAAGTCTGATTATTTTAATATGCCAGTCCATATGGTTCCCACAGAACTA
GTAGAAAAGGAATTTTGGCGGCTGGTAAGCAGCATTGAAGAAGATGTTATTGTGGAATATGGAGCAGATATCTCCTCAAAAGACTTTGGA
AGTGGATTTCCGGTGAAGGATGGGCGGAGAAAGATTCTGCCAGAAGAAGAGGAATATGCACTTTCTGGTTGGAATTTGAATAACATGCCT
GTCCTGGAACAGTCTGTTCTTGCACATATTAATGTGGACATCTCTGGTATGAAAGTGCCGTGGCTCTATGTGGGAATGTGCTTCTCTTCT
TTTTGCTGGCACATTGAGGATCACTGGAGTTATTCCATCAACTACTTGCACTGGGGGGAGCCAAAGACATGGTATGGTGTGCCATCTCAT
GCTGCAGAGCAACTGGAGGAGGTGATGAGAGAGCTGGCCCCCGAGTTATTTGAATCCCAGCCTGATCTTCTGCATCAGTTAGTTACCATC
ATGAACCCCAACGTGCTAATGGAGCATGGTGTGCCTGTGTACAGGACCAATCAGTGTGCTGGCGAGTTTGTTGTGACATTTCCTCGTGCC
TATCACTCTGGATTTAACCAGGGCTACAACTTTGCTGAAGCTGTGAACTTCTGTACTGCTGACTGGTTGCCCATTGGACGTCAATGTGTA
AATCATTACCGACGCCTAAGGCGCCACTGTGTCTTTTCACACGAGGAACTAATTTTCAAGATGGCAGCAGATCCAGAATGCTTAGATGTG
GGGCTGGCTGCCATGGTCTGCAAAGAATTGACTCTCATGACTGAAGAAGAAACACGATTAAGAGAGTCTGTTGTACAGATGGGTGTCCTG
ATGTCAGAAGAAGAAGTGTTTGAACTTGTTCCTGATGATGAGCGGCAGTGTTCAGCATGCAGAACCACATGTTTTCTCTCTGCTCTCACA
TGTTCCTGTAATCCTGAGCGGCTTGTATGTCTCTACCATCCAACTGATCTGTGCCCCTGCCCCATGCAGAAGAAATGTCTTAGATATCGC
TACCCATTAGAAGACCTCCCTTCTCTGCTATATGGTGTAAAAGTCAGGGCACAGTCCTATGACACTTGGGTCAGTCGTGTTACAGAAGCA
TTGTCTGCTAACTTCAACCACAAAAAAGATTTGATTGAATTGCGAGTAATGCTGGAAGATGCTGAGGATAGGAAATACCCAGAGAATGAT
CTCTTTCGAAAACTCAGGGATGCTGTAAAAGAAGCTGAGACCTGTGCTTCTGTGGCTCAGCTGCTTCTGAGCAAAAAGCAGAAACACAGA
CAGAGCCCAGATAGTGGGAGGACTCGGACCAAACTGACAGTGGAAGAATTGAAGGCCTTTGTCCAACAACTTTTTAGTCTTCCGTGTGTC
ATCAGCCAAGCTCGGCAAGTAAAGAATCTGCTAGATGATGTGGAAGAGTTTCATGAACGTGCTCAGGAGGCCATGATGGATGAAACCCCA
GATTCTTCCAAACTCCAGATGTTGATAGATATGGGCTCTAGTCTCTATGTGGAACTCCCTGAATTACCACGACTGAAGCAAGAGCTACAA
CAGGCTCGGTGGTTGGACGAAGTAAGACTGACCTTATCAGATCCGCAACAAGTCACTTTGGATGTCATGAAGAAGCTGATAGACTCTGGG
GTAGGGTTGGCACCCCACCATGCTGTGGAGAAAGCAATGGCTGAACTACAGGAGCTCCTTACAGTCTCTGAACGATGGGAAGAAAAGGCT
AAGGTCTGCCTACAGGCAAGACCGAGGCACAGTGTGGCAAGTTTAGAAAGCATTGTGAATGAAGCCAAGAACATTCCAGCCTTTCTACCC
