FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 18480

FusionGeneSummary for KDM5A_MBP

check button Fusion gene summary
Fusion gene informationFusion gene name: KDM5A_MBP
Fusion gene ID: 18480
HgeneTgene
Gene symbol

KDM5A

MBP

Gene ID

5927

5553

Gene namelysine demethylase 5Aproteoglycan 2, pro eosinophil major basic protein
SynonymsRBBP-2|RBBP2|RBP2BMPG|MBP|MBP1|proMBP
Cytomap

12p13.33

11q12.1

Type of geneprotein-codingprotein-coding
Descriptionlysine-specific demethylase 5AJumonji, AT rich interactive domain 1A (RBP2-like)histone demethylase JARID1Ajumonji/ARID domain-containing protein 1Alysine (K)-specific demethylase 5Aretinoblastoma binding protein 2bone marrow proteoglycaneosinophil granule major basic proteineosinophil major basic proteinnatural killer cell activatorproteoglycan 2 preproproteinproteoglycan 2, bone marrow (natural killer cell activator, eosinophil granule major basic protein)
Modification date2018052320180519
UniProtAcc

P29375

P02686

Ensembl transtripts involved in fusion geneENST00000399788, ENST00000540838, 
ENST00000382815, 
ENST00000382582, 
ENST00000355994, ENST00000397875, 
ENST00000397866, ENST00000397865, 
ENST00000527041, ENST00000359645, 
ENST00000528160, ENST00000397869, 
ENST00000354542, ENST00000526111, 
ENST00000580402, ENST00000579129, 
ENST00000578193, ENST00000397863, 
ENST00000397860, ENST00000487778, 
Fusion gene scores* DoF score7 X 8 X 6=33626 X 20 X 3=1560
# samples 1127
** MAII scorelog2(11/336*10)=-1.6109577092541
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(27/1560*10)=-2.53051471669878
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: KDM5A [Title/Abstract] AND MBP [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Tumor suppressor gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneKDM5A

GO:0033169

histone H3-K9 demethylation

18270511

HgeneKDM5A

GO:0034720

histone H3-K4 demethylation

18270511

HgeneKDM5A

GO:0045893

positive regulation of transcription, DNA-templated

11358960


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
ChiTaRS3.1DB177382KDM5Achr12

498092

-MBPchr18

74696852

-
ChiTaRS3.1DB177419KDM5Achr12

498092

-MBPchr18

74696852

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000399788ENST00000382582KDM5Achr12

