FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 18354

FusionGeneSummary for KCTD13_ICA1

check button Fusion gene summary
Fusion gene informationFusion gene name: KCTD13_ICA1
Fusion gene ID: 18354
HgeneTgene
Gene symbol

KCTD13

ICA1

Gene ID

253980

3382

Gene namepotassium channel tetramerization domain containing 13islet cell autoantigen 1
SynonymsBACURD1|FKSG86|PDIP1|POLDIP1|hBACURD1ICA69|ICAp69
Cytomap

16p11.2

7p21.3

Type of geneprotein-codingprotein-coding
DescriptionBTB/POZ domain-containing adapter for CUL3-mediated RhoA degradation protein 1BTB/POZ domain-containing protein KCTD13CTD-2574D22.4TNFAIP1-like proteinpolymerase delta-interacting protein 1potassium channel tetramerisation domain containing 13islet cell autoantigen 169 kDa islet cell autoantigendiabetes mellitus type I autoantigenislet cell autoantigen 1 isoformislet cell autoantigen 1, 69kDaislet cell autoantigen p69p69testicular tissue protein Li 162
Modification date2018052220180519
UniProtAcc

Q8WZ19

Q05084

Ensembl transtripts involved in fusion geneENST00000568000, ENST00000561540, 
ENST00000568721, 
ENST00000402384, 
ENST00000406470, ENST00000265577, 
ENST00000396675, ENST00000401396, 
ENST00000422063, ENST00000407906, 
ENST00000476942, 
Fusion gene scores* DoF score1 X 1 X 1=14 X 3 X 4=48
# samples 14
** MAII scorelog2(1/1*10)=3.32192809488736log2(4/48*10)=-0.263034405833794
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: KCTD13 [Title/Abstract] AND ICA1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneKCTD13

GO:0016567

protein ubiquitination

19782033

HgeneKCTD13

GO:0043161

proteasome-mediated ubiquitin-dependent protein catabolic process

19782033


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDCOADTCGA-A6-3809-01AKCTD13chr16

29934511

-ICA1chr7

8183602

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000568000ENST00000402384KCTD13chr16

29934511

-ICA1chr7

8183602

-
In-frameENST00000568000ENST00000406470KCTD13chr16

29934511

-ICA1chr7

8183602

-
In-frameENST00000568000ENST00000265577KCTD13chr16

29934511

-ICA1chr7

8183602

-
In-frameENST00000568000ENST00000396675KCTD13chr16

29934511

-ICA1chr7

8183602

-
In-frameENST00000568000ENST00000401396KCTD13chr16

29934511

-ICA1chr7

8183602

-
In-frameENST00000568000ENST00000422063KCTD13chr16

29934511

-ICA1chr7

8183602

-
5CDS-intronENST00000568000ENST00000407906KCTD13chr16

29934511

-ICA1chr7

8183602

-
5CDS-intronENST00000568000ENST00000476942KCTD13chr16

29934511

-ICA1chr7

8183602

-
intron-3CDSENST00000561540ENST00000402384KCTD13chr16

29934511

-ICA1chr7

8183602

-
intron-3CDSENST00000561540ENST00000406470KCTD13chr16

29934511

-ICA1chr7

8183602

-
intron-3CDSENST00000561540ENST00000265577KCTD13chr16

29934511

-ICA1chr7

8183602

-
intron-3CDSENST00000561540ENST00000396675KCTD13chr16

29934511

-ICA1chr7

8183602

-
intron-3CDSENST00000561540ENST00000401396KCTD13chr16

29934511

-ICA1chr7

8183602

-
intron-3CDSENST00000561540ENST00000422063KCTD13chr16

29934511

-ICA1chr7

8183602

-
intron-intronENST00000561540ENST00000407906KCTD13chr16

29934511

-ICA1chr7

8183602

-
intron-intronENST00000561540ENST00000476942KCTD13chr16

29934511

-ICA1chr7

8183602

-
intron-3CDSENST00000568721ENST00000402384KCTD13chr16

29934511

-ICA1chr7

8183602

-
intron-3CDSENST00000568721ENST00000406470KCTD13chr16

29934511

-ICA1chr7

8183602

-
intron-3CDSENST00000568721ENST00000265577KCTD13chr16

29934511

-ICA1chr7

8183602

-
intron-3CDSENST00000568721ENST00000396675KCTD13chr16

29934511

-ICA1chr7

8183602

-
intron-3CDSENST00000568721ENST00000401396KCTD13chr16

29934511

-ICA1chr7

8183602

-
intron-3CDSENST00000568721ENST00000422063KCTD13chr16

29934511

-ICA1chr7

8183602

-
intron-intronENST00000568721ENST00000407906KCTD13chr16

29934511

-ICA1chr7

8183602

-
intron-intronENST00000568721ENST00000476942KCTD13chr16

29934511

-ICA1chr7

8183602

-

Top

FusionProtFeatures for KCTD13_ICA1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
KCTD13

Q8WZ19

ICA1

Q05084

Substrate-specific adapter of a BCR (BTB-CUL3-RBX1) E3ubiquitin-protein ligase complex required for synaptictransmission (PubMed:19782033). The BCR(KCTD13) E3 ubiquitinligase complex mediates the ubiquitination of RHOA, leading to itsdegradation by the proteasome (PubMed:19782033) Degradation ofRHOA regulates the actin cytoskeleton and promotes synaptictransmission (By similarity). {ECO:0000250|UniProtKB:Q8BGV7,ECO:0000269|PubMed:19782033}. May play a role in neurotransmitter secretion.{ECO:0000250}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneKCTD13chr16:29934511chr7:8183602ENST00000568000-2641_109138330DomainBTB

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneICA1chr16:29934511chr7:8183602ENST00000396675-71451_254268484DomainAH
TgeneICA1chr16:29934511chr7:8183602ENST00000402384-71451_254268484DomainAH
TgeneICA1chr16:29934511chr7:8183602ENST00000406470-71451_254268484DomainAH
TgeneICA1chr16:29934511chr7:8183602ENST00000422063-61451_254268513DomainAH


Top

FusionGeneSequence for KCTD13_ICA1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_KCTD13_ENST00000568000_chr16_29934511_-_ICA1_ENST00000402384_chr7_8183602_-_354aa
MSAEASGPAAAAAPSLEAPKPSGLEPGPAAYGLKPLTPNSKYVKLNVGGSLHYTTLRTLTGQDTMLKAMFSGRVEVLTDAGGWVLIDRSG
RHFGTILNYLRDGSVPLPESTRELGELLGEARYYLVQGLIEDCQLALQSLQDPMKKLVEKEEKKKINQQESTDAAVQEPSQLISLEEENQ
RKESSSFKTEDGKSILSALDKGSTHTACSGPIDELLDMKSEEGACLGPVAGTPEPEGADKDDLLLLSEIFNASSLEEGEFSKEWAAVFGD

>In-frame_KCTD13_ENST00000568000_chr16_29934511_-_ICA1_ENST00000406470_chr7_8183602_-_354aa
MSAEASGPAAAAAPSLEAPKPSGLEPGPAAYGLKPLTPNSKYVKLNVGGSLHYTTLRTLTGQDTMLKAMFSGRVEVLTDAGGWVLIDRSG
RHFGTILNYLRDGSVPLPESTRELGELLGEARYYLVQGLIEDCQLALQSLQDPMKKLVEKEEKKKINQQESTDAAVQEPSQLISLEEENQ
RKESSSFKTEDGKSILSALDKGSTHTACSGPIDELLDMKSEEGACLGPVAGTPEPEGADKDDLLLLSEIFNASSLEEGEFSKEWAAVFGD