AATGTGTTGTCCTTGAAAGAAGCCTTACAAAAGGCTCGAGAATGGACCGCTAAAGTGGAAGCTATTCAGAGTGGCAGCAATTACGCTTAT
TTGGAGCAGCTTGAGAGCTTGTCTGCGAAAGGACGCCCTATTCCTGTGCGTCTTGAAGCACTGCCGCAAGTGGAATCACAGGTAGCAGCA
GCACGGGCATGGAGAGAACGGACTGGGCGGACGTTTCTTAAGAAGAATTCTAGCCATACATTGTTACAGGTGCTGAGCCCCCGGACCGAC
ATTGGTGTATATGGGAGTGGCAAAAATAGGAGGAAAAAAGTAAAAGAACTAATAGAAAAAGAAAAAGAAAAGGATCTGGACCTGGAGCCT
CTGAGTGATCTGGAGGAAGGATTGGAGGAAACCAGAGATACAGCCATGGTGGTGGCAGTTTTCAAAGAACGGGAGCAAAAAGAGATTGAA
GCCATGCATTCTCTCAGAGCAGCCAACCTAGCCAAGATGACAATGGTGGACCGCATAGAAGAAGTAAAATTTTGCATTTGCCGCAAGACA
GCCAGTGGGTTTATGCTACAGTGTGAGCTCTGCAAAGACTGGTTCCATAACAGCTGTGTTCCTCTTCCTAAATCAAGTTCCCAAAAAAAA
GGATCCAGCTGGCAAGCTAAAGAAGTAAAATTCCTTTGCCCTCTTTGTATGCGGTCTCGAAGGCCCAGGCTAGAGACTATTCTGTCACTC
CTGGTATCCCTTCAGAAGTTGCCCGTACGGTTGCCTGAAGGAGAGGCCCTGCAGTGTTTGACAGAACGTGCTATGAGTTGGCAAGATAGA
GCGCGGCAGGCTCTAGCCACAGATGAACTATCCTCTGCCCTGGCCAAACTATCTGTGTTGAGCCAGCGTATGGTGGAACAGGCGGCTCGA
GAAAAAACTGAAAAGATCATCAGTGCAGAACTCCAAAAAGCAGCTGCCAATCCAGACTTACAGGGACACTTACCTAGTTTCCAGCAGTCT
GCTTTTAACCGGGTGGTGAGCAGTGTGTCATCTTCTCCTCGACAAACAATGGACTATGATGATGAAGAAACAGACTCTGATGAAGACATT
CGAGAGACATATGGCTACGACATGAAGGACACAGCCAGTGTGAAGTCCTCTAGTAGTCTTGAACCCAATCTTTTTTGTGATGAAGAGATT
CCCATCAAATCCGAGGAGGTGGTGACCCACATGTGGACAGCACCTTCATTTTGTGCAGAGCATGCTTATTCTTCTGCTTCTAAGAGTTGT
TCTCAAGGTTCTAGCACCCCAAGGAAACAACCTCGGAAGAGCCCTTTGGTGCCCCGAAGTTTGGAACCTCCAGTGCTGGAGTTGTCACCT
GGAGCTAAGGCACAACTGGAAGAACTTATGATGGTTGGAGATCTCCTGGAAGTATCTCTGGACGAGACTCAACACATATGGCGGATTTTG
CAGGCCACACACCCACCCTCTGAAGACAGATTCTTGCATATCATGGAGCCTGGAAGCTCCGACCCCAGGAGCCAGCCCATCAACCTGAAC
CATTACGCCACCAAGAAGAGCGTGGCGGAGAGCATGCTGGACGTGGCCCTGTTCATGTCCAACGCCATGCGGCTGAAGGCGGTGCTGGAG
CAGGGACCATCCTCTCACTACTACACCACCCTGGTCACCCTCATCAGCCTCTCTCTGCTCCTGCAGGTGGTCATCGGTGTCCTGCTCGTG
GTCATTGCACGGCTGAACCTGAATGAGGTAGAAAAGCAGTGGCGACTCAACCAGCTCAACAACGCAGCCACCATCTTGGTCTTCTTCACT