498092

-MBPchr18

74696852

-
In-frameENST00000399788ENST00000355994KDM5Achr12

498092

-MBPchr18

74696852

-
In-frameENST00000399788ENST00000397875KDM5Achr12

498092

-MBPchr18

74696852

-
In-frameENST00000399788ENST00000397866KDM5Achr12

498092

-MBPchr18

74696852

-
In-frameENST00000399788ENST00000397865KDM5Achr12

498092

-MBPchr18

74696852

-
5CDS-intronENST00000399788ENST00000527041KDM5Achr12

498092

-MBPchr18

74696852

-
5CDS-intronENST00000399788ENST00000359645KDM5Achr12

498092

-MBPchr18

74696852

-
5CDS-intronENST00000399788ENST00000528160KDM5Achr12

498092

-MBPchr18

74696852

-
5CDS-intronENST00000399788ENST00000397869KDM5Achr12

498092

-MBPchr18

74696852

-
5CDS-intronENST00000399788ENST00000354542KDM5Achr12

498092

-MBPchr18

74696852

-
5CDS-intronENST00000399788ENST00000526111KDM5Achr12

498092

-MBPchr18

74696852

-
5CDS-intronENST00000399788ENST00000580402KDM5Achr12

498092

-MBPchr18

74696852

-
5CDS-intronENST00000399788ENST00000579129KDM5Achr12

498092

-MBPchr18

74696852

-
5CDS-intronENST00000399788ENST00000578193KDM5Achr12

498092

-MBPchr18

74696852

-
5CDS-intronENST00000399788ENST00000397863KDM5Achr12

498092

-MBPchr18

74696852

-
5CDS-intronENST00000399788ENST00000397860KDM5Achr12

498092

-MBPchr18

74696852

-
5CDS-intronENST00000399788ENST00000487778KDM5Achr12

498092

-MBPchr18

74696852

-
intron-3CDSENST00000540838ENST00000382582KDM5Achr12

498092

-MBPchr18

74696852

-
intron-3CDSENST00000540838ENST00000355994KDM5Achr12

498092

-MBPchr18

74696852

-
intron-3CDSENST00000540838ENST00000397875KDM5Achr12

498092

-MBPchr18

74696852

-
intron-3CDSENST00000540838ENST00000397866KDM5Achr12

498092

-MBPchr18

74696852

-
intron-3CDSENST00000540838ENST00000397865KDM5Achr12

498092

-MBPchr18

74696852

-
intron-intronENST00000540838ENST00000527041KDM5Achr12

498092

-MBPchr18

74696852

-
intron-intronENST00000540838ENST00000359645KDM5Achr12

498092

-MBPchr18

74696852

-
intron-intronENST00000540838ENST00000528160KDM5Achr12

498092

-MBPchr18

74696852

-
intron-intronENST00000540838ENST00000397869KDM5Achr12

498092

-MBPchr18

74696852

-
intron-intronENST00000540838ENST00000354542KDM5Achr12

498092

-MBPchr18

74696852

-
intron-intronENST00000540838ENST00000526111KDM5Achr12

498092

-MBPchr18

74696852

-
intron-intronENST00000540838ENST00000580402KDM5Achr12

498092

-MBPchr18

74696852

-
intron-intronENST00000540838ENST00000579129KDM5Achr12

498092

-MBPchr18

74696852

-
intron-intronENST00000540838ENST00000578193KDM5Achr12

498092

-MBPchr18

74696852

-
intron-intronENST00000540838ENST00000397863KDM5Achr12

498092

-MBPchr18

74696852

-
intron-intronENST00000540838ENST00000397860KDM5Achr12

498092

-MBPchr18

74696852

-
intron-intronENST00000540838ENST00000487778KDM5Achr12

498092

-MBPchr18

74696852

-
In-frameENST00000382815ENST00000382582KDM5Achr12

498092

-MBPchr18

74696852

-
In-frameENST00000382815ENST00000355994KDM5Achr12

498092

-MBPchr18

74696852

-
In-frameENST00000382815ENST00000397875KDM5Achr12

498092

-MBPchr18

74696852

-
In-frameENST00000382815ENST00000397866KDM5Achr12

498092

-MBPchr18

74696852

-
In-frameENST00000382815ENST00000397865KDM5Achr12

498092

-MBPchr18

74696852

-
5CDS-intronENST00000382815ENST00000527041KDM5Achr12

498092

-MBPchr18

74696852

-
5CDS-intronENST00000382815ENST00000359645KDM5Achr12

498092

-MBPchr18

74696852

-
5CDS-intronENST00000382815ENST00000528160KDM5Achr12

498092

-MBPchr18

74696852

-
5CDS-intronENST00000382815ENST00000397869KDM5Achr12

498092

-MBPchr18

74696852

-
5CDS-intronENST00000382815ENST00000354542KDM5Achr12

498092

-MBPchr18

74696852

-
5CDS-intronENST00000382815ENST00000526111KDM5Achr12

498092

-MBPchr18

74696852

-
5CDS-intronENST00000382815ENST00000580402KDM5Achr12

498092

-MBPchr18

74696852

-
5CDS-intronENST00000382815ENST00000579129KDM5Achr12

498092

-MBPchr18

74696852

-
5CDS-intronENST00000382815ENST00000578193KDM5Achr12

498092

-MBPchr18

74696852

-
5CDS-intronENST00000382815ENST00000397863KDM5Achr12

498092

-MBPchr18

74696852

-
5CDS-intronENST00000382815ENST00000397860KDM5Achr12

498092

-MBPchr18

74696852

-
5CDS-intronENST00000382815ENST00000487778KDM5Achr12

498092

-MBPchr18

74696852

-

Top

FusionProtFeatures for KDM5A_MBP


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
KDM5A

P29375

MBP

P02686

Histone demethylase that specifically demethylates 'Lys-4' of histone H3, thereby playing a central role in histone code.Does not demethylate histone H3 'Lys-9', H3 'Lys-27', H3 'Lys-36',H3 'Lys-79' or H4 'Lys-20'. Demethylates trimethylated anddimethylated but not monomethylated H3 'Lys-4'. Regulates specificgene transcription through DNA-binding on 5'-CCGCCC-3' motif(PubMed:18270511). May stimulate transcription mediated by nuclearreceptors. Involved in transcriptional regulation of Hox proteinsduring cell differentiation (PubMed:19430464). May participate intranscriptional repression of cytokines such as CXCL12. Plays arole in the regulation of the circadian rhythm and in maintainingthe normal periodicity of the circadian clock. In a histonedemethylase-independent manner, acts as a coactivator of theCLOCK-ARNTL/BMAL1-mediated transcriptional activation of PER1/2and other clock-controlled genes and increases histone acetylationat PER1/2 promoters by inhibiting the activity of HDAC1 (Bysimilarity). Seems to act as a transcriptional corepressor forsome genes such as MT1F and to favor the proliferation of cancercells (PubMed:27427228). {ECO:0000250|UniProtKB:Q3UXZ9,ECO:0000269|PubMed:11358960, ECO:0000269|PubMed:15949438,ECO:0000269|PubMed:17320160, ECO:0000269|PubMed:17320161,ECO:0000269|PubMed:17320163, ECO:0000269|PubMed:18270511,ECO:0000269|PubMed:19430464, ECO:0000269|PubMed:27427228}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneMBPchr12:498092chr18:74696852ENST00000359645-36179_222132187RegionNote=Induces experimental autoimmune encephalomyelitis (EAE) 1
TgeneMBPchr12:498092chr18:74696852ENST00000359645-36246_256132187RegionNote=Induces experimental autoimmune encephalomyelitis (EAE) 2
TgeneMBPchr12:498092chr18:74696852ENST00000382582-47179_222143198RegionNote=Induces experimental autoimmune encephalomyelitis (EAE) 1
TgeneMBPchr12:498092chr18:74696852ENST00000382582-47246_256143198RegionNote=Induces experimental autoimmune encephalomyelitis (EAE) 2
TgeneMBPchr12:498092chr18:74696852ENST00000397860-04179_222-72198RegionNote=Induces experimental autoimmune encephalomyelitis (EAE) 1
TgeneMBPchr12:498092chr18:74696852ENST00000397860-04246_256-72198RegionNote=Induces experimental autoimmune encephalomyelitis (EAE) 2
TgeneMBPchr12:498092chr18:74696852ENST00000397863-04179_222-57198RegionNote=Induces experimental autoimmune encephalomyelitis (EAE) 1
TgeneMBPchr12:498092chr18:74696852ENST00000397863-04246_256-57198RegionNote=Induces experimental autoimmune encephalomyelitis (EAE) 2
TgeneMBPchr12:498092chr18:74696852ENST00000397865-25179_222106161RegionNote=Induces experimental autoimmune encephalomyelitis (EAE) 1
TgeneMBPchr12:498092chr18:74696852ENST00000397865-25246_256106161RegionNote=Induces experimental autoimmune encephalomyelitis (EAE) 2
TgeneMBPchr12:498092chr18:74696852ENST00000397866-36179_222117172RegionNote=Induces experimental autoimmune encephalomyelitis (EAE) 1
TgeneMBPchr12:498092chr18:74696852ENST00000397866-36246_256117172RegionNote=Induces experimental autoimmune encephalomyelitis (EAE) 2

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneKDM5Achr12:498092chr18:74696852ENST00000399788-1281492_1587551691Compositional biasNote=Lys-rich
HgeneKDM5Achr12:498092chr18:74696852ENST00000399788-12819_60551691DomainJmjN
HgeneKDM5Achr12:498092chr18:74696852ENST00000399788-128437_603551691DomainJmjC
HgeneKDM5Achr12:498092chr18:74696852ENST00000399788-12884_174551691DomainARID
HgeneKDM5Achr12:498092chr18:74696852ENST00000399788-128419_423551691MotifGSGFP motif
HgeneKDM5Achr12:498092chr18:74696852ENST00000399788-1281161_1218551691Zinc fingerPHD-type 2
HgeneKDM5Achr12:498092chr18:74696852ENST00000399788-1281607_1661551691Zinc fingerPHD-type 3
HgeneKDM5Achr12:498092chr18:74696852ENST00000399788-128293_343551691Zinc fingerPHD-type 1
HgeneKDM5Achr12:498092chr18:74696852ENST00000399788-128676_728551691Zinc fingerC5HC2
TgeneMBPchr12:498092chr18:74696852ENST00000355994-69179_222250305RegionNote=Induces experimental autoimmune encephalomyelitis (EAE) 1
TgeneMBPchr12:498092chr18:74696852ENST00000355994-69246_256250305RegionNote=Induces experimental autoimmune encephalomyelitis (EAE) 2
TgeneMBPchr12:498092chr18:74696852ENST00000580402-58179_222250305RegionNote=Induces experimental autoimmune encephalomyelitis (EAE) 1
TgeneMBPchr12:498092chr18:74696852ENST00000580402-58246_256250305RegionNote=Induces experimental autoimmune encephalomyelitis (EAE) 2


Top

FusionGeneSequence for KDM5A_MBP


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_KDM5A_ENST00000399788_chr12_498092_-_MBP_ENST00000382582_chr18_74696852_-_110aa
MAGVGPGGYAAEFVPPPECPVFEPSWEEFTDPLSFIGRIRPLAEKTGICKIRPPKGAEGQRPGFGYGGRASDTKSAHKGFKGVDAQGTLS

>In-frame_KDM5A_ENST00000399788_chr12_498092_-_MBP_ENST00000355994_chr18_74696852_-_110aa
MAGVGPGGYAAEFVPPPECPVFEPSWEEFTDPLSFIGRIRPLAEKTGICKIRPPKGAEGQRPGFGYGGRASDTKSAHKGFKGVDAQGTLS

>In-frame_KDM5A_ENST00000399788_chr12_498092_-_MBP_ENST00000397875_chr18_74696852_-_110aa
MAGVGPGGYAAEFVPPPECPVFEPSWEEFTDPLSFIGRIRPLAEKTGICKIRPPKGAEGQRPGFGYGGRASDTKSAHKGFKGVDAQGTLS

>In-frame_KDM5A_ENST00000399788_chr12_498092_-_MBP_ENST00000397866_chr18_74696852_-_110aa
MAGVGPGGYAAEFVPPPECPVFEPSWEEFTDPLSFIGRIRPLAEKTGICKIRPPKGAEGQRPGFGYGGRASDTKSAHKGFKGVDAQGTLS

>In-frame_KDM5A_ENST00000399788_chr12_498092_-_MBP_ENST00000397865_chr18_74696852_-_110aa
MAGVGPGGYAAEFVPPPECPVFEPSWEEFTDPLSFIGRIRPLAEKTGICKIRPPKGAEGQRPGFGYGGRASDTKSAHKGFKGVDAQGTLS

>In-frame_KDM5A_ENST00000382815_chr12_498092_-_MBP_ENST00000382582_chr18_74696852_-_110aa
MAGVGPGGYAAEFVPPPECPVFEPSWEEFTDPLSFIGRIRPLAEKTGICKIRPPKGAEGQRPGFGYGGRASDTKSAHKGFKGVDAQGTLS

>In-frame_KDM5A_ENST00000382815_chr12_498092_-_MBP_ENST00000355994_chr18_74696852_-_110aa
MAGVGPGGYAAEFVPPPECPVFEPSWEEFTDPLSFIGRIRPLAEKTGICKIRPPKGAEGQRPGFGYGGRASDTKSAHKGFKGVDAQGTLS

>In-frame_KDM5A_ENST00000382815_chr12_498092_-_MBP_ENST00000397875_chr18_74696852_-_110aa
MAGVGPGGYAAEFVPPPECPVFEPSWEEFTDPLSFIGRIRPLAEKTGICKIRPPKGAEGQRPGFGYGGRASDTKSAHKGFKGVDAQGTLS

>In-frame_KDM5A_ENST00000382815_chr12_498092_-_MBP_ENST00000397866_chr18_74696852_-_110aa
MAGVGPGGYAAEFVPPPECPVFEPSWEEFTDPLSFIGRIRPLAEKTGICKIRPPKGAEGQRPGFGYGGRASDTKSAHKGFKGVDAQGTLS

>In-frame_KDM5A_ENST00000382815_chr12_498092_-_MBP_ENST00000397865_chr18_74696852_-_110aa
MAGVGPGGYAAEFVPPPECPVFEPSWEEFTDPLSFIGRIRPLAEKTGICKIRPPKGAEGQRPGFGYGGRASDTKSAHKGFKGVDAQGTLS


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_KDM5A_ENST00000399788_chr12_498092_-_MBP_ENST00000382582_chr18_74696852_-_330nt
ATGGCGGGCGTGGGGCCGGGGGGCTACGCGGCGGAGTTCGTGCCACCGCCAGAGTGCCCCGTCTTTGAGCCGAGTTGGGAGGAGTTCACA
GATCCGCTCAGCTTTATCGGCCGCATCCGGCCTTTGGCGGAGAAAACCGGCATCTGCAAAATTCGGCCGCCCAAGGGGGCCGAAGGCCAG
AGACCAGGATTTGGCTACGGAGGCAGAGCGTCCGACTATAAATCGGCTCACAAGGGATTCAAGGGAGTCGATGCCCAGGGCACGCTTTCC

>In-frame_KDM5A_ENST00000399788_chr12_498092_-_MBP_ENST00000355994_chr18_74696852_-_330nt
ATGGCGGGCGTGGGGCCGGGGGGCTACGCGGCGGAGTTCGTGCCACCGCCAGAGTGCCCCGTCTTTGAGCCGAGTTGGGAGGAGTTCACA
GATCCGCTCAGCTTTATCGGCCGCATCCGGCCTTTGGCGGAGAAAACCGGCATCTGCAAAATTCGGCCGCCCAAGGGGGCCGAAGGCCAG
AGACCAGGATTTGGCTACGGAGGCAGAGCGTCCGACTATAAATCGGCTCACAAGGGATTCAAGGGAGTCGATGCCCAGGGCACGCTTTCC

>In-frame_KDM5A_ENST00000399788_chr12_498092_-_MBP_ENST00000397875_chr18_74696852_-_330nt
ATGGCGGGCGTGGGGCCGGGGGGCTACGCGGCGGAGTTCGTGCCACCGCCAGAGTGCCCCGTCTTTGAGCCGAGTTGGGAGGAGTTCACA
GATCCGCTCAGCTTTATCGGCCGCATCCGGCCTTTGGCGGAGAAAACCGGCATCTGCAAAATTCGGCCGCCCAAGGGGGCCGAAGGCCAG
AGACCAGGATTTGGCTACGGAGGCAGAGCGTCCGACTATAAATCGGCTCACAAGGGATTCAAGGGAGTCGATGCCCAGGGCACGCTTTCC

>In-frame_KDM5A_ENST00000399788_chr12_498092_-_MBP_ENST00000397866_chr18_74696852_-_330nt
ATGGCGGGCGTGGGGCCGGGGGGCTACGCGGCGGAGTTCGTGCCACCGCCAGAGTGCCCCGTCTTTGAGCCGAGTTGGGAGGAGTTCACA
GATCCGCTCAGCTTTATCGGCCGCATCCGGCCTTTGGCGGAGAAAACCGGCATCTGCAAAATTCGGCCGCCCAAGGGGGCCGAAGGCCAG
AGACCAGGATTTGGCTACGGAGGCAGAGCGTCCGACTATAAATCGGCTCACAAGGGATTCAAGGGAGTCGATGCCCAGGGCACGCTTTCC