>In-frame_KCTD13_ENST00000568000_chr16_29934511_-_ICA1_ENST00000265577_chr7_8183602_-_354aa
MSAEASGPAAAAAPSLEAPKPSGLEPGPAAYGLKPLTPNSKYVKLNVGGSLHYTTLRTLTGQDTMLKAMFSGRVEVLTDAGGWVLIDRSG
RHFGTILNYLRDGSVPLPESTRELGELLGEARYYLVQGLIEDCQLALQSLQDPMKKLVEKEEKKKINQQESTDAAVQEPSQLISLEEENQ
RKESSSFKTEDGKSILSALDKGSTHTACSGPIDELLDMKSEEGACLGPVAGTPEPEGADKDDLLLLSEIFNASSLEEGEFSKEWAAVFGD

>In-frame_KCTD13_ENST00000568000_chr16_29934511_-_ICA1_ENST00000396675_chr7_8183602_-_354aa
MSAEASGPAAAAAPSLEAPKPSGLEPGPAAYGLKPLTPNSKYVKLNVGGSLHYTTLRTLTGQDTMLKAMFSGRVEVLTDAGGWVLIDRSG
RHFGTILNYLRDGSVPLPESTRELGELLGEARYYLVQGLIEDCQLALQSLQDPMKKLVEKEEKKKINQQESTDAAVQEPSQLISLEEENQ
RKESSSFKTEDGKSILSALDKGSTHTACSGPIDELLDMKSEEGACLGPVAGTPEPEGADKDDLLLLSEIFNASSLEEGEFSKEWAAVFGD

>In-frame_KCTD13_ENST00000568000_chr16_29934511_-_ICA1_ENST00000401396_chr7_8183602_-_354aa
MSAEASGPAAAAAPSLEAPKPSGLEPGPAAYGLKPLTPNSKYVKLNVGGSLHYTTLRTLTGQDTMLKAMFSGRVEVLTDAGGWVLIDRSG
RHFGTILNYLRDGSVPLPESTRELGELLGEARYYLVQGLIEDCQLALQSLQDPMKKLVEKEEKKKINQQESTDAAVQEPSQLISLEEENQ
RKESSSFKTEDGKSILSALDKGSTHTACSGPIDELLDMKSEEGACLGPVAGTPEPEGADKDDLLLLSEIFNASSLEEGEFSKEWAAVFGD

>In-frame_KCTD13_ENST00000568000_chr16_29934511_-_ICA1_ENST00000422063_chr7_8183602_-_383aa
MSAEASGPAAAAAPSLEAPKPSGLEPGPAAYGLKPLTPNSKYVKLNVGGSLHYTTLRTLTGQDTMLKAMFSGRVEVLTDAGGWVLIDRSG
RHFGTILNYLRDGSVPLPESTRELGELLGEARYYLVQGLIEDCQLALQSLQDPMKKLVEKEEKKKINQQESTDAAVQEPSQYLQNICLEM
KANSDIKMLQKGKEGQQIGILISLEEENQRKESSSFKTEDGKSILSALDKGSTHTACSGPIDELLDMKSEEGACLGPVAGTPEPEGADKD
DLLLLSEIFNASSLEEGEFSKEWAAVFGDGQVKEPVPTMALGEPDPKAQTGSGFLPSQLLDQNMKDLQASLQEPAKAASDLTAWFSLFAD


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_KCTD13_ENST00000568000_chr16_29934511_-_ICA1_ENST00000402384_chr7_8183602_-_1062nt
ATGTCGGCGGAGGCCTCGGGCCCGGCTGCCGCCGCGGCCCCGTCCCTGGAAGCCCCCAAGCCCTCGGGTCTCGAGCCTGGCCCCGCCGCC
TACGGTCTCAAGCCGCTGACCCCGAACAGCAAATACGTGAAGCTGAACGTGGGCGGCTCGTTGCACTACACCACGCTGCGCACCCTCACG
GGACAGGACACCATGCTCAAAGCCATGTTCAGCGGCCGCGTGGAGGTGCTGACCGATGCCGGAGGTTGGGTGCTGATTGACCGGAGCGGC
CGTCACTTTGGTACAATCCTCAATTACCTGCGGGATGGGTCTGTGCCACTGCCGGAGAGTACGAGAGAACTGGGGGAGCTGCTGGGCGAA
GCACGCTACTACCTGGTGCAGGGCCTGATTGAGGACTGCCAGCTGGCGCTGCAGAGCTTACAAGACCCTATGAAAAAATTAGTTGAGAAA
GAAGAGAAGAAGAAAATCAACCAGCAGGAAAGTACAGATGCAGCCGTGCAGGAGCCGAGCCAATTAATTTCATTAGAGGAAGAAAACCAG
CGCAAGGAATCCTCTAGTTTTAAGACTGAAGATGGAAAAAGTATTTTATCTGCCTTAGACAAAGGCTCTACACATACTGCATGCTCAGGA
CCCATAGATGAACTATTAGACATGAAATCTGAGGAAGGTGCTTGCCTGGGACCAGTGGCAGGGACCCCGGAACCTGAAGGTGCTGACAAA
GATGACCTGCTGCTGTTGAGTGAGATCTTCAATGCTTCCTCCTTGGAAGAGGGCGAGTTCAGCAAAGAGTGGGCCGCTGTGTTTGGAGAC
GGCCAAGTGAAGGAGCCAGTGCCCACTATGGCCCTGGGAGAGCCAGACCCCAAGGCCCAGACAGGCTCAGGTTTCCTTCCTTCGCAGCTT
TTAGACCAAAATATGAAAGACTTACAGGCCTCGCTACAAGAACCTGCTAAGGCTGCCTCAGACCTGACTGCCTGGTTCAGCCTCTTCGCT

>In-frame_KCTD13_ENST00000568000_chr16_29934511_-_ICA1_ENST00000406470_chr7_8183602_-_1062nt
ATGTCGGCGGAGGCCTCGGGCCCGGCTGCCGCCGCGGCCCCGTCCCTGGAAGCCCCCAAGCCCTCGGGTCTCGAGCCTGGCCCCGCCGCC
TACGGTCTCAAGCCGCTGACCCCGAACAGCAAATACGTGAAGCTGAACGTGGGCGGCTCGTTGCACTACACCACGCTGCGCACCCTCACG
GGACAGGACACCATGCTCAAAGCCATGTTCAGCGGCCGCGTGGAGGTGCTGACCGATGCCGGAGGTTGGGTGCTGATTGACCGGAGCGGC
CGTCACTTTGGTACAATCCTCAATTACCTGCGGGATGGGTCTGTGCCACTGCCGGAGAGTACGAGAGAACTGGGGGAGCTGCTGGGCGAA
GCACGCTACTACCTGGTGCAGGGCCTGATTGAGGACTGCCAGCTGGCGCTGCAGAGCTTACAAGACCCTATGAAAAAATTAGTTGAGAAA
GAAGAGAAGAAGAAAATCAACCAGCAGGAAAGTACAGATGCAGCCGTGCAGGAGCCGAGCCAATTAATTTCATTAGAGGAAGAAAACCAG
CGCAAGGAATCCTCTAGTTTTAAGACTGAAGATGGAAAAAGTATTTTATCTGCCTTAGACAAAGGCTCTACACATACTGCATGCTCAGGA
CCCATAGATGAACTATTAGACATGAAATCTGAGGAAGGTGCTTGCCTGGGACCAGTGGCAGGGACCCCGGAACCTGAAGGTGCTGACAAA
GATGACCTGCTGCTGTTGAGTGAGATCTTCAATGCTTCCTCCTTGGAAGAGGGCGAGTTCAGCAAAGAGTGGGCCGCTGTGTTTGGAGAC
GGCCAAGTGAAGGAGCCAGTGCCCACTATGGCCCTGGGAGAGCCAGACCCCAAGGCCCAGACAGGCTCAGGTTTCCTTCCTTCGCAGCTT
TTAGACCAAAATATGAAAGACTTACAGGCCTCGCTACAAGAACCTGCTAAGGCTGCCTCAGACCTGACTGCCTGGTTCAGCCTCTTCGCT