GTGGTCATCAATGTTTTCATTACAGCCTTCGGGGCACATAAAACAGGGTTCCTGGCTGCCAGGGCCTCAAGGAATCCTCTCTGAATGCAG
CCTGGGACCCAGGTTCTGGGCCTGGAACTTCTGCCTCCTTCCTCCGTGATCTGCCAGGCTCGTGGGCACTTTCCACAGCCCAGGAGAGCT
TCTGAAAGGACAGTATAGCTGCCCTTGCTCCCTACCCACAGCACCTGAGTTAAAAAGTGATTTTTATGTTATTGGTCTAAGGGACTTCCA
TCTTGGTCTGAAGTCCTGAGCTCAGACGCAGGTACTGCCAGCCATACCTTCCTGGTAGCATCTGCTGGACCTAAGTAAGGCATGTCTGTC

>In-frame_KDM5A_ENST00000399788_chr12_459787_-_NINJ2_ENST00000305108_chr12_675344_-_2471nt
GCAGAACTTTGGCGGGCAAGGAGACAAACAGCCACACTGTGCTGCCGGGGAAGAGAAGAAGAAGGAAAGGCCAGACACACAGGCGTCGTG
CAGCTGCGGAAGGATTCCGTTTCCTGCAGGGGGCGGAGGGATTTGACAGCACGGTAACTTCCGGAAAAGTCCTGAACCTCAGTGGAAAAG
CCTTGCAAGAAACAATAACAAACGGGAGGAGGAAGCGATTCTGGGGTTTCTGTGTTGAACGGTTCTTGTCCGCGAAGATGCGCTTCGGCC
TCTGTCAGGGGACTTGAACGGGCTTAGTGGGCTTCAGCCAGCTTTTCTCCACCGGTTCCCCACGGGGACCCCCCCCCCCCCCCGGCCGTT
GCAATGGCGGGCGTGGGGCCGGGGGGCTACGCGGCGGAGTTCGTGCCACCGCCAGAGTGCCCCGTCTTTGAGCCGAGTTGGGAGGAGTTC
ACAGATCCGCTCAGCTTTATCGGCCGCATCCGGCCTTTGGCGGAGAAAACCGGCATCTGCAAAATTCGGCCGCCCAAGGACTGGCAGCCT
CCATTTGCCTGTGAAGTAAAAAGCTTTCGTTTCACTCCAAGAGTCCAGCGCCTGAATGAACTTGAGGCAATGACCAGAGTGAGATTGGAT
TTCTTGGATCAACTAGCAAAATTTTGGGAACTTCAAGGATCTACTCTGAAGATCCCTGTGGTAGAGAGAAAAATCCTGGATCTGTATGCT
TTGAGCAAGATTGTTGCCAGCAAAGGAGGTTTTGAAATGGTCACCAAAGAGAAGAAATGGTCTAAAGTGGGTAGTCGCTTGGGATATCTG
CCAGGAAAAGGAACTGGGTCTCTTTTGAAGTCACATTATGAAAGAATTCTCTACCCATATGAGCTTTTCCAGTCTGGTGTGAGCCTTATG
GGTGTGCAGATGCCTAATTTAGATCTTAAAGAAAAAGTGGAGCCTGAGGTTCTCAGCACTGATACCCAAACTTCCCCAGAGCCAGGCACA
AGGATGAACATTCTGCCGAAGAGAACAAGACGTGTGAAGACTCAGTCAGAATCTGGAGATGTGAGTAGAAACACGGAACTGAAGAAACTT
CAGATTTTTGGGGCTGGGCCCAAGGTTGTGGGCTTGGCAATGGGAACAAAAGATAAAGAAGATGAGGTCACCCGAAGACGAAAAGTTACC
AACAGGTCAGACGCATTTAACATGCAAATGAGACAACGGAAAGGCACTCTCTCTGTTAACTTTGTTGATCTCTATGTTTGTATGTTTTGT
GGTCGGGGAAACAATGAAGATAAATTGCTTTTGTGTGATGGATGTGATGACAGCTATCATACATTTTGTCTAATTCCTCCACTACCTGAT