>In-frame_KDM5A_ENST00000399788_chr12_498092_-_MBP_ENST00000397865_chr18_74696852_-_330nt
ATGGCGGGCGTGGGGCCGGGGGGCTACGCGGCGGAGTTCGTGCCACCGCCAGAGTGCCCCGTCTTTGAGCCGAGTTGGGAGGAGTTCACA
GATCCGCTCAGCTTTATCGGCCGCATCCGGCCTTTGGCGGAGAAAACCGGCATCTGCAAAATTCGGCCGCCCAAGGGGGCCGAAGGCCAG
AGACCAGGATTTGGCTACGGAGGCAGAGCGTCCGACTATAAATCGGCTCACAAGGGATTCAAGGGAGTCGATGCCCAGGGCACGCTTTCC

>In-frame_KDM5A_ENST00000382815_chr12_498092_-_MBP_ENST00000382582_chr18_74696852_-_330nt
ATGGCGGGCGTGGGGCCGGGGGGCTACGCGGCGGAGTTCGTGCCACCGCCAGAGTGCCCCGTCTTTGAGCCGAGTTGGGAGGAGTTCACA
GATCCGCTCAGCTTTATCGGCCGCATCCGGCCTTTGGCGGAGAAAACCGGCATCTGCAAAATTCGGCCGCCCAAGGGGGCCGAAGGCCAG
AGACCAGGATTTGGCTACGGAGGCAGAGCGTCCGACTATAAATCGGCTCACAAGGGATTCAAGGGAGTCGATGCCCAGGGCACGCTTTCC

>In-frame_KDM5A_ENST00000382815_chr12_498092_-_MBP_ENST00000355994_chr18_74696852_-_330nt
ATGGCGGGCGTGGGGCCGGGGGGCTACGCGGCGGAGTTCGTGCCACCGCCAGAGTGCCCCGTCTTTGAGCCGAGTTGGGAGGAGTTCACA
GATCCGCTCAGCTTTATCGGCCGCATCCGGCCTTTGGCGGAGAAAACCGGCATCTGCAAAATTCGGCCGCCCAAGGGGGCCGAAGGCCAG
AGACCAGGATTTGGCTACGGAGGCAGAGCGTCCGACTATAAATCGGCTCACAAGGGATTCAAGGGAGTCGATGCCCAGGGCACGCTTTCC

>In-frame_KDM5A_ENST00000382815_chr12_498092_-_MBP_ENST00000397875_chr18_74696852_-_330nt
ATGGCGGGCGTGGGGCCGGGGGGCTACGCGGCGGAGTTCGTGCCACCGCCAGAGTGCCCCGTCTTTGAGCCGAGTTGGGAGGAGTTCACA
GATCCGCTCAGCTTTATCGGCCGCATCCGGCCTTTGGCGGAGAAAACCGGCATCTGCAAAATTCGGCCGCCCAAGGGGGCCGAAGGCCAG
AGACCAGGATTTGGCTACGGAGGCAGAGCGTCCGACTATAAATCGGCTCACAAGGGATTCAAGGGAGTCGATGCCCAGGGCACGCTTTCC

>In-frame_KDM5A_ENST00000382815_chr12_498092_-_MBP_ENST00000397866_chr18_74696852_-_330nt
ATGGCGGGCGTGGGGCCGGGGGGCTACGCGGCGGAGTTCGTGCCACCGCCAGAGTGCCCCGTCTTTGAGCCGAGTTGGGAGGAGTTCACA
GATCCGCTCAGCTTTATCGGCCGCATCCGGCCTTTGGCGGAGAAAACCGGCATCTGCAAAATTCGGCCGCCCAAGGGGGCCGAAGGCCAG
AGACCAGGATTTGGCTACGGAGGCAGAGCGTCCGACTATAAATCGGCTCACAAGGGATTCAAGGGAGTCGATGCCCAGGGCACGCTTTCC

>In-frame_KDM5A_ENST00000382815_chr12_498092_-_MBP_ENST00000397865_chr18_74696852_-_330nt
ATGGCGGGCGTGGGGCCGGGGGGCTACGCGGCGGAGTTCGTGCCACCGCCAGAGTGCCCCGTCTTTGAGCCGAGTTGGGAGGAGTTCACA
GATCCGCTCAGCTTTATCGGCCGCATCCGGCCTTTGGCGGAGAAAACCGGCATCTGCAAAATTCGGCCGCCCAAGGGGGCCGAAGGCCAG
AGACCAGGATTTGGCTACGGAGGCAGAGCGTCCGACTATAAATCGGCTCACAAGGGATTCAAGGGAGTCGATGCCCAGGGCACGCTTTCC


* Fusion transcript sequences (Full-length transcript).
>In-frame_KDM5A_ENST00000399788_chr12_498092_-_MBP_ENST00000382582_chr18_74696852_-_2293nt
GCAGAACTTTGGCGGGCAAGGAGACAAACAGCCACACTGTGCTGCCGGGGAAGAGAAGAAGAAGGAAAGGCCAGACACACAGGCGTCGTG
CAGCTGCGGAAGGATTCCGTTTCCTGCAGGGGGCGGAGGGATTTGACAGCACGGTAACTTCCGGAAAAGTCCTGAACCTCAGTGGAAAAG
CCTTGCAAGAAACAATAACAAACGGGAGGAGGAAGCGATTCTGGGGTTTCTGTGTTGAACGGTTCTTGTCCGCGAAGATGCGCTTCGGCC
TCTGTCAGGGGACTTGAACGGGCTTAGTGGGCTTCAGCCAGCTTTTCTCCACCGGTTCCCCACGGGGACCCCCCCCCCCCCCCGGCCGTT
GCAATGGCGGGCGTGGGGCCGGGGGGCTACGCGGCGGAGTTCGTGCCACCGCCAGAGTGCCCCGTCTTTGAGCCGAGTTGGGAGGAGTTC
ACAGATCCGCTCAGCTTTATCGGCCGCATCCGGCCTTTGGCGGAGAAAACCGGCATCTGCAAAATTCGGCCGCCCAAGGGGGCCGAAGGC
CAGAGACCAGGATTTGGCTACGGAGGCAGAGCGTCCGACTATAAATCGGCTCACAAGGGATTCAAGGGAGTCGATGCCCAGGGCACGCTT
TCCAAAATTTTTAAGCTGGGAGGAAGAGATAGTCGCTCTGGATCACCCATGGCTAGACGCTGAAAACCCACCTGGTTCCGGAATCCTGTC
CTCAGCTTCTTAATATAACTGCCTTAAAACTTTAATCCCACTTGCCCCTGTTACCTAATTAGAGCAGATGACCCCTCCCCTAATGCCTGC
GGAGTTGTGCACGTAGTAGGGTCAGGCCACGGCAGCCTACCGGCAATTTCCGGCCAACAGTTAAATGAGAACATGAAAACAGAAAACGGT
TAAAACTGTCCCTTTCTGTGTGAAGATCACGTTCCTTCCCCCGCAATGTGCCCCCAGACGCACGTGGGTCTTCAGGGGGCCAGGTGCACA
GACGTCCCTCCACGTTCACCCCTCCACCCTTGGACTTTCTTTTCGCCGTGGCTGCGGCACCCTTGCGCTTTTGCTGGTCACTGCCATGGA
GGCACACAGCTGCAGAGACAGAGAGGACGTGGGCGGCAGAGAGGACTGTTGACATCCAAGCTTCCTTTGTTTTTTTTTCCTGTCCTTCTC
TCACCTCCTAAAGTAGACTTCATTTTTCCTAACAGGATTAGACAGTCAAGGAGTGGCTTACTACATGTGGGAGCTTTTGGTATGTGACAT
GCGGGCTGGGCAGCTGTTAGAGTCCAACGTGGGGCAGCACAGAGAGGGGGCCACCTCCCCAGGCCGTGGCTGCCCACACACCCCAATTAG
CTGAATTCGCGTGTGGCAGAGGGAGGAAAAGGAGGCAAACGTGGGCTGGGCAATGGCCTCACATAGGAAACAGGGTCTTCCTGGAGATTT
GGTGATGGAGATGTCAAGCAGGTGGCCTCTGGACGTCACCGTTGCCCTGCATGGTGGCCCCAGAGCAGCCTCTATGAACAACCTCGTTTC
CAAACCACAGCCCACAGCCGGAGAGTCCAGGAAGACTTGCGCACTCAGAGCAGAAGGGTAGGAGTCCTCTAGACAGCCTCGCAGCCGCGC
CAGTCGCCCATAGACACTGGCTGTGACCGGGCGTGCTGGCAGCGGCAGTGCACAGTGGCCAGCACTAACCCTCCCTGAGAAGATAACCGG
CTCATTCACTTCCTCCCAGAAGACGCGTGGTAGCGAGTAGGCACAGGCGTGCACCTGCTCCCGAATTACTCACCGAGACACACGGGCTGA
GCAGACGGCCCCGTGGATGGAGACAAAGAGCTCTTCTGACCATATCCTTCTTAACACCCGCTGGCATCTCCTTTCGCGCCTCCCTCCCTA
ACCTACTGACCCACCTTTTGATTTTAGCGCACCTGTGATTGATAGGCCTTCCAAAGAGTCCCACGCTGGCATCACCCTCCCCGAGGACGG
AGATGAGGAGTAGTCAGCGTGATGCCAAAACGCGTCTTCTTAATCCAATTCTAATTCTGAATGTTTCGTGTGGGCTTAATACCATGTCTA
TTAATATATAGCCTCGATGATGAGAGAGTTACAAAGAACAAAACTCCAGACACAAACCTCCAAATTTTTCAGCAGAAGCACTCTGCGTCG
CTGAGCTGAGGTCGGCTCTGCGATCCATACGTGGCCGCACCCACACAGCACGTGCTGTGACGATGGCTGAACGGAAAGTGTACACTGTTC