>In-frame_KCTD13_ENST00000568000_chr16_29934511_-_ICA1_ENST00000265577_chr7_8183602_-_1062nt
ATGTCGGCGGAGGCCTCGGGCCCGGCTGCCGCCGCGGCCCCGTCCCTGGAAGCCCCCAAGCCCTCGGGTCTCGAGCCTGGCCCCGCCGCC
TACGGTCTCAAGCCGCTGACCCCGAACAGCAAATACGTGAAGCTGAACGTGGGCGGCTCGTTGCACTACACCACGCTGCGCACCCTCACG
GGACAGGACACCATGCTCAAAGCCATGTTCAGCGGCCGCGTGGAGGTGCTGACCGATGCCGGAGGTTGGGTGCTGATTGACCGGAGCGGC
CGTCACTTTGGTACAATCCTCAATTACCTGCGGGATGGGTCTGTGCCACTGCCGGAGAGTACGAGAGAACTGGGGGAGCTGCTGGGCGAA
GCACGCTACTACCTGGTGCAGGGCCTGATTGAGGACTGCCAGCTGGCGCTGCAGAGCTTACAAGACCCTATGAAAAAATTAGTTGAGAAA
GAAGAGAAGAAGAAAATCAACCAGCAGGAAAGTACAGATGCAGCCGTGCAGGAGCCGAGCCAATTAATTTCATTAGAGGAAGAAAACCAG
CGCAAGGAATCCTCTAGTTTTAAGACTGAAGATGGAAAAAGTATTTTATCTGCCTTAGACAAAGGCTCTACACATACTGCATGCTCAGGA
CCCATAGATGAACTATTAGACATGAAATCTGAGGAAGGTGCTTGCCTGGGACCAGTGGCAGGGACCCCGGAACCTGAAGGTGCTGACAAA
GATGACCTGCTGCTGTTGAGTGAGATCTTCAATGCTTCCTCCTTGGAAGAGGGCGAGTTCAGCAAAGAGTGGGCCGCTGTGTTTGGAGAC
GGCCAAGTGAAGGAGCCAGTGCCCACTATGGCCCTGGGAGAGCCAGACCCCAAGGCCCAGACAGGCTCAGGTTTCCTTCCTTCGCAGCTT
TTAGACCAAAATATGAAAGACTTACAGGCCTCGCTACAAGAACCTGCTAAGGCTGCCTCAGACCTGACTGCCTGGTTCAGCCTCTTCGCT

>In-frame_KCTD13_ENST00000568000_chr16_29934511_-_ICA1_ENST00000396675_chr7_8183602_-_1062nt
ATGTCGGCGGAGGCCTCGGGCCCGGCTGCCGCCGCGGCCCCGTCCCTGGAAGCCCCCAAGCCCTCGGGTCTCGAGCCTGGCCCCGCCGCC
TACGGTCTCAAGCCGCTGACCCCGAACAGCAAATACGTGAAGCTGAACGTGGGCGGCTCGTTGCACTACACCACGCTGCGCACCCTCACG
GGACAGGACACCATGCTCAAAGCCATGTTCAGCGGCCGCGTGGAGGTGCTGACCGATGCCGGAGGTTGGGTGCTGATTGACCGGAGCGGC
CGTCACTTTGGTACAATCCTCAATTACCTGCGGGATGGGTCTGTGCCACTGCCGGAGAGTACGAGAGAACTGGGGGAGCTGCTGGGCGAA
GCACGCTACTACCTGGTGCAGGGCCTGATTGAGGACTGCCAGCTGGCGCTGCAGAGCTTACAAGACCCTATGAAAAAATTAGTTGAGAAA
GAAGAGAAGAAGAAAATCAACCAGCAGGAAAGTACAGATGCAGCCGTGCAGGAGCCGAGCCAATTAATTTCATTAGAGGAAGAAAACCAG
CGCAAGGAATCCTCTAGTTTTAAGACTGAAGATGGAAAAAGTATTTTATCTGCCTTAGACAAAGGCTCTACACATACTGCATGCTCAGGA
CCCATAGATGAACTATTAGACATGAAATCTGAGGAAGGTGCTTGCCTGGGACCAGTGGCAGGGACCCCGGAACCTGAAGGTGCTGACAAA
GATGACCTGCTGCTGTTGAGTGAGATCTTCAATGCTTCCTCCTTGGAAGAGGGCGAGTTCAGCAAAGAGTGGGCCGCTGTGTTTGGAGAC
GGCCAAGTGAAGGAGCCAGTGCCCACTATGGCCCTGGGAGAGCCAGACCCCAAGGCCCAGACAGGCTCAGGTTTCCTTCCTTCGCAGCTT
TTAGACCAAAATATGAAAGACTTACAGGCCTCGCTACAAGAACCTGCTAAGGCTGCCTCAGACCTGACTGCCTGGTTCAGCCTCTTCGCT

>In-frame_KCTD13_ENST00000568000_chr16_29934511_-_ICA1_ENST00000401396_chr7_8183602_-_1062nt
ATGTCGGCGGAGGCCTCGGGCCCGGCTGCCGCCGCGGCCCCGTCCCTGGAAGCCCCCAAGCCCTCGGGTCTCGAGCCTGGCCCCGCCGCC
TACGGTCTCAAGCCGCTGACCCCGAACAGCAAATACGTGAAGCTGAACGTGGGCGGCTCGTTGCACTACACCACGCTGCGCACCCTCACG
GGACAGGACACCATGCTCAAAGCCATGTTCAGCGGCCGCGTGGAGGTGCTGACCGATGCCGGAGGTTGGGTGCTGATTGACCGGAGCGGC
CGTCACTTTGGTACAATCCTCAATTACCTGCGGGATGGGTCTGTGCCACTGCCGGAGAGTACGAGAGAACTGGGGGAGCTGCTGGGCGAA
GCACGCTACTACCTGGTGCAGGGCCTGATTGAGGACTGCCAGCTGGCGCTGCAGAGCTTACAAGACCCTATGAAAAAATTAGTTGAGAAA
GAAGAGAAGAAGAAAATCAACCAGCAGGAAAGTACAGATGCAGCCGTGCAGGAGCCGAGCCAATTAATTTCATTAGAGGAAGAAAACCAG
CGCAAGGAATCCTCTAGTTTTAAGACTGAAGATGGAAAAAGTATTTTATCTGCCTTAGACAAAGGCTCTACACATACTGCATGCTCAGGA
CCCATAGATGAACTATTAGACATGAAATCTGAGGAAGGTGCTTGCCTGGGACCAGTGGCAGGGACCCCGGAACCTGAAGGTGCTGACAAA
GATGACCTGCTGCTGTTGAGTGAGATCTTCAATGCTTCCTCCTTGGAAGAGGGCGAGTTCAGCAAAGAGTGGGCCGCTGTGTTTGGAGAC
GGCCAAGTGAAGGAGCCAGTGCCCACTATGGCCCTGGGAGAGCCAGACCCCAAGGCCCAGACAGGCTCAGGTTTCCTTCCTTCGCAGCTT
TTAGACCAAAATATGAAAGACTTACAGGCCTCGCTACAAGAACCTGCTAAGGCTGCCTCAGACCTGACTGCCTGGTTCAGCCTCTTCGCT