GTGCCCAAAGGAGACTGGAGGTGTCCTAAATGTGTCGCCGAGGAATGTAGCAAACCTCGAGAAGCCTTTGGATTTGAACAAGCTGTACGA
GAGTATACACTTCAGAGCTTTGGAGAGATGGCAGATAATTTTAAGTCTGATTATTTTAATATGCCAGTCCATATGGTTCCCACAGAACTA
GTAGAAAAGGAATTTTGGCGGCTGGTAAGCAGCATTGAAGAAGATGTTATTGTGGAATATGGAGCAGATATCTCCTCAAAAGACTTTGGA
AGTGGATTTCCGGTGAAGGATGGGCGGAGAAAGATTCTGCCAGAAGAAGAGCCTGGAAGCTCCGACCCCAGGAGCCAGCCCATCAACCTG
AACCATTACGCCACCAAGAAGAGCGTGGCGGAGAGCATGCTGGACGTGGCCCTGTTCATGTCCAACGCCATGCGGCTGAAGGCGGTGCTG
GAGCAGGGACCATCCTCTCACTACTACACCACCCTGGTCACCCTCATCAGCCTCTCTCTGCTCCTGCAGGTGGTCATCGGTGTCCTGCTC
GTGGTCATTGCACGGCTGAACCTGAATGAGGTAGAAAAGCAGTGGCGACTCAACCAGCTCAACAACGCAGCCACCATCTTGGTCTTCTTC
ACTGTGGTCATCAATGTTTTCATTACAGCCTTCGGGGCACATAAAACAGGGTTCCTGGCTGCCAGGGCCTCAAGGAATCCTCTCTGAATG
CAGCCTGGGACCCAGGTTCTGGGCCTGGAACTTCTGCCTCCTTCCTCCGTGATCTGCCAGGCTCGTGGGCACTTTCCACAGCCCAGGAGA
GCTTCTGAAAGGACAGTATAGCTGCCCTTGCTCCCTACCCACAGCACCTGAGTTAAAAAGTGATTTTTATGTTATTGGTCTAAGGGACTT
CCATCTTGGTCTGAAGTCCTGAGCTCAGACGCAGGTACTGCCAGCCATACCTTCCTGGTAGCATCTGCTGGACCTAAGTAAGGCATGTCT
GTCTAAGGCCAAGTCTGCCCGGCTTAAGGATGCTGGTTCTGACTCTACCCCACTGCTTCCTTCTGCTCCAGGCCTCAATTTTCCCTTCTT

>In-frame_KDM5A_ENST00000399788_chr12_459787_-_NINJ2_ENST00000397265_chr12_675344_-_2391nt
GCAGAACTTTGGCGGGCAAGGAGACAAACAGCCACACTGTGCTGCCGGGGAAGAGAAGAAGAAGGAAAGGCCAGACACACAGGCGTCGTG
CAGCTGCGGAAGGATTCCGTTTCCTGCAGGGGGCGGAGGGATTTGACAGCACGGTAACTTCCGGAAAAGTCCTGAACCTCAGTGGAAAAG
CCTTGCAAGAAACAATAACAAACGGGAGGAGGAAGCGATTCTGGGGTTTCTGTGTTGAACGGTTCTTGTCCGCGAAGATGCGCTTCGGCC
TCTGTCAGGGGACTTGAACGGGCTTAGTGGGCTTCAGCCAGCTTTTCTCCACCGGTTCCCCACGGGGACCCCCCCCCCCCCCCGGCCGTT
GCAATGGCGGGCGTGGGGCCGGGGGGCTACGCGGCGGAGTTCGTGCCACCGCCAGAGTGCCCCGTCTTTGAGCCGAGTTGGGAGGAGTTC
ACAGATCCGCTCAGCTTTATCGGCCGCATCCGGCCTTTGGCGGAGAAAACCGGCATCTGCAAAATTCGGCCGCCCAAGGACTGGCAGCCT
CCATTTGCCTGTGAAGTAAAAAGCTTTCGTTTCACTCCAAGAGTCCAGCGCCTGAATGAACTTGAGGCAATGACCAGAGTGAGATTGGAT