>In-frame_KDM5A_ENST00000399788_chr12_498092_-_MBP_ENST00000355994_chr18_74696852_-_2286nt
GCAGAACTTTGGCGGGCAAGGAGACAAACAGCCACACTGTGCTGCCGGGGAAGAGAAGAAGAAGGAAAGGCCAGACACACAGGCGTCGTG
CAGCTGCGGAAGGATTCCGTTTCCTGCAGGGGGCGGAGGGATTTGACAGCACGGTAACTTCCGGAAAAGTCCTGAACCTCAGTGGAAAAG
CCTTGCAAGAAACAATAACAAACGGGAGGAGGAAGCGATTCTGGGGTTTCTGTGTTGAACGGTTCTTGTCCGCGAAGATGCGCTTCGGCC
TCTGTCAGGGGACTTGAACGGGCTTAGTGGGCTTCAGCCAGCTTTTCTCCACCGGTTCCCCACGGGGACCCCCCCCCCCCCCCGGCCGTT
GCAATGGCGGGCGTGGGGCCGGGGGGCTACGCGGCGGAGTTCGTGCCACCGCCAGAGTGCCCCGTCTTTGAGCCGAGTTGGGAGGAGTTC
ACAGATCCGCTCAGCTTTATCGGCCGCATCCGGCCTTTGGCGGAGAAAACCGGCATCTGCAAAATTCGGCCGCCCAAGGGGGCCGAAGGC
CAGAGACCAGGATTTGGCTACGGAGGCAGAGCGTCCGACTATAAATCGGCTCACAAGGGATTCAAGGGAGTCGATGCCCAGGGCACGCTT
TCCAAAATTTTTAAGCTGGGAGGAAGAGATAGTCGCTCTGGATCACCCATGGCTAGACGCTGAAAACCCACCTGGTTCCGGAATCCTGTC
CTCAGCTTCTTAATATAACTGCCTTAAAACTTTAATCCCACTTGCCCCTGTTACCTAATTAGAGCAGATGACCCCTCCCCTAATGCCTGC
GGAGTTGTGCACGTAGTAGGGTCAGGCCACGGCAGCCTACCGGCAATTTCCGGCCAACAGTTAAATGAGAACATGAAAACAGAAAACGGT
TAAAACTGTCCCTTTCTGTGTGAAGATCACGTTCCTTCCCCCGCAATGTGCCCCCAGACGCACGTGGGTCTTCAGGGGGCCAGGTGCACA
GACGTCCCTCCACGTTCACCCCTCCACCCTTGGACTTTCTTTTCGCCGTGGCTGCGGCACCCTTGCGCTTTTGCTGGTCACTGCCATGGA
GGCACACAGCTGCAGAGACAGAGAGGACGTGGGCGGCAGAGAGGACTGTTGACATCCAAGCTTCCTTTGTTTTTTTTTCCTGTCCTTCTC
TCACCTCCTAAAGTAGACTTCATTTTTCCTAACAGGATTAGACAGTCAAGGAGTGGCTTACTACATGTGGGAGCTTTTGGTATGTGACAT
GCGGGCTGGGCAGCTGTTAGAGTCCAACGTGGGGCAGCACAGAGAGGGGGCCACCTCCCCAGGCCGTGGCTGCCCACACACCCCAATTAG
CTGAATTCGCGTGTGGCAGAGGGAGGAAAAGGAGGCAAACGTGGGCTGGGCAATGGCCTCACATAGGAAACAGGGTCTTCCTGGAGATTT
GGTGATGGAGATGTCAAGCAGGTGGCCTCTGGACGTCACCGTTGCCCTGCATGGTGGCCCCAGAGCAGCCTCTATGAACAACCTCGTTTC
CAAACCACAGCCCACAGCCGGAGAGTCCAGGAAGACTTGCGCACTCAGAGCAGAAGGGTAGGAGTCCTCTAGACAGCCTCGCAGCCGCGC
CAGTCGCCCATAGACACTGGCTGTGACCGGGCGTGCTGGCAGCGGCAGTGCACAGTGGCCAGCACTAACCCTCCCTGAGAAGATAACCGG
CTCATTCACTTCCTCCCAGAAGACGCGTGGTAGCGAGTAGGCACAGGCGTGCACCTGCTCCCGAATTACTCACCGAGACACACGGGCTGA
GCAGACGGCCCCGTGGATGGAGACAAAGAGCTCTTCTGACCATATCCTTCTTAACACCCGCTGGCATCTCCTTTCGCGCCTCCCTCCCTA
ACCTACTGACCCACCTTTTGATTTTAGCGCACCTGTGATTGATAGGCCTTCCAAAGAGTCCCACGCTGGCATCACCCTCCCCGAGGACGG
AGATGAGGAGTAGTCAGCGTGATGCCAAAACGCGTCTTCTTAATCCAATTCTAATTCTGAATGTTTCGTGTGGGCTTAATACCATGTCTA
TTAATATATAGCCTCGATGATGAGAGAGTTACAAAGAACAAAACTCCAGACACAAACCTCCAAATTTTTCAGCAGAAGCACTCTGCGTCG
CTGAGCTGAGGTCGGCTCTGCGATCCATACGTGGCCGCACCCACACAGCACGTGCTGTGACGATGGCTGAACGGAAAGTGTACACTGTTC

>In-frame_KDM5A_ENST00000399788_chr12_498092_-_MBP_ENST00000397875_chr18_74696852_-_2268nt
GCAGAACTTTGGCGGGCAAGGAGACAAACAGCCACACTGTGCTGCCGGGGAAGAGAAGAAGAAGGAAAGGCCAGACACACAGGCGTCGTG
CAGCTGCGGAAGGATTCCGTTTCCTGCAGGGGGCGGAGGGATTTGACAGCACGGTAACTTCCGGAAAAGTCCTGAACCTCAGTGGAAAAG
CCTTGCAAGAAACAATAACAAACGGGAGGAGGAAGCGATTCTGGGGTTTCTGTGTTGAACGGTTCTTGTCCGCGAAGATGCGCTTCGGCC
TCTGTCAGGGGACTTGAACGGGCTTAGTGGGCTTCAGCCAGCTTTTCTCCACCGGTTCCCCACGGGGACCCCCCCCCCCCCCCGGCCGTT
GCAATGGCGGGCGTGGGGCCGGGGGGCTACGCGGCGGAGTTCGTGCCACCGCCAGAGTGCCCCGTCTTTGAGCCGAGTTGGGAGGAGTTC
ACAGATCCGCTCAGCTTTATCGGCCGCATCCGGCCTTTGGCGGAGAAAACCGGCATCTGCAAAATTCGGCCGCCCAAGGGGGCCGAAGGC
CAGAGACCAGGATTTGGCTACGGAGGCAGAGCGTCCGACTATAAATCGGCTCACAAGGGATTCAAGGGAGTCGATGCCCAGGGCACGCTT
TCCAAAATTTTTAAGCTGGGAGGAAGAGATAGTCGCTCTGGATCACCCATGGCTAGACGCTGAAAACCCACCTGGTTCCGGAATCCTGTC
CTCAGCTTCTTAATATAACTGCCTTAAAACTTTAATCCCACTTGCCCCTGTTACCTAATTAGAGCAGATGACCCCTCCCCTAATGCCTGC
GGAGTTGTGCACGTAGTAGGGTCAGGCCACGGCAGCCTACCGGCAATTTCCGGCCAACAGTTAAATGAGAACATGAAAACAGAAAACGGT
TAAAACTGTCCCTTTCTGTGTGAAGATCACGTTCCTTCCCCCGCAATGTGCCCCCAGACGCACGTGGGTCTTCAGGGGGCCAGGTGCACA
GACGTCCCTCCACGTTCACCCCTCCACCCTTGGACTTTCTTTTCGCCGTGGCTGCGGCACCCTTGCGCTTTTGCTGGTCACTGCCATGGA
GGCACACAGCTGCAGAGACAGAGAGGACGTGGGCGGCAGAGAGGACTGTTGACATCCAAGCTTCCTTTGTTTTTTTTTCCTGTCCTTCTC
TCACCTCCTAAAGTAGACTTCATTTTTCCTAACAGGATTAGACAGTCAAGGAGTGGCTTACTACATGTGGGAGCTTTTGGTATGTGACAT
GCGGGCTGGGCAGCTGTTAGAGTCCAACGTGGGGCAGCACAGAGAGGGGGCCACCTCCCCAGGCCGTGGCTGCCCACACACCCCAATTAG
CTGAATTCGCGTGTGGCAGAGGGAGGAAAAGGAGGCAAACGTGGGCTGGGCAATGGCCTCACATAGGAAACAGGGTCTTCCTGGAGATTT
GGTGATGGAGATGTCAAGCAGGTGGCCTCTGGACGTCACCGTTGCCCTGCATGGTGGCCCCAGAGCAGCCTCTATGAACAACCTCGTTTC
CAAACCACAGCCCACAGCCGGAGAGTCCAGGAAGACTTGCGCACTCAGAGCAGAAGGGTAGGAGTCCTCTAGACAGCCTCGCAGCCGCGC
CAGTCGCCCATAGACACTGGCTGTGACCGGGCGTGCTGGCAGCGGCAGTGCACAGTGGCCAGCACTAACCCTCCCTGAGAAGATAACCGG
CTCATTCACTTCCTCCCAGAAGACGCGTGGTAGCGAGTAGGCACAGGCGTGCACCTGCTCCCGAATTACTCACCGAGACACACGGGCTGA
GCAGACGGCCCCGTGGATGGAGACAAAGAGCTCTTCTGACCATATCCTTCTTAACACCCGCTGGCATCTCCTTTCGCGCCTCCCTCCCTA
ACCTACTGACCCACCTTTTGATTTTAGCGCACCTGTGATTGATAGGCCTTCCAAAGAGTCCCACGCTGGCATCACCCTCCCCGAGGACGG
AGATGAGGAGTAGTCAGCGTGATGCCAAAACGCGTCTTCTTAATCCAATTCTAATTCTGAATGTTTCGTGTGGGCTTAATACCATGTCTA
TTAATATATAGCCTCGATGATGAGAGAGTTACAAAGAACAAAACTCCAGACACAAACCTCCAAATTTTTCAGCAGAAGCACTCTGCGTCG
CTGAGCTGAGGTCGGCTCTGCGATCCATACGTGGCCGCACCCACACAGCACGTGCTGTGACGATGGCTGAACGGAAAGTGTACACTGTTC