>In-frame_KCTD13_ENST00000568000_chr16_29934511_-_ICA1_ENST00000422063_chr7_8183602_-_1149nt
ATGTCGGCGGAGGCCTCGGGCCCGGCTGCCGCCGCGGCCCCGTCCCTGGAAGCCCCCAAGCCCTCGGGTCTCGAGCCTGGCCCCGCCGCC
TACGGTCTCAAGCCGCTGACCCCGAACAGCAAATACGTGAAGCTGAACGTGGGCGGCTCGTTGCACTACACCACGCTGCGCACCCTCACG
GGACAGGACACCATGCTCAAAGCCATGTTCAGCGGCCGCGTGGAGGTGCTGACCGATGCCGGAGGTTGGGTGCTGATTGACCGGAGCGGC
CGTCACTTTGGTACAATCCTCAATTACCTGCGGGATGGGTCTGTGCCACTGCCGGAGAGTACGAGAGAACTGGGGGAGCTGCTGGGCGAA
GCACGCTACTACCTGGTGCAGGGCCTGATTGAGGACTGCCAGCTGGCGCTGCAGAGCTTACAAGACCCTATGAAAAAATTAGTTGAGAAA
GAAGAGAAGAAGAAAATCAACCAGCAGGAAAGTACAGATGCAGCCGTGCAGGAGCCGAGCCAATATTTACAGAATATTTGCCTCGAGATG
AAAGCAAATTCAGATATTAAGATGCTACAGAAAGGGAAAGAAGGCCAGCAAATTGGCATATTAATTTCATTAGAGGAAGAAAACCAGCGC
AAGGAATCCTCTAGTTTTAAGACTGAAGATGGAAAAAGTATTTTATCTGCCTTAGACAAAGGCTCTACACATACTGCATGCTCAGGACCC
ATAGATGAACTATTAGACATGAAATCTGAGGAAGGTGCTTGCCTGGGACCAGTGGCAGGGACCCCGGAACCTGAAGGTGCTGACAAAGAT
GACCTGCTGCTGTTGAGTGAGATCTTCAATGCTTCCTCCTTGGAAGAGGGCGAGTTCAGCAAAGAGTGGGCCGCTGTGTTTGGAGACGGC
CAAGTGAAGGAGCCAGTGCCCACTATGGCCCTGGGAGAGCCAGACCCCAAGGCCCAGACAGGCTCAGGTTTCCTTCCTTCGCAGCTTTTA
GACCAAAATATGAAAGACTTACAGGCCTCGCTACAAGAACCTGCTAAGGCTGCCTCAGACCTGACTGCCTGGTTCAGCCTCTTCGCTGAC


* Fusion transcript sequences (Full-length transcript).
>In-frame_KCTD13_ENST00000568000_chr16_29934511_-_ICA1_ENST00000402384_chr7_8183602_-_2803nt
GGGATTGGGTGCTAGGTCCCACGACATTAGCTGGGATTCTAAGACCTTTGCTCAGCTGCTGCGGCCACCACTGACACGCCCTCTGCTCCT
CAAATACGGAGAACAGTTCAGTGTTCCTGCCTGAGGATCTCTGCATTTGCCTTCCCTCTGCCTGGAACTCTTCCCTCACATCCGCTTCCC
AGCTTCAGCTCGGCATCACCTCCTCAGAGAGGCCTTCCATCCTTGGTGCCCGGGCACCACTGCTACCCGTTTTGGCCTCTGTTTTTTTTT
TTTTTTTCAAAGGACGTTATGTTGCCCAGGCTAGAGTGCAACGGTCCGATCACGGATTACTGCAGCTTCCAACTCCTGGCTTCAAGCGCT
CCTTCTGCCTCGGCCTCCCGAGTAGCTAGGCTTACAGGCTGGGGTTACAGGTGTGAGCCACAGCGCCCGGCCGCTTTGGCCTCCTTTAAG
AGCTTCCCTCCGCGCTTTGTTCGCAGTTCTGGTCACAGTCTGTTCAGTGCGCGGGGCTGGGAGGCGGGAAACTGCCCAATGCCCAGACCT
CTCTGTCTGTTTCCCCTCAAGCTCGTGAAGCTCTCTGACAGCAGAGACCCAATCACGAGGTGGAGACTTCGCTTTCCACATCGGGCAGGG
GGTCGGCCGCATCCTCGATCTGGTCCTGGTGACTCGAGACCAGAGAGGAGCGCACGTCGACCCGCCCGGGGAACCCGCAGGCCACACGCC
AAACCTCTACGGGATCCCCCAGCGAGGCCACTGCGCATGCTCCATACTCGCAGCCCCGCCCCCATTCAGGGGCGGGGCCGCGCCTGCGCA
GCTGCCCGGCGCCGGCTTCCGGGTGGTGCGAGCGAGATGGGGCGGAGGGCCGGTCTTGCAGAGTAGCTGCGGTGAGTGGGCGTGTGCGCC
GAGCGGTCTGGCCCAAGGGCTGGGGGCCGGCCGAGGGTCTTCGGGAGCAGGCCGCAGGGCGCGGAGAGATCCTGGGATCGCCGTCCGCCG
CTGCTACCCGGCATGTCGGCGGAGGCCTCGGGCCCGGCTGCCGCCGCGGCCCCGTCCCTGGAAGCCCCCAAGCCCTCGGGTCTCGAGCCT
GGCCCCGCCGCCTACGGTCTCAAGCCGCTGACCCCGAACAGCAAATACGTGAAGCTGAACGTGGGCGGCTCGTTGCACTACACCACGCTG
CGCACCCTCACGGGACAGGACACCATGCTCAAAGCCATGTTCAGCGGCCGCGTGGAGGTGCTGACCGATGCCGGAGGTTGGGTGCTGATT
GACCGGAGCGGCCGTCACTTTGGTACAATCCTCAATTACCTGCGGGATGGGTCTGTGCCACTGCCGGAGAGTACGAGAGAACTGGGGGAG
CTGCTGGGCGAAGCACGCTACTACCTGGTGCAGGGCCTGATTGAGGACTGCCAGCTGGCGCTGCAGAGCTTACAAGACCCTATGAAAAAA
TTAGTTGAGAAAGAAGAGAAGAAGAAAATCAACCAGCAGGAAAGTACAGATGCAGCCGTGCAGGAGCCGAGCCAATTAATTTCATTAGAG
GAAGAAAACCAGCGCAAGGAATCCTCTAGTTTTAAGACTGAAGATGGAAAAAGTATTTTATCTGCCTTAGACAAAGGCTCTACACATACT
GCATGCTCAGGACCCATAGATGAACTATTAGACATGAAATCTGAGGAAGGTGCTTGCCTGGGACCAGTGGCAGGGACCCCGGAACCTGAA
GGTGCTGACAAAGATGACCTGCTGCTGTTGAGTGAGATCTTCAATGCTTCCTCCTTGGAAGAGGGCGAGTTCAGCAAAGAGTGGGCCGCT
GTGTTTGGAGACGGCCAAGTGAAGGAGCCAGTGCCCACTATGGCCCTGGGAGAGCCAGACCCCAAGGCCCAGACAGGCTCAGGTTTCCTT
CCTTCGCAGCTTTTAGACCAAAATATGAAAGACTTACAGGCCTCGCTACAAGAACCTGCTAAGGCTGCCTCAGACCTGACTGCCTGGTTC
AGCCTCTTCGCTGACCTCGACCCACTCTCAAATCCTGATGCTGTTGGGAAAACCGATAAAGAACACGAATTGCTCAATGCATGAATCTGT
ACCCTTCGGGAGGGCACTCACATGCCGCCCCCAGCAGCTCCCCTGGGGGCTAGCAGAAGTATAAAGTGATCAGTATGCTGTTTTAATAAT
TATGTGCCATTTTAATAAAATGAAAGGGTCAACGGCCCTGTTTATATTGGTATAATTATTTACTCTTATTTGGTATAAAGGGTTTTCGTG
TATCTCTATGTGGATCTAAATAATACAGGATTGTCTAGAAGCGGTTTCCAGGCCACCGCTCTCCTGCCTACATCCCATCATGGCTGCTGC
GGTGTCACTGGGCTACCGTGAGATCCAAGTTGAAATCAGAAGCCTACTTTGATGGTAGGTTTGAATGACGTGTCCTACAGCCTCAGAGGC
AGCAGGAGGCTAGCAAAGCTTAAATGCCTCCTTCTCTGCCCCCAGCCTCTGTCCCCCTTGGAGGAGGGCTGTAGGAAGATTCCCTCTTCC
TGCCAAGCCACCTTCCAGTGAGCTCTGGATGAAGCTCTGGCCAACCAAAGACACTGTCCCCACAGCAGGTGCCTGGTGGGCCACGTGTTC
TCACACTGGTGGAGGAGCTGGGCTTCTGTCCAAGGCACAAACCTTACTATGGAAAGCAGCCATATTTGCAGATACCACTGTCTCCTTTTG
TCCTCTTCGTGGCTGGAATTCAAAAGCATGTATTTCTGAAGCCTCTTGTGACATTGTTTTTTTTTTTTTTTTAATTAAACAGAAAAGATA