TTCTTGGATCAACTAGCAAAATTTTGGGAACTTCAAGGATCTACTCTGAAGATCCCTGTGGTAGAGAGAAAAATCCTGGATCTGTATGCT
TTGAGCAAGATTGTTGCCAGCAAAGGAGGTTTTGAAATGGTCACCAAAGAGAAGAAATGGTCTAAAGTGGGTAGTCGCTTGGGATATCTG
CCAGGAAAAGGAACTGGGTCTCTTTTGAAGTCACATTATGAAAGAATTCTCTACCCATATGAGCTTTTCCAGTCTGGTGTGAGCCTTATG
GGTGTGCAGATGCCTAATTTAGATCTTAAAGAAAAAGTGGAGCCTGAGGTTCTCAGCACTGATACCCAAACTTCCCCAGAGCCAGGCACA
AGGATGAACATTCTGCCGAAGAGAACAAGACGTGTGAAGACTCAGTCAGAATCTGGAGATGTGAGTAGAAACACGGAACTGAAGAAACTT
CAGATTTTTGGGGCTGGGCCCAAGGTTGTGGGCTTGGCAATGGGAACAAAAGATAAAGAAGATGAGGTCACCCGAAGACGAAAAGTTACC
AACAGGTCAGACGCATTTAACATGCAAATGAGACAACGGAAAGGCACTCTCTCTGTTAACTTTGTTGATCTCTATGTTTGTATGTTTTGT
GGTCGGGGAAACAATGAAGATAAATTGCTTTTGTGTGATGGATGTGATGACAGCTATCATACATTTTGTCTAATTCCTCCACTACCTGAT
GTGCCCAAAGGAGACTGGAGGTGTCCTAAATGTGTCGCCGAGGAATGTAGCAAACCTCGAGAAGCCTTTGGATTTGAACAAGCTGTACGA
GAGTATACACTTCAGAGCTTTGGAGAGATGGCAGATAATTTTAAGTCTGATTATTTTAATATGCCAGTCCATATGGTTCCCACAGAACTA
GTAGAAAAGGAATTTTGGCGGCTGGTAAGCAGCATTGAAGAAGATGTTATTGTGGAATATGGAGCAGATATCTCCTCAAAAGACTTTGGA
AGTGGATTTCCGGTGAAGGATGGGCGGAGAAAGATTCTGCCAGAAGAAGAGCCTGGAAGCTCCGACCCCAGGAGCCAGCCCATCAACCTG
AACCATTACGCCACCAAGAAGAGCGTGGCGGAGAGCATGCTGGACGTGGCCCTGTTCATGTCCAACGCCATGCGGCTGAAGGCGGTGCTG
GAGCAGGGACCATCCTCTCACTACTACACCACCCTGGTCACCCTCATCAGCCTCTCTCTGCTCCTGCAGGTGGTCATCGGTGTCCTGCTC
GTGGTCATTGCACGGCTGAACCTGAATGAGGTAGAAAAGCAGTGGCGACTCAACCAGCTCAACAACGCAGCCACCATCTTGGTCTTCTTC
ACTGTGGTCATCAATGTTTTCATTACAGCCTTCGGGGCACATAAAACAGGGTTCCTGGCTGCCAGGGCCTCAAGGAATCCTCTCTGAATG
CAGCCTGGGACCCAGGTTCTGGGCCTGGAACTTCTGCCTCCTTCCTCCGTGATCTGCCAGGCTCGTGGGCACTTTCCACAGCCCAGGAGA
GCTTCTGAAAGGACAGTATAGCTGCCCTTGCTCCCTACCCACAGCACCTGAGTTAAAAAGTGATTTTTATGTTATTGGTCTAAGGGACTT
CCATCTTGGTCTGAAGTCCTGAGCTCAGACGCAGGTACTGCCAGCCATACCTTCCTGGTAGCATCTGCTGGACCTAAGTAAGGCATGTCT

>In-frame_KDM5A_ENST00000382815_chr12_459787_-_NINJ2_ENST00000305108_chr12_675344_-_2471nt