>In-frame_KDM5A_ENST00000399788_chr12_498092_-_MBP_ENST00000397866_chr18_74696852_-_2268nt
GCAGAACTTTGGCGGGCAAGGAGACAAACAGCCACACTGTGCTGCCGGGGAAGAGAAGAAGAAGGAAAGGCCAGACACACAGGCGTCGTG
CAGCTGCGGAAGGATTCCGTTTCCTGCAGGGGGCGGAGGGATTTGACAGCACGGTAACTTCCGGAAAAGTCCTGAACCTCAGTGGAAAAG
CCTTGCAAGAAACAATAACAAACGGGAGGAGGAAGCGATTCTGGGGTTTCTGTGTTGAACGGTTCTTGTCCGCGAAGATGCGCTTCGGCC
TCTGTCAGGGGACTTGAACGGGCTTAGTGGGCTTCAGCCAGCTTTTCTCCACCGGTTCCCCACGGGGACCCCCCCCCCCCCCCGGCCGTT
GCAATGGCGGGCGTGGGGCCGGGGGGCTACGCGGCGGAGTTCGTGCCACCGCCAGAGTGCCCCGTCTTTGAGCCGAGTTGGGAGGAGTTC
ACAGATCCGCTCAGCTTTATCGGCCGCATCCGGCCTTTGGCGGAGAAAACCGGCATCTGCAAAATTCGGCCGCCCAAGGGGGCCGAAGGC
CAGAGACCAGGATTTGGCTACGGAGGCAGAGCGTCCGACTATAAATCGGCTCACAAGGGATTCAAGGGAGTCGATGCCCAGGGCACGCTT
TCCAAAATTTTTAAGCTGGGAGGAAGAGATAGTCGCTCTGGATCACCCATGGCTAGACGCTGAAAACCCACCTGGTTCCGGAATCCTGTC
CTCAGCTTCTTAATATAACTGCCTTAAAACTTTAATCCCACTTGCCCCTGTTACCTAATTAGAGCAGATGACCCCTCCCCTAATGCCTGC
GGAGTTGTGCACGTAGTAGGGTCAGGCCACGGCAGCCTACCGGCAATTTCCGGCCAACAGTTAAATGAGAACATGAAAACAGAAAACGGT
TAAAACTGTCCCTTTCTGTGTGAAGATCACGTTCCTTCCCCCGCAATGTGCCCCCAGACGCACGTGGGTCTTCAGGGGGCCAGGTGCACA
GACGTCCCTCCACGTTCACCCCTCCACCCTTGGACTTTCTTTTCGCCGTGGCTGCGGCACCCTTGCGCTTTTGCTGGTCACTGCCATGGA
GGCACACAGCTGCAGAGACAGAGAGGACGTGGGCGGCAGAGAGGACTGTTGACATCCAAGCTTCCTTTGTTTTTTTTTCCTGTCCTTCTC
TCACCTCCTAAAGTAGACTTCATTTTTCCTAACAGGATTAGACAGTCAAGGAGTGGCTTACTACATGTGGGAGCTTTTGGTATGTGACAT
GCGGGCTGGGCAGCTGTTAGAGTCCAACGTGGGGCAGCACAGAGAGGGGGCCACCTCCCCAGGCCGTGGCTGCCCACACACCCCAATTAG
CTGAATTCGCGTGTGGCAGAGGGAGGAAAAGGAGGCAAACGTGGGCTGGGCAATGGCCTCACATAGGAAACAGGGTCTTCCTGGAGATTT
GGTGATGGAGATGTCAAGCAGGTGGCCTCTGGACGTCACCGTTGCCCTGCATGGTGGCCCCAGAGCAGCCTCTATGAACAACCTCGTTTC
CAAACCACAGCCCACAGCCGGAGAGTCCAGGAAGACTTGCGCACTCAGAGCAGAAGGGTAGGAGTCCTCTAGACAGCCTCGCAGCCGCGC
CAGTCGCCCATAGACACTGGCTGTGACCGGGCGTGCTGGCAGCGGCAGTGCACAGTGGCCAGCACTAACCCTCCCTGAGAAGATAACCGG
CTCATTCACTTCCTCCCAGAAGACGCGTGGTAGCGAGTAGGCACAGGCGTGCACCTGCTCCCGAATTACTCACCGAGACACACGGGCTGA
GCAGACGGCCCCGTGGATGGAGACAAAGAGCTCTTCTGACCATATCCTTCTTAACACCCGCTGGCATCTCCTTTCGCGCCTCCCTCCCTA
ACCTACTGACCCACCTTTTGATTTTAGCGCACCTGTGATTGATAGGCCTTCCAAAGAGTCCCACGCTGGCATCACCCTCCCCGAGGACGG
AGATGAGGAGTAGTCAGCGTGATGCCAAAACGCGTCTTCTTAATCCAATTCTAATTCTGAATGTTTCGTGTGGGCTTAATACCATGTCTA
TTAATATATAGCCTCGATGATGAGAGAGTTACAAAGAACAAAACTCCAGACACAAACCTCCAAATTTTTCAGCAGAAGCACTCTGCGTCG
CTGAGCTGAGGTCGGCTCTGCGATCCATACGTGGCCGCACCCACACAGCACGTGCTGTGACGATGGCTGAACGGAAAGTGTACACTGTTC

>In-frame_KDM5A_ENST00000399788_chr12_498092_-_MBP_ENST00000397865_chr18_74696852_-_2259nt
GCAGAACTTTGGCGGGCAAGGAGACAAACAGCCACACTGTGCTGCCGGGGAAGAGAAGAAGAAGGAAAGGCCAGACACACAGGCGTCGTG
CAGCTGCGGAAGGATTCCGTTTCCTGCAGGGGGCGGAGGGATTTGACAGCACGGTAACTTCCGGAAAAGTCCTGAACCTCAGTGGAAAAG
CCTTGCAAGAAACAATAACAAACGGGAGGAGGAAGCGATTCTGGGGTTTCTGTGTTGAACGGTTCTTGTCCGCGAAGATGCGCTTCGGCC
TCTGTCAGGGGACTTGAACGGGCTTAGTGGGCTTCAGCCAGCTTTTCTCCACCGGTTCCCCACGGGGACCCCCCCCCCCCCCCGGCCGTT
GCAATGGCGGGCGTGGGGCCGGGGGGCTACGCGGCGGAGTTCGTGCCACCGCCAGAGTGCCCCGTCTTTGAGCCGAGTTGGGAGGAGTTC
ACAGATCCGCTCAGCTTTATCGGCCGCATCCGGCCTTTGGCGGAGAAAACCGGCATCTGCAAAATTCGGCCGCCCAAGGGGGCCGAAGGC
CAGAGACCAGGATTTGGCTACGGAGGCAGAGCGTCCGACTATAAATCGGCTCACAAGGGATTCAAGGGAGTCGATGCCCAGGGCACGCTT
TCCAAAATTTTTAAGCTGGGAGGAAGAGATAGTCGCTCTGGATCACCCATGGCTAGACGCTGAAAACCCACCTGGTTCCGGAATCCTGTC
CTCAGCTTCTTAATATAACTGCCTTAAAACTTTAATCCCACTTGCCCCTGTTACCTAATTAGAGCAGATGACCCCTCCCCTAATGCCTGC
GGAGTTGTGCACGTAGTAGGGTCAGGCCACGGCAGCCTACCGGCAATTTCCGGCCAACAGTTAAATGAGAACATGAAAACAGAAAACGGT
TAAAACTGTCCCTTTCTGTGTGAAGATCACGTTCCTTCCCCCGCAATGTGCCCCCAGACGCACGTGGGTCTTCAGGGGGCCAGGTGCACA
GACGTCCCTCCACGTTCACCCCTCCACCCTTGGACTTTCTTTTCGCCGTGGCTGCGGCACCCTTGCGCTTTTGCTGGTCACTGCCATGGA
GGCACACAGCTGCAGAGACAGAGAGGACGTGGGCGGCAGAGAGGACTGTTGACATCCAAGCTTCCTTTGTTTTTTTTTCCTGTCCTTCTC
TCACCTCCTAAAGTAGACTTCATTTTTCCTAACAGGATTAGACAGTCAAGGAGTGGCTTACTACATGTGGGAGCTTTTGGTATGTGACAT
GCGGGCTGGGCAGCTGTTAGAGTCCAACGTGGGGCAGCACAGAGAGGGGGCCACCTCCCCAGGCCGTGGCTGCCCACACACCCCAATTAG
CTGAATTCGCGTGTGGCAGAGGGAGGAAAAGGAGGCAAACGTGGGCTGGGCAATGGCCTCACATAGGAAACAGGGTCTTCCTGGAGATTT
GGTGATGGAGATGTCAAGCAGGTGGCCTCTGGACGTCACCGTTGCCCTGCATGGTGGCCCCAGAGCAGCCTCTATGAACAACCTCGTTTC
CAAACCACAGCCCACAGCCGGAGAGTCCAGGAAGACTTGCGCACTCAGAGCAGAAGGGTAGGAGTCCTCTAGACAGCCTCGCAGCCGCGC
CAGTCGCCCATAGACACTGGCTGTGACCGGGCGTGCTGGCAGCGGCAGTGCACAGTGGCCAGCACTAACCCTCCCTGAGAAGATAACCGG
CTCATTCACTTCCTCCCAGAAGACGCGTGGTAGCGAGTAGGCACAGGCGTGCACCTGCTCCCGAATTACTCACCGAGACACACGGGCTGA
GCAGACGGCCCCGTGGATGGAGACAAAGAGCTCTTCTGACCATATCCTTCTTAACACCCGCTGGCATCTCCTTTCGCGCCTCCCTCCCTA
ACCTACTGACCCACCTTTTGATTTTAGCGCACCTGTGATTGATAGGCCTTCCAAAGAGTCCCACGCTGGCATCACCCTCCCCGAGGACGG
AGATGAGGAGTAGTCAGCGTGATGCCAAAACGCGTCTTCTTAATCCAATTCTAATTCTGAATGTTTCGTGTGGGCTTAATACCATGTCTA
TTAATATATAGCCTCGATGATGAGAGAGTTACAAAGAACAAAACTCCAGACACAAACCTCCAAATTTTTCAGCAGAAGCACTCTGCGTCG
CTGAGCTGAGGTCGGCTCTGCGATCCATACGTGGCCGCACCCACACAGCACGTGCTGTGACGATGGCTGAACGGAAAGTGTACACTGTTC