>In-frame_KCTD13_ENST00000568000_chr16_29934511_-_ICA1_ENST00000406470_chr7_8183602_-_2800nt
GGGATTGGGTGCTAGGTCCCACGACATTAGCTGGGATTCTAAGACCTTTGCTCAGCTGCTGCGGCCACCACTGACACGCCCTCTGCTCCT
CAAATACGGAGAACAGTTCAGTGTTCCTGCCTGAGGATCTCTGCATTTGCCTTCCCTCTGCCTGGAACTCTTCCCTCACATCCGCTTCCC
AGCTTCAGCTCGGCATCACCTCCTCAGAGAGGCCTTCCATCCTTGGTGCCCGGGCACCACTGCTACCCGTTTTGGCCTCTGTTTTTTTTT
TTTTTTTCAAAGGACGTTATGTTGCCCAGGCTAGAGTGCAACGGTCCGATCACGGATTACTGCAGCTTCCAACTCCTGGCTTCAAGCGCT
CCTTCTGCCTCGGCCTCCCGAGTAGCTAGGCTTACAGGCTGGGGTTACAGGTGTGAGCCACAGCGCCCGGCCGCTTTGGCCTCCTTTAAG
AGCTTCCCTCCGCGCTTTGTTCGCAGTTCTGGTCACAGTCTGTTCAGTGCGCGGGGCTGGGAGGCGGGAAACTGCCCAATGCCCAGACCT
CTCTGTCTGTTTCCCCTCAAGCTCGTGAAGCTCTCTGACAGCAGAGACCCAATCACGAGGTGGAGACTTCGCTTTCCACATCGGGCAGGG
GGTCGGCCGCATCCTCGATCTGGTCCTGGTGACTCGAGACCAGAGAGGAGCGCACGTCGACCCGCCCGGGGAACCCGCAGGCCACACGCC
AAACCTCTACGGGATCCCCCAGCGAGGCCACTGCGCATGCTCCATACTCGCAGCCCCGCCCCCATTCAGGGGCGGGGCCGCGCCTGCGCA
GCTGCCCGGCGCCGGCTTCCGGGTGGTGCGAGCGAGATGGGGCGGAGGGCCGGTCTTGCAGAGTAGCTGCGGTGAGTGGGCGTGTGCGCC
GAGCGGTCTGGCCCAAGGGCTGGGGGCCGGCCGAGGGTCTTCGGGAGCAGGCCGCAGGGCGCGGAGAGATCCTGGGATCGCCGTCCGCCG
CTGCTACCCGGCATGTCGGCGGAGGCCTCGGGCCCGGCTGCCGCCGCGGCCCCGTCCCTGGAAGCCCCCAAGCCCTCGGGTCTCGAGCCT
GGCCCCGCCGCCTACGGTCTCAAGCCGCTGACCCCGAACAGCAAATACGTGAAGCTGAACGTGGGCGGCTCGTTGCACTACACCACGCTG
CGCACCCTCACGGGACAGGACACCATGCTCAAAGCCATGTTCAGCGGCCGCGTGGAGGTGCTGACCGATGCCGGAGGTTGGGTGCTGATT
GACCGGAGCGGCCGTCACTTTGGTACAATCCTCAATTACCTGCGGGATGGGTCTGTGCCACTGCCGGAGAGTACGAGAGAACTGGGGGAG
CTGCTGGGCGAAGCACGCTACTACCTGGTGCAGGGCCTGATTGAGGACTGCCAGCTGGCGCTGCAGAGCTTACAAGACCCTATGAAAAAA
TTAGTTGAGAAAGAAGAGAAGAAGAAAATCAACCAGCAGGAAAGTACAGATGCAGCCGTGCAGGAGCCGAGCCAATTAATTTCATTAGAG
GAAGAAAACCAGCGCAAGGAATCCTCTAGTTTTAAGACTGAAGATGGAAAAAGTATTTTATCTGCCTTAGACAAAGGCTCTACACATACT
GCATGCTCAGGACCCATAGATGAACTATTAGACATGAAATCTGAGGAAGGTGCTTGCCTGGGACCAGTGGCAGGGACCCCGGAACCTGAA
GGTGCTGACAAAGATGACCTGCTGCTGTTGAGTGAGATCTTCAATGCTTCCTCCTTGGAAGAGGGCGAGTTCAGCAAAGAGTGGGCCGCT
GTGTTTGGAGACGGCCAAGTGAAGGAGCCAGTGCCCACTATGGCCCTGGGAGAGCCAGACCCCAAGGCCCAGACAGGCTCAGGTTTCCTT
CCTTCGCAGCTTTTAGACCAAAATATGAAAGACTTACAGGCCTCGCTACAAGAACCTGCTAAGGCTGCCTCAGACCTGACTGCCTGGTTC
AGCCTCTTCGCTGACCTCGACCCACTCTCAAATCCTGATGCTGTTGGGAAAACCGATAAAGAACACGAATTGCTCAATGCATGAATCTGT
ACCCTTCGGGAGGGCACTCACATGCCGCCCCCAGCAGCTCCCCTGGGGGCTAGCAGAAGTATAAAGTGATCAGTATGCTGTTTTAATAAT
TATGTGCCATTTTAATAAAATGAAAGGGTCAACGGCCCTGTTTATATTGGTATAATTATTTACTCTTATTTGGTATAAAGGGTTTTCGTG
TATCTCTATGTGGATCTAAATAATACAGGATTGTCTAGAAGCGGTTTCCAGGCCACCGCTCTCCTGCCTACATCCCATCATGGCTGCTGC
GGTGTCACTGGGCTACCGTGAGATCCAAGTTGAAATCAGAAGCCTACTTTGATGGTAGGTTTGAATGACGTGTCCTACAGCCTCAGAGGC
AGCAGGAGGCTAGCAAAGCTTAAATGCCTCCTTCTCTGCCCCCAGCCTCTGTCCCCCTTGGAGGAGGGCTGTAGGAAGATTCCCTCTTCC
TGCCAAGCCACCTTCCAGTGAGCTCTGGATGAAGCTCTGGCCAACCAAAGACACTGTCCCCACAGCAGGTGCCTGGTGGGCCACGTGTTC
TCACACTGGTGGAGGAGCTGGGCTTCTGTCCAAGGCACAAACCTTACTATGGAAAGCAGCCATATTTGCAGATACCACTGTCTCCTTTTG
TCCTCTTCGTGGCTGGAATTCAAAAGCATGTATTTCTGAAGCCTCTTGTGACATTGTTTTTTTTTTTTTTTTAATTAAACAGAAAAGATA