GCAGAACTTTGGCGGGCAAGGAGACAAACAGCCACACTGTGCTGCCGGGGAAGAGAAGAAGAAGGAAAGGCCAGACACACAGGCGTCGTG
CAGCTGCGGAAGGATTCCGTTTCCTGCAGGGGGCGGAGGGATTTGACAGCACGGTAACTTCCGGAAAAGTCCTGAACCTCAGTGGAAAAG
CCTTGCAAGAAACAATAACAAACGGGAGGAGGAAGCGATTCTGGGGTTTCTGTGTTGAACGGTTCTTGTCCGCGAAGATGCGCTTCGGCC
TCTGTCAGGGGACTTGAACGGGCTTAGTGGGCTTCAGCCAGCTTTTCTCCACCGGTTCCCCACGGGGACCCCCCCCCCCCCCCGGCCGTT
GCAATGGCGGGCGTGGGGCCGGGGGGCTACGCGGCGGAGTTCGTGCCACCGCCAGAGTGCCCCGTCTTTGAGCCGAGTTGGGAGGAGTTC
ACAGATCCGCTCAGCTTTATCGGCCGCATCCGGCCTTTGGCGGAGAAAACCGGCATCTGCAAAATTCGGCCGCCCAAGGACTGGCAGCCT
CCATTTGCCTGTGAAGTAAAAAGCTTTCGTTTCACTCCAAGAGTCCAGCGCCTGAATGAACTTGAGGCAATGACCAGAGTGAGATTGGAT
TTCTTGGATCAACTAGCAAAATTTTGGGAACTTCAAGGATCTACTCTGAAGATCCCTGTGGTAGAGAGAAAAATCCTGGATCTGTATGCT
TTGAGCAAGATTGTTGCCAGCAAAGGAGGTTTTGAAATGGTCACCAAAGAGAAGAAATGGTCTAAAGTGGGTAGTCGCTTGGGATATCTG
CCAGGAAAAGGAACTGGGTCTCTTTTGAAGTCACATTATGAAAGAATTCTCTACCCATATGAGCTTTTCCAGTCTGGTGTGAGCCTTATG
GGTGTGCAGATGCCTAATTTAGATCTTAAAGAAAAAGTGGAGCCTGAGGTTCTCAGCACTGATACCCAAACTTCCCCAGAGCCAGGCACA
AGGATGAACATTCTGCCGAAGAGAACAAGACGTGTGAAGACTCAGTCAGAATCTGGAGATGTGAGTAGAAACACGGAACTGAAGAAACTT
CAGATTTTTGGGGCTGGGCCCAAGGTTGTGGGCTTGGCAATGGGAACAAAAGATAAAGAAGATGAGGTCACCCGAAGACGAAAAGTTACC
AACAGGTCAGACGCATTTAACATGCAAATGAGACAACGGAAAGGCACTCTCTCTGTTAACTTTGTTGATCTCTATGTTTGTATGTTTTGT
GGTCGGGGAAACAATGAAGATAAATTGCTTTTGTGTGATGGATGTGATGACAGCTATCATACATTTTGTCTAATTCCTCCACTACCTGAT
GTGCCCAAAGGAGACTGGAGGTGTCCTAAATGTGTCGCCGAGGAATGTAGCAAACCTCGAGAAGCCTTTGGATTTGAACAAGCTGTACGA
GAGTATACACTTCAGAGCTTTGGAGAGATGGCAGATAATTTTAAGTCTGATTATTTTAATATGCCAGTCCATATGGTTCCCACAGAACTA
GTAGAAAAGGAATTTTGGCGGCTGGTAAGCAGCATTGAAGAAGATGTTATTGTGGAATATGGAGCAGATATCTCCTCAAAAGACTTTGGA
AGTGGATTTCCGGTGAAGGATGGGCGGAGAAAGATTCTGCCAGAAGAAGAGCCTGGAAGCTCCGACCCCAGGAGCCAGCCCATCAACCTG
AACCATTACGCCACCAAGAAGAGCGTGGCGGAGAGCATGCTGGACGTGGCCCTGTTCATGTCCAACGCCATGCGGCTGAAGGCGGTGCTG