>In-frame_KDM5A_ENST00000382815_chr12_498092_-_MBP_ENST00000382582_chr18_74696852_-_2293nt
GCAGAACTTTGGCGGGCAAGGAGACAAACAGCCACACTGTGCTGCCGGGGAAGAGAAGAAGAAGGAAAGGCCAGACACACAGGCGTCGTG
CAGCTGCGGAAGGATTCCGTTTCCTGCAGGGGGCGGAGGGATTTGACAGCACGGTAACTTCCGGAAAAGTCCTGAACCTCAGTGGAAAAG
CCTTGCAAGAAACAATAACAAACGGGAGGAGGAAGCGATTCTGGGGTTTCTGTGTTGAACGGTTCTTGTCCGCGAAGATGCGCTTCGGCC
TCTGTCAGGGGACTTGAACGGGCTTAGTGGGCTTCAGCCAGCTTTTCTCCACCGGTTCCCCACGGGGACCCCCCCCCCCCCCCGGCCGTT
GCAATGGCGGGCGTGGGGCCGGGGGGCTACGCGGCGGAGTTCGTGCCACCGCCAGAGTGCCCCGTCTTTGAGCCGAGTTGGGAGGAGTTC
ACAGATCCGCTCAGCTTTATCGGCCGCATCCGGCCTTTGGCGGAGAAAACCGGCATCTGCAAAATTCGGCCGCCCAAGGGGGCCGAAGGC
CAGAGACCAGGATTTGGCTACGGAGGCAGAGCGTCCGACTATAAATCGGCTCACAAGGGATTCAAGGGAGTCGATGCCCAGGGCACGCTT
TCCAAAATTTTTAAGCTGGGAGGAAGAGATAGTCGCTCTGGATCACCCATGGCTAGACGCTGAAAACCCACCTGGTTCCGGAATCCTGTC
CTCAGCTTCTTAATATAACTGCCTTAAAACTTTAATCCCACTTGCCCCTGTTACCTAATTAGAGCAGATGACCCCTCCCCTAATGCCTGC
GGAGTTGTGCACGTAGTAGGGTCAGGCCACGGCAGCCTACCGGCAATTTCCGGCCAACAGTTAAATGAGAACATGAAAACAGAAAACGGT
TAAAACTGTCCCTTTCTGTGTGAAGATCACGTTCCTTCCCCCGCAATGTGCCCCCAGACGCACGTGGGTCTTCAGGGGGCCAGGTGCACA
GACGTCCCTCCACGTTCACCCCTCCACCCTTGGACTTTCTTTTCGCCGTGGCTGCGGCACCCTTGCGCTTTTGCTGGTCACTGCCATGGA
GGCACACAGCTGCAGAGACAGAGAGGACGTGGGCGGCAGAGAGGACTGTTGACATCCAAGCTTCCTTTGTTTTTTTTTCCTGTCCTTCTC
TCACCTCCTAAAGTAGACTTCATTTTTCCTAACAGGATTAGACAGTCAAGGAGTGGCTTACTACATGTGGGAGCTTTTGGTATGTGACAT
GCGGGCTGGGCAGCTGTTAGAGTCCAACGTGGGGCAGCACAGAGAGGGGGCCACCTCCCCAGGCCGTGGCTGCCCACACACCCCAATTAG
CTGAATTCGCGTGTGGCAGAGGGAGGAAAAGGAGGCAAACGTGGGCTGGGCAATGGCCTCACATAGGAAACAGGGTCTTCCTGGAGATTT
GGTGATGGAGATGTCAAGCAGGTGGCCTCTGGACGTCACCGTTGCCCTGCATGGTGGCCCCAGAGCAGCCTCTATGAACAACCTCGTTTC
CAAACCACAGCCCACAGCCGGAGAGTCCAGGAAGACTTGCGCACTCAGAGCAGAAGGGTAGGAGTCCTCTAGACAGCCTCGCAGCCGCGC
CAGTCGCCCATAGACACTGGCTGTGACCGGGCGTGCTGGCAGCGGCAGTGCACAGTGGCCAGCACTAACCCTCCCTGAGAAGATAACCGG
CTCATTCACTTCCTCCCAGAAGACGCGTGGTAGCGAGTAGGCACAGGCGTGCACCTGCTCCCGAATTACTCACCGAGACACACGGGCTGA
GCAGACGGCCCCGTGGATGGAGACAAAGAGCTCTTCTGACCATATCCTTCTTAACACCCGCTGGCATCTCCTTTCGCGCCTCCCTCCCTA
ACCTACTGACCCACCTTTTGATTTTAGCGCACCTGTGATTGATAGGCCTTCCAAAGAGTCCCACGCTGGCATCACCCTCCCCGAGGACGG
AGATGAGGAGTAGTCAGCGTGATGCCAAAACGCGTCTTCTTAATCCAATTCTAATTCTGAATGTTTCGTGTGGGCTTAATACCATGTCTA
TTAATATATAGCCTCGATGATGAGAGAGTTACAAAGAACAAAACTCCAGACACAAACCTCCAAATTTTTCAGCAGAAGCACTCTGCGTCG
CTGAGCTGAGGTCGGCTCTGCGATCCATACGTGGCCGCACCCACACAGCACGTGCTGTGACGATGGCTGAACGGAAAGTGTACACTGTTC

>In-frame_KDM5A_ENST00000382815_chr12_498092_-_MBP_ENST00000355994_chr18_74696852_-_2286nt
GCAGAACTTTGGCGGGCAAGGAGACAAACAGCCACACTGTGCTGCCGGGGAAGAGAAGAAGAAGGAAAGGCCAGACACACAGGCGTCGTG
CAGCTGCGGAAGGATTCCGTTTCCTGCAGGGGGCGGAGGGATTTGACAGCACGGTAACTTCCGGAAAAGTCCTGAACCTCAGTGGAAAAG
CCTTGCAAGAAACAATAACAAACGGGAGGAGGAAGCGATTCTGGGGTTTCTGTGTTGAACGGTTCTTGTCCGCGAAGATGCGCTTCGGCC
TCTGTCAGGGGACTTGAACGGGCTTAGTGGGCTTCAGCCAGCTTTTCTCCACCGGTTCCCCACGGGGACCCCCCCCCCCCCCCGGCCGTT
GCAATGGCGGGCGTGGGGCCGGGGGGCTACGCGGCGGAGTTCGTGCCACCGCCAGAGTGCCCCGTCTTTGAGCCGAGTTGGGAGGAGTTC
ACAGATCCGCTCAGCTTTATCGGCCGCATCCGGCCTTTGGCGGAGAAAACCGGCATCTGCAAAATTCGGCCGCCCAAGGGGGCCGAAGGC
CAGAGACCAGGATTTGGCTACGGAGGCAGAGCGTCCGACTATAAATCGGCTCACAAGGGATTCAAGGGAGTCGATGCCCAGGGCACGCTT
TCCAAAATTTTTAAGCTGGGAGGAAGAGATAGTCGCTCTGGATCACCCATGGCTAGACGCTGAAAACCCACCTGGTTCCGGAATCCTGTC
CTCAGCTTCTTAATATAACTGCCTTAAAACTTTAATCCCACTTGCCCCTGTTACCTAATTAGAGCAGATGACCCCTCCCCTAATGCCTGC
GGAGTTGTGCACGTAGTAGGGTCAGGCCACGGCAGCCTACCGGCAATTTCCGGCCAACAGTTAAATGAGAACATGAAAACAGAAAACGGT
TAAAACTGTCCCTTTCTGTGTGAAGATCACGTTCCTTCCCCCGCAATGTGCCCCCAGACGCACGTGGGTCTTCAGGGGGCCAGGTGCACA
GACGTCCCTCCACGTTCACCCCTCCACCCTTGGACTTTCTTTTCGCCGTGGCTGCGGCACCCTTGCGCTTTTGCTGGTCACTGCCATGGA
GGCACACAGCTGCAGAGACAGAGAGGACGTGGGCGGCAGAGAGGACTGTTGACATCCAAGCTTCCTTTGTTTTTTTTTCCTGTCCTTCTC
TCACCTCCTAAAGTAGACTTCATTTTTCCTAACAGGATTAGACAGTCAAGGAGTGGCTTACTACATGTGGGAGCTTTTGGTATGTGACAT
GCGGGCTGGGCAGCTGTTAGAGTCCAACGTGGGGCAGCACAGAGAGGGGGCCACCTCCCCAGGCCGTGGCTGCCCACACACCCCAATTAG
CTGAATTCGCGTGTGGCAGAGGGAGGAAAAGGAGGCAAACGTGGGCTGGGCAATGGCCTCACATAGGAAACAGGGTCTTCCTGGAGATTT
GGTGATGGAGATGTCAAGCAGGTGGCCTCTGGACGTCACCGTTGCCCTGCATGGTGGCCCCAGAGCAGCCTCTATGAACAACCTCGTTTC
CAAACCACAGCCCACAGCCGGAGAGTCCAGGAAGACTTGCGCACTCAGAGCAGAAGGGTAGGAGTCCTCTAGACAGCCTCGCAGCCGCGC
CAGTCGCCCATAGACACTGGCTGTGACCGGGCGTGCTGGCAGCGGCAGTGCACAGTGGCCAGCACTAACCCTCCCTGAGAAGATAACCGG
CTCATTCACTTCCTCCCAGAAGACGCGTGGTAGCGAGTAGGCACAGGCGTGCACCTGCTCCCGAATTACTCACCGAGACACACGGGCTGA
GCAGACGGCCCCGTGGATGGAGACAAAGAGCTCTTCTGACCATATCCTTCTTAACACCCGCTGGCATCTCCTTTCGCGCCTCCCTCCCTA
ACCTACTGACCCACCTTTTGATTTTAGCGCACCTGTGATTGATAGGCCTTCCAAAGAGTCCCACGCTGGCATCACCCTCCCCGAGGACGG
AGATGAGGAGTAGTCAGCGTGATGCCAAAACGCGTCTTCTTAATCCAATTCTAATTCTGAATGTTTCGTGTGGGCTTAATACCATGTCTA
TTAATATATAGCCTCGATGATGAGAGAGTTACAAAGAACAAAACTCCAGACACAAACCTCCAAATTTTTCAGCAGAAGCACTCTGCGTCG
CTGAGCTGAGGTCGGCTCTGCGATCCATACGTGGCCGCACCCACACAGCACGTGCTGTGACGATGGCTGAACGGAAAGTGTACACTGTTC