>In-frame_KCTD13_ENST00000568000_chr16_29934511_-_ICA1_ENST00000265577_chr7_8183602_-_2732nt
GGGATTGGGTGCTAGGTCCCACGACATTAGCTGGGATTCTAAGACCTTTGCTCAGCTGCTGCGGCCACCACTGACACGCCCTCTGCTCCT
CAAATACGGAGAACAGTTCAGTGTTCCTGCCTGAGGATCTCTGCATTTGCCTTCCCTCTGCCTGGAACTCTTCCCTCACATCCGCTTCCC
AGCTTCAGCTCGGCATCACCTCCTCAGAGAGGCCTTCCATCCTTGGTGCCCGGGCACCACTGCTACCCGTTTTGGCCTCTGTTTTTTTTT
TTTTTTTCAAAGGACGTTATGTTGCCCAGGCTAGAGTGCAACGGTCCGATCACGGATTACTGCAGCTTCCAACTCCTGGCTTCAAGCGCT
CCTTCTGCCTCGGCCTCCCGAGTAGCTAGGCTTACAGGCTGGGGTTACAGGTGTGAGCCACAGCGCCCGGCCGCTTTGGCCTCCTTTAAG
AGCTTCCCTCCGCGCTTTGTTCGCAGTTCTGGTCACAGTCTGTTCAGTGCGCGGGGCTGGGAGGCGGGAAACTGCCCAATGCCCAGACCT
CTCTGTCTGTTTCCCCTCAAGCTCGTGAAGCTCTCTGACAGCAGAGACCCAATCACGAGGTGGAGACTTCGCTTTCCACATCGGGCAGGG
GGTCGGCCGCATCCTCGATCTGGTCCTGGTGACTCGAGACCAGAGAGGAGCGCACGTCGACCCGCCCGGGGAACCCGCAGGCCACACGCC
AAACCTCTACGGGATCCCCCAGCGAGGCCACTGCGCATGCTCCATACTCGCAGCCCCGCCCCCATTCAGGGGCGGGGCCGCGCCTGCGCA
GCTGCCCGGCGCCGGCTTCCGGGTGGTGCGAGCGAGATGGGGCGGAGGGCCGGTCTTGCAGAGTAGCTGCGGTGAGTGGGCGTGTGCGCC
GAGCGGTCTGGCCCAAGGGCTGGGGGCCGGCCGAGGGTCTTCGGGAGCAGGCCGCAGGGCGCGGAGAGATCCTGGGATCGCCGTCCGCCG
CTGCTACCCGGCATGTCGGCGGAGGCCTCGGGCCCGGCTGCCGCCGCGGCCCCGTCCCTGGAAGCCCCCAAGCCCTCGGGTCTCGAGCCT
GGCCCCGCCGCCTACGGTCTCAAGCCGCTGACCCCGAACAGCAAATACGTGAAGCTGAACGTGGGCGGCTCGTTGCACTACACCACGCTG
CGCACCCTCACGGGACAGGACACCATGCTCAAAGCCATGTTCAGCGGCCGCGTGGAGGTGCTGACCGATGCCGGAGGTTGGGTGCTGATT
GACCGGAGCGGCCGTCACTTTGGTACAATCCTCAATTACCTGCGGGATGGGTCTGTGCCACTGCCGGAGAGTACGAGAGAACTGGGGGAG
CTGCTGGGCGAAGCACGCTACTACCTGGTGCAGGGCCTGATTGAGGACTGCCAGCTGGCGCTGCAGAGCTTACAAGACCCTATGAAAAAA
TTAGTTGAGAAAGAAGAGAAGAAGAAAATCAACCAGCAGGAAAGTACAGATGCAGCCGTGCAGGAGCCGAGCCAATTAATTTCATTAGAG
GAAGAAAACCAGCGCAAGGAATCCTCTAGTTTTAAGACTGAAGATGGAAAAAGTATTTTATCTGCCTTAGACAAAGGCTCTACACATACT
GCATGCTCAGGACCCATAGATGAACTATTAGACATGAAATCTGAGGAAGGTGCTTGCCTGGGACCAGTGGCAGGGACCCCGGAACCTGAA
GGTGCTGACAAAGATGACCTGCTGCTGTTGAGTGAGATCTTCAATGCTTCCTCCTTGGAAGAGGGCGAGTTCAGCAAAGAGTGGGCCGCT
GTGTTTGGAGACGGCCAAGTGAAGGAGCCAGTGCCCACTATGGCCCTGGGAGAGCCAGACCCCAAGGCCCAGACAGGCTCAGGTTTCCTT
CCTTCGCAGCTTTTAGACCAAAATATGAAAGACTTACAGGCCTCGCTACAAGAACCTGCTAAGGCTGCCTCAGACCTGACTGCCTGGTTC
AGCCTCTTCGCTGACCTCGACCCACTCTCAAATCCTGATGCTGTTGGGAAAACCGATAAAGAACACGAATTGCTCAATGCATGAATCTGT
ACCCTTCGGGAGGGCACTCACATGCCGCCCCCAGCAGCTCCCCTGGGGGCTAGCAGAAGTATAAAGTGATCAGTATGCTGTTTTAATAAT
TATGTGCCATTTTAATAAAATGAAAGGGTCAACGGCCCTGTTTATATTGGTATAATTATTTACTCTTATTTGGTATAAAGGGTTTTCGTG
TATCTCTATGTGGATCTAAATAATACAGGATTGTCTAGAAGCGGTTTCCAGGCCACCGCTCTCCTGCCTACATCCCATCATGGCTGCTGC
GGTGTCACTGGGCTACCGTGAGATCCAAGTTGAAATCAGAAGCCTACTTTGATGGTAGGTTTGAATGACGTGTCCTACAGCCTCAGAGGC
AGCAGGAGGCTAGCAAAGCTTAAATGCCTCCTTCTCTGCCCCCAGCCTCTGTCCCCCTTGGAGGAGGGCTGTAGGAAGATTCCCTCTTCC
TGCCAAGCCACCTTCCAGTGAGCTCTGGATGAAGCTCTGGCCAACCAAAGACACTGTCCCCACAGCAGGTGCCTGGTGGGCCACGTGTTC
TCACACTGGTGGAGGAGCTGGGCTTCTGTCCAAGGCACAAACCTTACTATGGAAAGCAGCCATATTTGCAGATACCACTGTCTCCTTTTG