GAGCAGGGACCATCCTCTCACTACTACACCACCCTGGTCACCCTCATCAGCCTCTCTCTGCTCCTGCAGGTGGTCATCGGTGTCCTGCTC
GTGGTCATTGCACGGCTGAACCTGAATGAGGTAGAAAAGCAGTGGCGACTCAACCAGCTCAACAACGCAGCCACCATCTTGGTCTTCTTC
ACTGTGGTCATCAATGTTTTCATTACAGCCTTCGGGGCACATAAAACAGGGTTCCTGGCTGCCAGGGCCTCAAGGAATCCTCTCTGAATG
CAGCCTGGGACCCAGGTTCTGGGCCTGGAACTTCTGCCTCCTTCCTCCGTGATCTGCCAGGCTCGTGGGCACTTTCCACAGCCCAGGAGA
GCTTCTGAAAGGACAGTATAGCTGCCCTTGCTCCCTACCCACAGCACCTGAGTTAAAAAGTGATTTTTATGTTATTGGTCTAAGGGACTT
CCATCTTGGTCTGAAGTCCTGAGCTCAGACGCAGGTACTGCCAGCCATACCTTCCTGGTAGCATCTGCTGGACCTAAGTAAGGCATGTCT
GTCTAAGGCCAAGTCTGCCCGGCTTAAGGATGCTGGTTCTGACTCTACCCCACTGCTTCCTTCTGCTCCAGGCCTCAATTTTCCCTTCTT

>In-frame_KDM5A_ENST00000382815_chr12_459787_-_NINJ2_ENST00000397265_chr12_675344_-_2391nt
GCAGAACTTTGGCGGGCAAGGAGACAAACAGCCACACTGTGCTGCCGGGGAAGAGAAGAAGAAGGAAAGGCCAGACACACAGGCGTCGTG
CAGCTGCGGAAGGATTCCGTTTCCTGCAGGGGGCGGAGGGATTTGACAGCACGGTAACTTCCGGAAAAGTCCTGAACCTCAGTGGAAAAG
CCTTGCAAGAAACAATAACAAACGGGAGGAGGAAGCGATTCTGGGGTTTCTGTGTTGAACGGTTCTTGTCCGCGAAGATGCGCTTCGGCC
TCTGTCAGGGGACTTGAACGGGCTTAGTGGGCTTCAGCCAGCTTTTCTCCACCGGTTCCCCACGGGGACCCCCCCCCCCCCCCGGCCGTT
GCAATGGCGGGCGTGGGGCCGGGGGGCTACGCGGCGGAGTTCGTGCCACCGCCAGAGTGCCCCGTCTTTGAGCCGAGTTGGGAGGAGTTC
ACAGATCCGCTCAGCTTTATCGGCCGCATCCGGCCTTTGGCGGAGAAAACCGGCATCTGCAAAATTCGGCCGCCCAAGGACTGGCAGCCT
CCATTTGCCTGTGAAGTAAAAAGCTTTCGTTTCACTCCAAGAGTCCAGCGCCTGAATGAACTTGAGGCAATGACCAGAGTGAGATTGGAT
TTCTTGGATCAACTAGCAAAATTTTGGGAACTTCAAGGATCTACTCTGAAGATCCCTGTGGTAGAGAGAAAAATCCTGGATCTGTATGCT
TTGAGCAAGATTGTTGCCAGCAAAGGAGGTTTTGAAATGGTCACCAAAGAGAAGAAATGGTCTAAAGTGGGTAGTCGCTTGGGATATCTG
CCAGGAAAAGGAACTGGGTCTCTTTTGAAGTCACATTATGAAAGAATTCTCTACCCATATGAGCTTTTCCAGTCTGGTGTGAGCCTTATG
GGTGTGCAGATGCCTAATTTAGATCTTAAAGAAAAAGTGGAGCCTGAGGTTCTCAGCACTGATACCCAAACTTCCCCAGAGCCAGGCACA
AGGATGAACATTCTGCCGAAGAGAACAAGACGTGTGAAGACTCAGTCAGAATCTGGAGATGTGAGTAGAAACACGGAACTGAAGAAACTT