>In-frame_KDM5A_ENST00000382815_chr12_498092_-_MBP_ENST00000397875_chr18_74696852_-_2268nt
GCAGAACTTTGGCGGGCAAGGAGACAAACAGCCACACTGTGCTGCCGGGGAAGAGAAGAAGAAGGAAAGGCCAGACACACAGGCGTCGTG
CAGCTGCGGAAGGATTCCGTTTCCTGCAGGGGGCGGAGGGATTTGACAGCACGGTAACTTCCGGAAAAGTCCTGAACCTCAGTGGAAAAG
CCTTGCAAGAAACAATAACAAACGGGAGGAGGAAGCGATTCTGGGGTTTCTGTGTTGAACGGTTCTTGTCCGCGAAGATGCGCTTCGGCC
TCTGTCAGGGGACTTGAACGGGCTTAGTGGGCTTCAGCCAGCTTTTCTCCACCGGTTCCCCACGGGGACCCCCCCCCCCCCCCGGCCGTT
GCAATGGCGGGCGTGGGGCCGGGGGGCTACGCGGCGGAGTTCGTGCCACCGCCAGAGTGCCCCGTCTTTGAGCCGAGTTGGGAGGAGTTC
ACAGATCCGCTCAGCTTTATCGGCCGCATCCGGCCTTTGGCGGAGAAAACCGGCATCTGCAAAATTCGGCCGCCCAAGGGGGCCGAAGGC
CAGAGACCAGGATTTGGCTACGGAGGCAGAGCGTCCGACTATAAATCGGCTCACAAGGGATTCAAGGGAGTCGATGCCCAGGGCACGCTT
TCCAAAATTTTTAAGCTGGGAGGAAGAGATAGTCGCTCTGGATCACCCATGGCTAGACGCTGAAAACCCACCTGGTTCCGGAATCCTGTC
CTCAGCTTCTTAATATAACTGCCTTAAAACTTTAATCCCACTTGCCCCTGTTACCTAATTAGAGCAGATGACCCCTCCCCTAATGCCTGC
GGAGTTGTGCACGTAGTAGGGTCAGGCCACGGCAGCCTACCGGCAATTTCCGGCCAACAGTTAAATGAGAACATGAAAACAGAAAACGGT
TAAAACTGTCCCTTTCTGTGTGAAGATCACGTTCCTTCCCCCGCAATGTGCCCCCAGACGCACGTGGGTCTTCAGGGGGCCAGGTGCACA
GACGTCCCTCCACGTTCACCCCTCCACCCTTGGACTTTCTTTTCGCCGTGGCTGCGGCACCCTTGCGCTTTTGCTGGTCACTGCCATGGA
GGCACACAGCTGCAGAGACAGAGAGGACGTGGGCGGCAGAGAGGACTGTTGACATCCAAGCTTCCTTTGTTTTTTTTTCCTGTCCTTCTC
TCACCTCCTAAAGTAGACTTCATTTTTCCTAACAGGATTAGACAGTCAAGGAGTGGCTTACTACATGTGGGAGCTTTTGGTATGTGACAT
GCGGGCTGGGCAGCTGTTAGAGTCCAACGTGGGGCAGCACAGAGAGGGGGCCACCTCCCCAGGCCGTGGCTGCCCACACACCCCAATTAG
CTGAATTCGCGTGTGGCAGAGGGAGGAAAAGGAGGCAAACGTGGGCTGGGCAATGGCCTCACATAGGAAACAGGGTCTTCCTGGAGATTT
GGTGATGGAGATGTCAAGCAGGTGGCCTCTGGACGTCACCGTTGCCCTGCATGGTGGCCCCAGAGCAGCCTCTATGAACAACCTCGTTTC
CAAACCACAGCCCACAGCCGGAGAGTCCAGGAAGACTTGCGCACTCAGAGCAGAAGGGTAGGAGTCCTCTAGACAGCCTCGCAGCCGCGC
CAGTCGCCCATAGACACTGGCTGTGACCGGGCGTGCTGGCAGCGGCAGTGCACAGTGGCCAGCACTAACCCTCCCTGAGAAGATAACCGG
CTCATTCACTTCCTCCCAGAAGACGCGTGGTAGCGAGTAGGCACAGGCGTGCACCTGCTCCCGAATTACTCACCGAGACACACGGGCTGA
GCAGACGGCCCCGTGGATGGAGACAAAGAGCTCTTCTGACCATATCCTTCTTAACACCCGCTGGCATCTCCTTTCGCGCCTCCCTCCCTA
ACCTACTGACCCACCTTTTGATTTTAGCGCACCTGTGATTGATAGGCCTTCCAAAGAGTCCCACGCTGGCATCACCCTCCCCGAGGACGG
AGATGAGGAGTAGTCAGCGTGATGCCAAAACGCGTCTTCTTAATCCAATTCTAATTCTGAATGTTTCGTGTGGGCTTAATACCATGTCTA
TTAATATATAGCCTCGATGATGAGAGAGTTACAAAGAACAAAACTCCAGACACAAACCTCCAAATTTTTCAGCAGAAGCACTCTGCGTCG
CTGAGCTGAGGTCGGCTCTGCGATCCATACGTGGCCGCACCCACACAGCACGTGCTGTGACGATGGCTGAACGGAAAGTGTACACTGTTC