>In-frame_KCTD13_ENST00000568000_chr16_29934511_-_ICA1_ENST00000396675_chr7_8183602_-_2678nt
GGGATTGGGTGCTAGGTCCCACGACATTAGCTGGGATTCTAAGACCTTTGCTCAGCTGCTGCGGCCACCACTGACACGCCCTCTGCTCCT
CAAATACGGAGAACAGTTCAGTGTTCCTGCCTGAGGATCTCTGCATTTGCCTTCCCTCTGCCTGGAACTCTTCCCTCACATCCGCTTCCC
AGCTTCAGCTCGGCATCACCTCCTCAGAGAGGCCTTCCATCCTTGGTGCCCGGGCACCACTGCTACCCGTTTTGGCCTCTGTTTTTTTTT
TTTTTTTCAAAGGACGTTATGTTGCCCAGGCTAGAGTGCAACGGTCCGATCACGGATTACTGCAGCTTCCAACTCCTGGCTTCAAGCGCT
CCTTCTGCCTCGGCCTCCCGAGTAGCTAGGCTTACAGGCTGGGGTTACAGGTGTGAGCCACAGCGCCCGGCCGCTTTGGCCTCCTTTAAG
AGCTTCCCTCCGCGCTTTGTTCGCAGTTCTGGTCACAGTCTGTTCAGTGCGCGGGGCTGGGAGGCGGGAAACTGCCCAATGCCCAGACCT
CTCTGTCTGTTTCCCCTCAAGCTCGTGAAGCTCTCTGACAGCAGAGACCCAATCACGAGGTGGAGACTTCGCTTTCCACATCGGGCAGGG
GGTCGGCCGCATCCTCGATCTGGTCCTGGTGACTCGAGACCAGAGAGGAGCGCACGTCGACCCGCCCGGGGAACCCGCAGGCCACACGCC
AAACCTCTACGGGATCCCCCAGCGAGGCCACTGCGCATGCTCCATACTCGCAGCCCCGCCCCCATTCAGGGGCGGGGCCGCGCCTGCGCA
GCTGCCCGGCGCCGGCTTCCGGGTGGTGCGAGCGAGATGGGGCGGAGGGCCGGTCTTGCAGAGTAGCTGCGGTGAGTGGGCGTGTGCGCC
GAGCGGTCTGGCCCAAGGGCTGGGGGCCGGCCGAGGGTCTTCGGGAGCAGGCCGCAGGGCGCGGAGAGATCCTGGGATCGCCGTCCGCCG
CTGCTACCCGGCATGTCGGCGGAGGCCTCGGGCCCGGCTGCCGCCGCGGCCCCGTCCCTGGAAGCCCCCAAGCCCTCGGGTCTCGAGCCT
GGCCCCGCCGCCTACGGTCTCAAGCCGCTGACCCCGAACAGCAAATACGTGAAGCTGAACGTGGGCGGCTCGTTGCACTACACCACGCTG
CGCACCCTCACGGGACAGGACACCATGCTCAAAGCCATGTTCAGCGGCCGCGTGGAGGTGCTGACCGATGCCGGAGGTTGGGTGCTGATT
GACCGGAGCGGCCGTCACTTTGGTACAATCCTCAATTACCTGCGGGATGGGTCTGTGCCACTGCCGGAGAGTACGAGAGAACTGGGGGAG
CTGCTGGGCGAAGCACGCTACTACCTGGTGCAGGGCCTGATTGAGGACTGCCAGCTGGCGCTGCAGAGCTTACAAGACCCTATGAAAAAA
TTAGTTGAGAAAGAAGAGAAGAAGAAAATCAACCAGCAGGAAAGTACAGATGCAGCCGTGCAGGAGCCGAGCCAATTAATTTCATTAGAG
GAAGAAAACCAGCGCAAGGAATCCTCTAGTTTTAAGACTGAAGATGGAAAAAGTATTTTATCTGCCTTAGACAAAGGCTCTACACATACT
GCATGCTCAGGACCCATAGATGAACTATTAGACATGAAATCTGAGGAAGGTGCTTGCCTGGGACCAGTGGCAGGGACCCCGGAACCTGAA
GGTGCTGACAAAGATGACCTGCTGCTGTTGAGTGAGATCTTCAATGCTTCCTCCTTGGAAGAGGGCGAGTTCAGCAAAGAGTGGGCCGCT
GTGTTTGGAGACGGCCAAGTGAAGGAGCCAGTGCCCACTATGGCCCTGGGAGAGCCAGACCCCAAGGCCCAGACAGGCTCAGGTTTCCTT
CCTTCGCAGCTTTTAGACCAAAATATGAAAGACTTACAGGCCTCGCTACAAGAACCTGCTAAGGCTGCCTCAGACCTGACTGCCTGGTTC
AGCCTCTTCGCTGACCTCGACCCACTCTCAAATCCTGATGCTGTTGGGAAAACCGATAAAGAACACGAATTGCTCAATGCATGAATCTGT
ACCCTTCGGGAGGGCACTCACATGCCGCCCCCAGCAGCTCCCCTGGGGGCTAGCAGAAGTATAAAGTGATCAGTATGCTGTTTTAATAAT
TATGTGCCATTTTAATAAAATGAAAGGGTCAACGGCCCTGTTTATATTGGTATAATTATTTACTCTTATTTGGTATAAAGGGTTTTCGTG
TATCTCTATGTGGATCTAAATAATACAGGATTGTCTAGAAGCGGTTTCCAGGCCACCGCTCTCCTGCCTACATCCCATCATGGCTGCTGC
GGTGTCACTGGGCTACCGTGAGATCCAAGTTGAAATCAGAAGCCTACTTTGATGGTAGGTTTGAATGACGTGTCCTACAGCCTCAGAGGC
AGCAGGAGGCTAGCAAAGCTTAAATGCCTCCTTCTCTGCCCCCAGCCTCTGTCCCCCTTGGAGGAGGGCTGTAGGAAGATTCCCTCTTCC
TGCCAAGCCACCTTCCAGTGAGCTCTGGATGAAGCTCTGGCCAACCAAAGACACTGTCCCCACAGCAGGTGCCTGGTGGGCCACGTGTTC

>In-frame_KCTD13_ENST00000568000_chr16_29934511_-_ICA1_ENST00000401396_chr7_8183602_-_2208nt
GGGATTGGGTGCTAGGTCCCACGACATTAGCTGGGATTCTAAGACCTTTGCTCAGCTGCTGCGGCCACCACTGACACGCCCTCTGCTCCT
CAAATACGGAGAACAGTTCAGTGTTCCTGCCTGAGGATCTCTGCATTTGCCTTCCCTCTGCCTGGAACTCTTCCCTCACATCCGCTTCCC
AGCTTCAGCTCGGCATCACCTCCTCAGAGAGGCCTTCCATCCTTGGTGCCCGGGCACCACTGCTACCCGTTTTGGCCTCTGTTTTTTTTT
TTTTTTTCAAAGGACGTTATGTTGCCCAGGCTAGAGTGCAACGGTCCGATCACGGATTACTGCAGCTTCCAACTCCTGGCTTCAAGCGCT
CCTTCTGCCTCGGCCTCCCGAGTAGCTAGGCTTACAGGCTGGGGTTACAGGTGTGAGCCACAGCGCCCGGCCGCTTTGGCCTCCTTTAAG
AGCTTCCCTCCGCGCTTTGTTCGCAGTTCTGGTCACAGTCTGTTCAGTGCGCGGGGCTGGGAGGCGGGAAACTGCCCAATGCCCAGACCT
CTCTGTCTGTTTCCCCTCAAGCTCGTGAAGCTCTCTGACAGCAGAGACCCAATCACGAGGTGGAGACTTCGCTTTCCACATCGGGCAGGG
GGTCGGCCGCATCCTCGATCTGGTCCTGGTGACTCGAGACCAGAGAGGAGCGCACGTCGACCCGCCCGGGGAACCCGCAGGCCACACGCC
AAACCTCTACGGGATCCCCCAGCGAGGCCACTGCGCATGCTCCATACTCGCAGCCCCGCCCCCATTCAGGGGCGGGGCCGCGCCTGCGCA
GCTGCCCGGCGCCGGCTTCCGGGTGGTGCGAGCGAGATGGGGCGGAGGGCCGGTCTTGCAGAGTAGCTGCGGTGAGTGGGCGTGTGCGCC
GAGCGGTCTGGCCCAAGGGCTGGGGGCCGGCCGAGGGTCTTCGGGAGCAGGCCGCAGGGCGCGGAGAGATCCTGGGATCGCCGTCCGCCG
CTGCTACCCGGCATGTCGGCGGAGGCCTCGGGCCCGGCTGCCGCCGCGGCCCCGTCCCTGGAAGCCCCCAAGCCCTCGGGTCTCGAGCCT
GGCCCCGCCGCCTACGGTCTCAAGCCGCTGACCCCGAACAGCAAATACGTGAAGCTGAACGTGGGCGGCTCGTTGCACTACACCACGCTG
CGCACCCTCACGGGACAGGACACCATGCTCAAAGCCATGTTCAGCGGCCGCGTGGAGGTGCTGACCGATGCCGGAGGTTGGGTGCTGATT
GACCGGAGCGGCCGTCACTTTGGTACAATCCTCAATTACCTGCGGGATGGGTCTGTGCCACTGCCGGAGAGTACGAGAGAACTGGGGGAG
CTGCTGGGCGAAGCACGCTACTACCTGGTGCAGGGCCTGATTGAGGACTGCCAGCTGGCGCTGCAGAGCTTACAAGACCCTATGAAAAAA
TTAGTTGAGAAAGAAGAGAAGAAGAAAATCAACCAGCAGGAAAGTACAGATGCAGCCGTGCAGGAGCCGAGCCAATTAATTTCATTAGAG
GAAGAAAACCAGCGCAAGGAATCCTCTAGTTTTAAGACTGAAGATGGAAAAAGTATTTTATCTGCCTTAGACAAAGGCTCTACACATACT
GCATGCTCAGGACCCATAGATGAACTATTAGACATGAAATCTGAGGAAGGTGCTTGCCTGGGACCAGTGGCAGGGACCCCGGAACCTGAA
GGTGCTGACAAAGATGACCTGCTGCTGTTGAGTGAGATCTTCAATGCTTCCTCCTTGGAAGAGGGCGAGTTCAGCAAAGAGTGGGCCGCT
GTGTTTGGAGACGGCCAAGTGAAGGAGCCAGTGCCCACTATGGCCCTGGGAGAGCCAGACCCCAAGGCCCAGACAGGCTCAGGTTTCCTT
CCTTCGCAGCTTTTAGACCAAAATATGAAAGACTTACAGGCCTCGCTACAAGAACCTGCTAAGGCTGCCTCAGACCTGACTGCCTGGTTC
AGCCTCTTCGCTGACCTCGACCCACTCTCAAATCCTGATGCTGTTGGGAAAACCGATAAAGAACACGAATTGCTCAATGCATGAATCTGT
ACCCTTCGGGAGGGCACTCACATGCCGCCCCCAGCAGCTCCCCTGGGGGCTAGCAGAAGTATAAAGTGATCAGTATGCTGTTTTAATAAT