CAGATTTTTGGGGCTGGGCCCAAGGTTGTGGGCTTGGCAATGGGAACAAAAGATAAAGAAGATGAGGTCACCCGAAGACGAAAAGTTACC
AACAGGTCAGACGCATTTAACATGCAAATGAGACAACGGAAAGGCACTCTCTCTGTTAACTTTGTTGATCTCTATGTTTGTATGTTTTGT
GGTCGGGGAAACAATGAAGATAAATTGCTTTTGTGTGATGGATGTGATGACAGCTATCATACATTTTGTCTAATTCCTCCACTACCTGAT
GTGCCCAAAGGAGACTGGAGGTGTCCTAAATGTGTCGCCGAGGAATGTAGCAAACCTCGAGAAGCCTTTGGATTTGAACAAGCTGTACGA
GAGTATACACTTCAGAGCTTTGGAGAGATGGCAGATAATTTTAAGTCTGATTATTTTAATATGCCAGTCCATATGGTTCCCACAGAACTA
GTAGAAAAGGAATTTTGGCGGCTGGTAAGCAGCATTGAAGAAGATGTTATTGTGGAATATGGAGCAGATATCTCCTCAAAAGACTTTGGA
AGTGGATTTCCGGTGAAGGATGGGCGGAGAAAGATTCTGCCAGAAGAAGAGCCTGGAAGCTCCGACCCCAGGAGCCAGCCCATCAACCTG
AACCATTACGCCACCAAGAAGAGCGTGGCGGAGAGCATGCTGGACGTGGCCCTGTTCATGTCCAACGCCATGCGGCTGAAGGCGGTGCTG
GAGCAGGGACCATCCTCTCACTACTACACCACCCTGGTCACCCTCATCAGCCTCTCTCTGCTCCTGCAGGTGGTCATCGGTGTCCTGCTC
GTGGTCATTGCACGGCTGAACCTGAATGAGGTAGAAAAGCAGTGGCGACTCAACCAGCTCAACAACGCAGCCACCATCTTGGTCTTCTTC
ACTGTGGTCATCAATGTTTTCATTACAGCCTTCGGGGCACATAAAACAGGGTTCCTGGCTGCCAGGGCCTCAAGGAATCCTCTCTGAATG
CAGCCTGGGACCCAGGTTCTGGGCCTGGAACTTCTGCCTCCTTCCTCCGTGATCTGCCAGGCTCGTGGGCACTTTCCACAGCCCAGGAGA
GCTTCTGAAAGGACAGTATAGCTGCCCTTGCTCCCTACCCACAGCACCTGAGTTAAAAAGTGATTTTTATGTTATTGGTCTAAGGGACTT
CCATCTTGGTCTGAAGTCCTGAGCTCAGACGCAGGTACTGCCAGCCATACCTTCCTGGTAGCATCTGCTGGACCTAAGTAAGGCATGTCT


Top

FusionGenePPI for KDM5A_NINJ2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
KDM5ALMO2, ESR1, RARA, NR3C1, VDR, RB1, TBP, RBL1, HIST2H3A, MXD1, EZH2, EED, SUZ12, MORF4L1, MORF4L2, SIN3B, HDAC2, RBPJ, HDAC1, HIST3H3, GATAD1, RBBP7, TM9SF4, PHF12, FOXK2, C11orf30, ZNF131, TRIM25NINJ2NINJ2, BCL2L13, CLEC7A, LMNA


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for KDM5A_NINJ2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for KDM5A_NINJ2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneKDM5AC3714756Intellectual Disability1CTD_human