>In-frame_KDM5A_ENST00000382815_chr12_498092_-_MBP_ENST00000397866_chr18_74696852_-_2268nt
GCAGAACTTTGGCGGGCAAGGAGACAAACAGCCACACTGTGCTGCCGGGGAAGAGAAGAAGAAGGAAAGGCCAGACACACAGGCGTCGTG
CAGCTGCGGAAGGATTCCGTTTCCTGCAGGGGGCGGAGGGATTTGACAGCACGGTAACTTCCGGAAAAGTCCTGAACCTCAGTGGAAAAG
CCTTGCAAGAAACAATAACAAACGGGAGGAGGAAGCGATTCTGGGGTTTCTGTGTTGAACGGTTCTTGTCCGCGAAGATGCGCTTCGGCC
TCTGTCAGGGGACTTGAACGGGCTTAGTGGGCTTCAGCCAGCTTTTCTCCACCGGTTCCCCACGGGGACCCCCCCCCCCCCCCGGCCGTT
GCAATGGCGGGCGTGGGGCCGGGGGGCTACGCGGCGGAGTTCGTGCCACCGCCAGAGTGCCCCGTCTTTGAGCCGAGTTGGGAGGAGTTC
ACAGATCCGCTCAGCTTTATCGGCCGCATCCGGCCTTTGGCGGAGAAAACCGGCATCTGCAAAATTCGGCCGCCCAAGGGGGCCGAAGGC
CAGAGACCAGGATTTGGCTACGGAGGCAGAGCGTCCGACTATAAATCGGCTCACAAGGGATTCAAGGGAGTCGATGCCCAGGGCACGCTT
TCCAAAATTTTTAAGCTGGGAGGAAGAGATAGTCGCTCTGGATCACCCATGGCTAGACGCTGAAAACCCACCTGGTTCCGGAATCCTGTC
CTCAGCTTCTTAATATAACTGCCTTAAAACTTTAATCCCACTTGCCCCTGTTACCTAATTAGAGCAGATGACCCCTCCCCTAATGCCTGC
GGAGTTGTGCACGTAGTAGGGTCAGGCCACGGCAGCCTACCGGCAATTTCCGGCCAACAGTTAAATGAGAACATGAAAACAGAAAACGGT
TAAAACTGTCCCTTTCTGTGTGAAGATCACGTTCCTTCCCCCGCAATGTGCCCCCAGACGCACGTGGGTCTTCAGGGGGCCAGGTGCACA
GACGTCCCTCCACGTTCACCCCTCCACCCTTGGACTTTCTTTTCGCCGTGGCTGCGGCACCCTTGCGCTTTTGCTGGTCACTGCCATGGA
GGCACACAGCTGCAGAGACAGAGAGGACGTGGGCGGCAGAGAGGACTGTTGACATCCAAGCTTCCTTTGTTTTTTTTTCCTGTCCTTCTC
TCACCTCCTAAAGTAGACTTCATTTTTCCTAACAGGATTAGACAGTCAAGGAGTGGCTTACTACATGTGGGAGCTTTTGGTATGTGACAT
GCGGGCTGGGCAGCTGTTAGAGTCCAACGTGGGGCAGCACAGAGAGGGGGCCACCTCCCCAGGCCGTGGCTGCCCACACACCCCAATTAG
CTGAATTCGCGTGTGGCAGAGGGAGGAAAAGGAGGCAAACGTGGGCTGGGCAATGGCCTCACATAGGAAACAGGGTCTTCCTGGAGATTT
GGTGATGGAGATGTCAAGCAGGTGGCCTCTGGACGTCACCGTTGCCCTGCATGGTGGCCCCAGAGCAGCCTCTATGAACAACCTCGTTTC
CAAACCACAGCCCACAGCCGGAGAGTCCAGGAAGACTTGCGCACTCAGAGCAGAAGGGTAGGAGTCCTCTAGACAGCCTCGCAGCCGCGC
CAGTCGCCCATAGACACTGGCTGTGACCGGGCGTGCTGGCAGCGGCAGTGCACAGTGGCCAGCACTAACCCTCCCTGAGAAGATAACCGG
CTCATTCACTTCCTCCCAGAAGACGCGTGGTAGCGAGTAGGCACAGGCGTGCACCTGCTCCCGAATTACTCACCGAGACACACGGGCTGA
GCAGACGGCCCCGTGGATGGAGACAAAGAGCTCTTCTGACCATATCCTTCTTAACACCCGCTGGCATCTCCTTTCGCGCCTCCCTCCCTA
ACCTACTGACCCACCTTTTGATTTTAGCGCACCTGTGATTGATAGGCCTTCCAAAGAGTCCCACGCTGGCATCACCCTCCCCGAGGACGG
AGATGAGGAGTAGTCAGCGTGATGCCAAAACGCGTCTTCTTAATCCAATTCTAATTCTGAATGTTTCGTGTGGGCTTAATACCATGTCTA
TTAATATATAGCCTCGATGATGAGAGAGTTACAAAGAACAAAACTCCAGACACAAACCTCCAAATTTTTCAGCAGAAGCACTCTGCGTCG
CTGAGCTGAGGTCGGCTCTGCGATCCATACGTGGCCGCACCCACACAGCACGTGCTGTGACGATGGCTGAACGGAAAGTGTACACTGTTC

>In-frame_KDM5A_ENST00000382815_chr12_498092_-_MBP_ENST00000397865_chr18_74696852_-_2259nt
GCAGAACTTTGGCGGGCAAGGAGACAAACAGCCACACTGTGCTGCCGGGGAAGAGAAGAAGAAGGAAAGGCCAGACACACAGGCGTCGTG
CAGCTGCGGAAGGATTCCGTTTCCTGCAGGGGGCGGAGGGATTTGACAGCACGGTAACTTCCGGAAAAGTCCTGAACCTCAGTGGAAAAG
CCTTGCAAGAAACAATAACAAACGGGAGGAGGAAGCGATTCTGGGGTTTCTGTGTTGAACGGTTCTTGTCCGCGAAGATGCGCTTCGGCC
TCTGTCAGGGGACTTGAACGGGCTTAGTGGGCTTCAGCCAGCTTTTCTCCACCGGTTCCCCACGGGGACCCCCCCCCCCCCCCGGCCGTT
GCAATGGCGGGCGTGGGGCCGGGGGGCTACGCGGCGGAGTTCGTGCCACCGCCAGAGTGCCCCGTCTTTGAGCCGAGTTGGGAGGAGTTC
ACAGATCCGCTCAGCTTTATCGGCCGCATCCGGCCTTTGGCGGAGAAAACCGGCATCTGCAAAATTCGGCCGCCCAAGGGGGCCGAAGGC
CAGAGACCAGGATTTGGCTACGGAGGCAGAGCGTCCGACTATAAATCGGCTCACAAGGGATTCAAGGGAGTCGATGCCCAGGGCACGCTT
TCCAAAATTTTTAAGCTGGGAGGAAGAGATAGTCGCTCTGGATCACCCATGGCTAGACGCTGAAAACCCACCTGGTTCCGGAATCCTGTC
CTCAGCTTCTTAATATAACTGCCTTAAAACTTTAATCCCACTTGCCCCTGTTACCTAATTAGAGCAGATGACCCCTCCCCTAATGCCTGC
GGAGTTGTGCACGTAGTAGGGTCAGGCCACGGCAGCCTACCGGCAATTTCCGGCCAACAGTTAAATGAGAACATGAAAACAGAAAACGGT
TAAAACTGTCCCTTTCTGTGTGAAGATCACGTTCCTTCCCCCGCAATGTGCCCCCAGACGCACGTGGGTCTTCAGGGGGCCAGGTGCACA
GACGTCCCTCCACGTTCACCCCTCCACCCTTGGACTTTCTTTTCGCCGTGGCTGCGGCACCCTTGCGCTTTTGCTGGTCACTGCCATGGA
GGCACACAGCTGCAGAGACAGAGAGGACGTGGGCGGCAGAGAGGACTGTTGACATCCAAGCTTCCTTTGTTTTTTTTTCCTGTCCTTCTC
TCACCTCCTAAAGTAGACTTCATTTTTCCTAACAGGATTAGACAGTCAAGGAGTGGCTTACTACATGTGGGAGCTTTTGGTATGTGACAT
GCGGGCTGGGCAGCTGTTAGAGTCCAACGTGGGGCAGCACAGAGAGGGGGCCACCTCCCCAGGCCGTGGCTGCCCACACACCCCAATTAG
CTGAATTCGCGTGTGGCAGAGGGAGGAAAAGGAGGCAAACGTGGGCTGGGCAATGGCCTCACATAGGAAACAGGGTCTTCCTGGAGATTT
GGTGATGGAGATGTCAAGCAGGTGGCCTCTGGACGTCACCGTTGCCCTGCATGGTGGCCCCAGAGCAGCCTCTATGAACAACCTCGTTTC
CAAACCACAGCCCACAGCCGGAGAGTCCAGGAAGACTTGCGCACTCAGAGCAGAAGGGTAGGAGTCCTCTAGACAGCCTCGCAGCCGCGC
CAGTCGCCCATAGACACTGGCTGTGACCGGGCGTGCTGGCAGCGGCAGTGCACAGTGGCCAGCACTAACCCTCCCTGAGAAGATAACCGG
CTCATTCACTTCCTCCCAGAAGACGCGTGGTAGCGAGTAGGCACAGGCGTGCACCTGCTCCCGAATTACTCACCGAGACACACGGGCTGA
GCAGACGGCCCCGTGGATGGAGACAAAGAGCTCTTCTGACCATATCCTTCTTAACACCCGCTGGCATCTCCTTTCGCGCCTCCCTCCCTA
ACCTACTGACCCACCTTTTGATTTTAGCGCACCTGTGATTGATAGGCCTTCCAAAGAGTCCCACGCTGGCATCACCCTCCCCGAGGACGG
AGATGAGGAGTAGTCAGCGTGATGCCAAAACGCGTCTTCTTAATCCAATTCTAATTCTGAATGTTTCGTGTGGGCTTAATACCATGTCTA
TTAATATATAGCCTCGATGATGAGAGAGTTACAAAGAACAAAACTCCAGACACAAACCTCCAAATTTTTCAGCAGAAGCACTCTGCGTCG
CTGAGCTGAGGTCGGCTCTGCGATCCATACGTGGCCGCACCCACACAGCACGTGCTGTGACGATGGCTGAACGGAAAGTGTACACTGTTC


Top

FusionGenePPI for KDM5A_MBP


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
KDM5ALMO2, ESR1, RARA, NR3C1, VDR, RB1, TBP, RBL1, HIST2H3A, MXD1, EZH2, EED, SUZ12, MORF4L1, MORF4L2, SIN3B, HDAC2, RBPJ, HDAC1, HIST3H3, GATAD1, RBBP7, TM9SF4, PHF12, FOXK2, C11orf30, ZNF131, TRIM25MBPTRPM7, PRMT5, STK39, HLA-DRA, PLP1, TSSK6, IRAK4, PRKCA, PRKCI, PRKCZ, PPP2R5C, LIMK1, LIMK2, TBK1, IKBKE, STK3, APTX, ATN1, ATXN1, MAPK14, LRRK2, PRKDC, MAPK12, MAPK11, MAPK13, MAPK3, MAPK1, CDK1, CDK5, MAP3K5, TLK1, RPS6KA6, DDX58, MELK, CDK7, CDK8, CDK9, HIPK2, SQSTM1, PKN1, ULK1, PRKCB, MAP3K3, CTDSP1, ABL1, MUS81, RPS6KA5, MYH6, MAP3K1, MAPK8, CTDSPL, NLN, IDE, PTPRA, PRKCD


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for KDM5A_MBP


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for KDM5A_MBP


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneKDM5AC3714756Intellectual Disability1CTD_human
TgeneMBPC0036341Schizophrenia4PSYGENET
TgeneMBPC0014072Experimental Autoimmune Encephalomyelitis3CTD_human
TgeneMBPC0001973Alcoholic Intoxication, Chronic1PSYGENET
TgeneMBPC0011303Demyelinating Diseases1CTD_human
TgeneMBPC0027873Neuromyelitis Optica1CTD_human