>In-frame_KCTD13_ENST00000568000_chr16_29934511_-_ICA1_ENST00000422063_chr7_8183602_-_2151nt
GGGATTGGGTGCTAGGTCCCACGACATTAGCTGGGATTCTAAGACCTTTGCTCAGCTGCTGCGGCCACCACTGACACGCCCTCTGCTCCT
CAAATACGGAGAACAGTTCAGTGTTCCTGCCTGAGGATCTCTGCATTTGCCTTCCCTCTGCCTGGAACTCTTCCCTCACATCCGCTTCCC
AGCTTCAGCTCGGCATCACCTCCTCAGAGAGGCCTTCCATCCTTGGTGCCCGGGCACCACTGCTACCCGTTTTGGCCTCTGTTTTTTTTT
TTTTTTTCAAAGGACGTTATGTTGCCCAGGCTAGAGTGCAACGGTCCGATCACGGATTACTGCAGCTTCCAACTCCTGGCTTCAAGCGCT
CCTTCTGCCTCGGCCTCCCGAGTAGCTAGGCTTACAGGCTGGGGTTACAGGTGTGAGCCACAGCGCCCGGCCGCTTTGGCCTCCTTTAAG
AGCTTCCCTCCGCGCTTTGTTCGCAGTTCTGGTCACAGTCTGTTCAGTGCGCGGGGCTGGGAGGCGGGAAACTGCCCAATGCCCAGACCT
CTCTGTCTGTTTCCCCTCAAGCTCGTGAAGCTCTCTGACAGCAGAGACCCAATCACGAGGTGGAGACTTCGCTTTCCACATCGGGCAGGG
GGTCGGCCGCATCCTCGATCTGGTCCTGGTGACTCGAGACCAGAGAGGAGCGCACGTCGACCCGCCCGGGGAACCCGCAGGCCACACGCC
AAACCTCTACGGGATCCCCCAGCGAGGCCACTGCGCATGCTCCATACTCGCAGCCCCGCCCCCATTCAGGGGCGGGGCCGCGCCTGCGCA
GCTGCCCGGCGCCGGCTTCCGGGTGGTGCGAGCGAGATGGGGCGGAGGGCCGGTCTTGCAGAGTAGCTGCGGTGAGTGGGCGTGTGCGCC
GAGCGGTCTGGCCCAAGGGCTGGGGGCCGGCCGAGGGTCTTCGGGAGCAGGCCGCAGGGCGCGGAGAGATCCTGGGATCGCCGTCCGCCG
CTGCTACCCGGCATGTCGGCGGAGGCCTCGGGCCCGGCTGCCGCCGCGGCCCCGTCCCTGGAAGCCCCCAAGCCCTCGGGTCTCGAGCCT
GGCCCCGCCGCCTACGGTCTCAAGCCGCTGACCCCGAACAGCAAATACGTGAAGCTGAACGTGGGCGGCTCGTTGCACTACACCACGCTG
CGCACCCTCACGGGACAGGACACCATGCTCAAAGCCATGTTCAGCGGCCGCGTGGAGGTGCTGACCGATGCCGGAGGTTGGGTGCTGATT
GACCGGAGCGGCCGTCACTTTGGTACAATCCTCAATTACCTGCGGGATGGGTCTGTGCCACTGCCGGAGAGTACGAGAGAACTGGGGGAG
CTGCTGGGCGAAGCACGCTACTACCTGGTGCAGGGCCTGATTGAGGACTGCCAGCTGGCGCTGCAGAGCTTACAAGACCCTATGAAAAAA
TTAGTTGAGAAAGAAGAGAAGAAGAAAATCAACCAGCAGGAAAGTACAGATGCAGCCGTGCAGGAGCCGAGCCAATATTTACAGAATATT
TGCCTCGAGATGAAAGCAAATTCAGATATTAAGATGCTACAGAAAGGGAAAGAAGGCCAGCAAATTGGCATATTAATTTCATTAGAGGAA
GAAAACCAGCGCAAGGAATCCTCTAGTTTTAAGACTGAAGATGGAAAAAGTATTTTATCTGCCTTAGACAAAGGCTCTACACATACTGCA
TGCTCAGGACCCATAGATGAACTATTAGACATGAAATCTGAGGAAGGTGCTTGCCTGGGACCAGTGGCAGGGACCCCGGAACCTGAAGGT
GCTGACAAAGATGACCTGCTGCTGTTGAGTGAGATCTTCAATGCTTCCTCCTTGGAAGAGGGCGAGTTCAGCAAAGAGTGGGCCGCTGTG
TTTGGAGACGGCCAAGTGAAGGAGCCAGTGCCCACTATGGCCCTGGGAGAGCCAGACCCCAAGGCCCAGACAGGCTCAGGTTTCCTTCCT
TCGCAGCTTTTAGACCAAAATATGAAAGACTTACAGGCCTCGCTACAAGAACCTGCTAAGGCTGCCTCAGACCTGACTGCCTGGTTCAGC


Top

FusionGenePPI for KCTD13_ICA1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
KCTD13ARMC7, VTA1, NUDT18, ZMYND19, LNX1, KAT7, POLD2, PCNA, PLEC, TNFAIP1, SRPX, LAMB4, KCTD10, USP25, CUL3, SPRTN, PPARG, ADRB2, RHOA, KCTD13, HSPA1L, FLNC, HSPB8, CRK, UBXN7, FAF1, ARIH1, PFDN2ICA1STK16, CNTF, KRT33B, MKKS, EXOC5, RAB2A, CCDC28A, MBD3, ING5, RAB2B, PICK1, MORF4L1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for KCTD13_ICA1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for KCTD13_ICA1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource