FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 18339

FusionGeneSummary for KCNQ5_ALK

check button Fusion gene summary
Fusion gene informationFusion gene name: KCNQ5_ALK
Fusion gene ID: 18339
HgeneTgene
Gene symbol

KCNQ5

ALK

Gene ID

56479

238

Gene namepotassium voltage-gated channel subfamily Q member 5ALK receptor tyrosine kinase
SynonymsKv7.5|MRD46CD246|NBLST3
Cytomap

6q13

2p23.2-p23.1

Type of geneprotein-codingprotein-coding
Descriptionpotassium voltage-gated channel subfamily KQT member 5KQT-like 5potassium channel proteinpotassium channel subunit alpha KvLQT5potassium channel, voltage gated KQT-like subfamily Q, member 5voltage-gated potassium channel subunit Kv7.5ALK tyrosine kinase receptorCD246 antigenanaplastic lymphoma receptor tyrosine kinasemutant anaplastic lymphoma kinase
Modification date2018052320180527
UniProtAcc

Q9NR82

Q9UM73

Ensembl transtripts involved in fusion geneENST00000342056, ENST00000355194, 
ENST00000370398, ENST00000370392, 
ENST00000355635, ENST00000414165, 
ENST00000402622, ENST00000403813, 
ENST00000389048, ENST00000431873, 
ENST00000498037, 
Fusion gene scores* DoF score6 X 5 X 4=12024 X 23 X 10=5520
# samples 646
** MAII scorelog2(6/120*10)=-1
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(46/5520*10)=-3.58496250072116
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: KCNQ5 [Title/Abstract] AND ALK [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Kinase involved fusion gene, inframe and retained kinase domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneKCNQ5

GO:0071805

potassium ion transmembrane transport

10787416|11159685

TgeneALK

GO:0016310

phosphorylation

9174053

TgeneALK

GO:0046777

protein autophosphorylation

9174053


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSKCMTCGA-EB-A6QY-01AKCNQ5chr6

73332315

+ALKchr2

29498362

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000342056ENST00000389048KCNQ5chr6

73332315

+ALKchr2

29498362

-
5CDS-intronENST00000342056ENST00000431873KCNQ5chr6

73332315

+ALKchr2

29498362

-
5CDS-intronENST00000342056ENST00000498037KCNQ5chr6

73332315

+ALKchr2

29498362

-
In-frameENST00000355194ENST00000389048KCNQ5chr6

73332315

+ALKchr2

29498362

-
5CDS-intronENST00000355194ENST00000431873KCNQ5chr6

73332315

+ALKchr2

29498362

-
5CDS-intronENST00000355194ENST00000498037KCNQ5chr6

73332315

+ALKchr2

29498362

-
In-frameENST00000370398ENST00000389048KCNQ5chr6

73332315

+ALKchr2

29498362

-
5CDS-intronENST00000370398ENST00000431873KCNQ5chr6

73332315

+ALKchr2

29498362

-
5CDS-intronENST00000370398ENST00000498037KCNQ5chr6

73332315

+ALKchr2

29498362

-
In-frameENST00000370392ENST00000389048KCNQ5chr6

73332315

+ALKchr2

29498362

-
5CDS-intronENST00000370392ENST00000431873KCNQ5chr6

73332315

+ALKchr2

29498362

-
5CDS-intronENST00000370392ENST00000498037KCNQ5chr6

73332315

+ALKchr2

29498362

-
In-frameENST00000355635ENST00000389048KCNQ5chr6

73332315

+ALKchr2

29498362

-
5CDS-intronENST00000355635ENST00000431873KCNQ5chr6

73332315

+ALKchr2

29498362

-
5CDS-intronENST00000355635ENST00000498037KCNQ5chr6

73332315

+ALKchr2

29498362

-
In-frameENST00000414165ENST00000389048KCNQ5chr6

73332315

+ALKchr2

29498362

-
5CDS-intronENST00000414165ENST00000431873KCNQ5chr6

73332315

+ALKchr2

29498362

-
5CDS-intronENST00000414165ENST00000498037KCNQ5chr6

73332315

+ALKchr2

29498362

-
In-frameENST00000402622ENST00000389048KCNQ5chr6

73332315

+ALKchr2

29498362

-
5CDS-intronENST00000402622ENST00000431873KCNQ5chr6

73332315

+ALKchr2

29498362

-
5CDS-intronENST00000402622ENST00000498037KCNQ5chr6

73332315

+ALKchr2

29498362

-
In-frameENST00000403813ENST00000389048KCNQ5chr6

73332315

+ALKchr2

29498362

-
5CDS-intronENST00000403813ENST00000431873KCNQ5chr6

73332315

+ALKchr2

29498362

-
5CDS-intronENST00000403813ENST00000498037KCNQ5chr6

73332315

+ALKchr2

29498362

-

Top

FusionProtFeatures for KCNQ5_ALK


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
KCNQ5

Q9NR82

ALK

Q9UM73

Neuronal receptor tyrosine kinase that is essentiallyand transiently expressed in specific regions of the central andperipheral nervous systems and plays an important role in thegenesis and differentiation of the nervous system. Transducessignals from ligands at the cell surface, through specificactivation of the mitogen-activated protein kinase (MAPK) pathway.Phosphorylates almost exclusively at the first tyrosine of the Y-x-x-x-Y-Y motif. Following activation by ligand, ALK inducestyrosine phosphorylation of CBL, FRS2, IRS1 and SHC1, as well asof the MAP kinases MAPK1/ERK2 and MAPK3/ERK1. Acts as a receptorfor ligands pleiotrophin (PTN), a secreted growth factor, andmidkine (MDK), a PTN-related factor, thus participating in PTN andMDK signal transduction. PTN-binding induces MAPK pathwayactivation, which is important for the anti-apoptotic signaling ofPTN and regulation of cell proliferation. MDK-binding inducesphosphorylation of the ALK target insulin receptor substrate(IRS1), activates mitogen-activated protein kinases (MAPKs) andPI3-kinase, resulting also in cell proliferation induction. DrivesNF-kappa-B activation, probably through IRS1 and the activation ofthe AKT serine/threonine kinase. Recruitment of IRS1 to activatedALK and the activation of NF-kappa-B are essential for theautocrine growth and survival signaling of MDK.{ECO:0000269|PubMed:11121404, ECO:0000269|PubMed:11278720,ECO:0000269|PubMed:11387242, ECO:0000269|PubMed:11809760,ECO:0000269|PubMed:12107166, ECO:0000269|PubMed:12122009,ECO:0000269|PubMed:15226403, ECO:0000269|PubMed:15908427,ECO:0000269|PubMed:16317043, ECO:0000269|PubMed:16878150,ECO:0000269|PubMed:17274988}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneKCNQ5chr6:73332315chr2:29498362ENST00000370392+191_125132428Topological domainCytoplasmic
HgeneKCNQ5chr6:73332315chr2:29498362ENST00000370398+1141_125132933Topological domainCytoplasmic
HgeneKCNQ5chr6:73332315chr2:29498362ENST00000402622+1141_125132943Topological domainCytoplasmic
HgeneKCNQ5chr6:73332315chr2:29498362ENST00000403813+1131_125132924Topological domainCytoplasmic
HgeneKCNQ5chr6:73332315chr2:29498362ENST00000414165+1121_125132823Topological domainCytoplasmic
TgeneALKchr6:73332315chr2:29498362ENST00000389048-829816_9406051621Compositional biasNote=Gly-rich
TgeneALKchr6:73332315chr2:29498362ENST00000389048-8291116_13926051621DomainProtein kinase
TgeneALKchr6:73332315chr2:29498362ENST00000389048-8291197_11996051621RegionNote=Inhibitor binding
TgeneALKchr6:73332315chr2:29498362ENST00000389048-8291060_16206051621Topological domainCytoplasmic
TgeneALKchr6:73332315chr2:29498362ENST00000389048-8291039_10596051621TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneKCNQ5chr6:73332315chr2:29498362ENST00000370392+19299_319132428IntramembranePore-forming%3B Name%3DSegment H5
HgeneKCNQ5chr6:73332315chr2:29498362ENST00000370398+114299_319132933IntramembranePore-forming%3B Name%3DSegment H5
HgeneKCNQ5chr6:73332315chr2:29498362ENST00000402622+114299_319132943IntramembranePore-forming%3B Name%3DSegment H5
HgeneKCNQ5chr6:73332315chr2:29498362ENST00000403813+113299_319132924IntramembranePore-forming%3B Name%3DSegment H5
HgeneKCNQ5chr6:73332315chr2:29498362ENST00000414165+112299_319132823IntramembranePore-forming%3B Name%3DSegment H5
HgeneKCNQ5chr6:73332315chr2:29498362ENST00000370392+19311_316132428MotifSelectivity filter
HgeneKCNQ5chr6:73332315chr2:29498362ENST00000370398+114311_316132933MotifSelectivity filter
HgeneKCNQ5chr6:73332315chr2:29498362ENST00000402622+114311_316132943MotifSelectivity filter
HgeneKCNQ5chr6:73332315chr2:29498362ENST00000403813+113311_316132924MotifSelectivity filter
HgeneKCNQ5chr6:73332315chr2:29498362ENST00000414165+112311_316132823MotifSelectivity filter
HgeneKCNQ5chr6:73332315chr2:29498362ENST00000370392+19147_156132428Topological domainExtracellular
HgeneKCNQ5chr6:73332315chr2:29498362ENST00000370392+19178_200132428Topological domainCytoplasmic
HgeneKCNQ5chr6:73332315chr2:29498362ENST00000370392+19222_229132428Topological domainExtracellular
HgeneKCNQ5chr6:73332315chr2:29498362ENST00000370392+19253_266132428Topological domainCytoplasmic
HgeneKCNQ5chr6:73332315chr2:29498362ENST00000370392+19288_298132428Topological domainExtracellular
HgeneKCNQ5chr6:73332315chr2:29498362ENST00000370392+19320_325132428Topological domainExtracellular
HgeneKCNQ5chr6:73332315chr2:29498362ENST00000370392+19347_932132428Topological domainCytoplasmic
HgeneKCNQ5chr6:73332315chr2:29498362ENST00000370398+114147_156132933Topological domainExtracellular
HgeneKCNQ5chr6:73332315chr2:29498362ENST00000370398+114178_200132933Topological domainCytoplasmic
HgeneKCNQ5chr6:73332315chr2:29498362ENST00000370398+114222_229132933Topological domainExtracellular
HgeneKCNQ5chr6:73332315chr2:29498362ENST00000370398+114253_266132933Topological domainCytoplasmic
HgeneKCNQ5chr6:73332315chr2:29498362ENST00000370398+114288_298132933Topological domainExtracellular
HgeneKCNQ5chr6:73332315chr2:29498362ENST00000370398+114320_325132933Topological domainExtracellular
HgeneKCNQ5chr6:73332315chr2:29498362ENST00000370398+114347_932132933Topological domainCytoplasmic
HgeneKCNQ5chr6:73332315chr2:29498362ENST00000402622+114147_156132943Topological domainExtracellular
HgeneKCNQ5chr6:73332315chr2:29498362ENST00000402622+114178_200132943Topological domainCytoplasmic
HgeneKCNQ5chr6:73332315chr2:29498362ENST00000402622+114222_229132943Topological domainExtracellular
HgeneKCNQ5chr6:73332315chr2:29498362ENST00000402622+114253_266132943Topological domainCytoplasmic
HgeneKCNQ5chr6:73332315chr2:29498362ENST00000402622+114288_298132943Topological domainExtracellular
HgeneKCNQ5chr6:73332315chr2:29498362ENST00000402622+114320_325132943Topological domainExtracellular
HgeneKCNQ5chr6:73332315chr2:29498362ENST00000402622+114347_932132943Topological domainCytoplasmic
HgeneKCNQ5chr6:73332315chr2:29498362ENST00000403813+113147_156132924Topological domainExtracellular
HgeneKCNQ5chr6:73332315chr2:29498362ENST00000403813+113178_200132924Topological domainCytoplasmic
HgeneKCNQ5chr6:73332315chr2:29498362ENST00000403813+113222_229132924Topological domainExtracellular
HgeneKCNQ5chr6:73332315chr2:29498362ENST00000403813+113253_266132924Topological domainCytoplasmic
HgeneKCNQ5chr6:73332315chr2:29498362ENST00000403813+113288_298132924Topological domainExtracellular
HgeneKCNQ5chr6:73332315chr2:29498362ENST00000403813+113320_325132924Topological domainExtracellular
HgeneKCNQ5chr6:73332315chr2:29498362ENST00000403813+113347_932132924Topological domainCytoplasmic
HgeneKCNQ5chr6:73332315chr2:29498362ENST00000414165+112147_156132823Topological domainExtracellular
HgeneKCNQ5chr6:73332315chr2:29498362ENST00000414165+112178_200132823Topological domainCytoplasmic
HgeneKCNQ5chr6:73332315chr2:29498362ENST00000414165+112222_229132823Topological domainExtracellular
HgeneKCNQ5chr6:73332315chr2:29498362ENST00000414165+112253_266132823Topological domainCytoplasmic
HgeneKCNQ5chr6:73332315chr2:29498362ENST00000414165+112288_298132823Topological domainExtracellular
HgeneKCNQ5chr6:73332315chr2:29498362ENST00000414165+112320_325132823Topological domainExtracellular
HgeneKCNQ5chr6:73332315chr2:29498362ENST00000414165+112347_932132823Topological domainCytoplasmic
HgeneKCNQ5chr6:73332315chr2:29498362ENST00000370392+19126_146132428TransmembraneHelical%3B Name%3DSegment S1
HgeneKCNQ5chr6:73332315chr2:29498362ENST00000370392+19157_177132428TransmembraneHelical%3B Name%3DSegment S2
HgeneKCNQ5chr6:73332315chr2:29498362ENST00000370392+19201_221132428TransmembraneHelical%3B Name%3DSegment S3
HgeneKCNQ5chr6:73332315chr2:29498362ENST00000370392+19230_252132428TransmembraneHelical%3B Voltage-sensor%3B Name%3DSegment S4
HgeneKCNQ5chr6:73332315chr2:29498362ENST00000370392+19267_287132428TransmembraneHelical%3B Name%3DSegment S5
HgeneKCNQ5chr6:73332315chr2:29498362ENST00000370392+19326_346132428TransmembraneHelical%3B Name%3DSegment S6
HgeneKCNQ5chr6:73332315chr2:29498362ENST00000370398+114126_146132933TransmembraneHelical%3B Name%3DSegment S1
HgeneKCNQ5chr6:73332315chr2:29498362ENST00000370398+114157_177132933TransmembraneHelical%3B Name%3DSegment S2
HgeneKCNQ5chr6:73332315chr2:29498362ENST00000370398+114201_221132933TransmembraneHelical%3B Name%3DSegment S3
HgeneKCNQ5chr6:73332315chr2:29498362ENST00000370398+114230_252132933TransmembraneHelical%3B Voltage-sensor%3B Name%3DSegment S4
HgeneKCNQ5chr6:73332315chr2:29498362ENST00000370398+114267_287132933TransmembraneHelical%3B Name%3DSegment S5
HgeneKCNQ5chr6:73332315chr2:29498362ENST00000370398+114326_346132933TransmembraneHelical%3B Name%3DSegment S6
HgeneKCNQ5chr6:73332315chr2:29498362ENST00000402622+114126_146132943TransmembraneHelical%3B Name%3DSegment S1
HgeneKCNQ5chr6:73332315chr2:29498362ENST00000402622+114157_177132943TransmembraneHelical%3B Name%3DSegment S2
HgeneKCNQ5chr6:73332315chr2:29498362ENST00000402622+114201_221132943TransmembraneHelical%3B Name%3DSegment S3
HgeneKCNQ5chr6:73332315chr2:29498362ENST00000402622+114230_252132943TransmembraneHelical%3B Voltage-sensor%3B Name%3DSegment S4
HgeneKCNQ5chr6:73332315chr2:29498362ENST00000402622+114267_287132943TransmembraneHelical%3B Name%3DSegment S5
HgeneKCNQ5chr6:73332315chr2:29498362ENST00000402622+114326_346132943TransmembraneHelical%3B Name%3DSegment S6
HgeneKCNQ5chr6:73332315chr2:29498362ENST00000403813+113126_146132924TransmembraneHelical%3B Name%3DSegment S1
HgeneKCNQ5chr6:73332315chr2:29498362ENST00000403813+113157_177132924TransmembraneHelical%3B Name%3DSegment S2
HgeneKCNQ5chr6:73332315chr2:29498362ENST00000403813+113201_221132924TransmembraneHelical%3B Name%3DSegment S3
HgeneKCNQ5chr6:73332315chr2:29498362ENST00000403813+113230_252132924TransmembraneHelical%3B Voltage-sensor%3B Name%3DSegment S4
HgeneKCNQ5chr6:73332315chr2:29498362ENST00000403813+113267_287132924TransmembraneHelical%3B Name%3DSegment S5
HgeneKCNQ5chr6:73332315chr2:29498362ENST00000403813+113326_346132924TransmembraneHelical%3B Name%3DSegment S6
HgeneKCNQ5chr6:73332315chr2:29498362ENST00000414165+112126_146132823TransmembraneHelical%3B Name%3DSegment S1
HgeneKCNQ5chr6:73332315chr2:29498362ENST00000414165+112157_177132823TransmembraneHelical%3B Name%3DSegment S2
HgeneKCNQ5chr6:73332315chr2:29498362ENST00000414165+112201_221132823TransmembraneHelical%3B Name%3DSegment S3
HgeneKCNQ5chr6:73332315chr2:29498362ENST00000414165+112230_252132823TransmembraneHelical%3B Voltage-sensor%3B Name%3DSegment S4
HgeneKCNQ5chr6:73332315chr2:29498362ENST00000414165+112267_287132823TransmembraneHelical%3B Name%3DSegment S5
HgeneKCNQ5chr6:73332315chr2:29498362ENST00000414165+112326_346132823TransmembraneHelical%3B Name%3DSegment S6
TgeneALKchr6:73332315chr2:29498362ENST00000389048-829264_4276051621DomainMAM 1
TgeneALKchr6:73332315chr2:29498362ENST00000389048-829437_4736051621DomainNote=LDL-receptor class A
TgeneALKchr6:73332315chr2:29498362ENST00000389048-829478_6366051621DomainMAM 2
TgeneALKchr6:73332315chr2:29498362ENST00000389048-82919_10386051621Topological domainExtracellular


Top

FusionGeneSequence for KCNQ5_ALK


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_KCNQ5_ENST00000342056_chr6_73332315_+_ALK_ENST00000389048_chr2_29498362_-_1148aa
MPRHHAGGEEGGAAGLWVKSGAAAAAAGGGRLGSGMKDVESGRGRVLLNSAAARGDGLLLLGTRAATLGGGGGGLRESRRGKQGARMSLL
GKPLSYTSSQSCRRNVKYRRVQNYLYNVLERPRGWAFIYHAFVFWLQMVAWWGQGSRAIVAFDNISISLDCYLTISGEDKILQNTAPKSR
NLFERNPNKELKPGENSPRQTPIFDPTVHWLFTTCGASGPHGPTQAQCNNAYQNSNLSVEVGSEGPLKGIQIWKVPATDTYSISGYGAAG
GKGGKNTMMRSHGVSVLGIFNLEKDDMLYILVGQQGEDACPSTNQLIQKVCIGENNVIEEEIRVNRSVHEWAGGGGGGGGATYVFKMKDG
VPVPLIIAAGGGGRAYGAKTDTFHPERLENNSSVLGLNGNSGAAGGGGGWNDNTSLLWAGKSLQEGATGGHSCPQAMKKWGWETRGGFGG
GGGGCSSGGGGGGTIGGNAASNNDPEMDGEDGVSFISPLGILYTPALKVMEGHGEVNIKHTLNCSHCEVDECHMDPESHKVICFCDHGTV
LAEDGVSCIVSPTPEPHLPLSLILSVVTSALVAALVLAFSGIMIVYRRKHQELQAMQMELQSPEYKLSKLRTSTIMTDYNPNYCFAGKTS
SISDLKEVPRKNITLIRGLGHGAFGEVTEGQVSGMPNDPSPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRF
ILLELMAGGDLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQTLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYRASYT
RKGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGTMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDR
PNFAIILERIEYCTQDPDVINTALPIETGPLVEEEEKVPVRPKDPEGVPPLLVSQQAKREEERSPAAPPPLPTTSSGKAAKKPTAAEISV
RVPRGPAVEGGHVNMAFSQSNPPSELHKVHGSRNKPTSLWNPTYGSWFTEKPTKKNNPIAKKEPHDRGNLGLEGSCTVPPNVATGRLPGA

>In-frame_KCNQ5_ENST00000355194_chr6_73332315_+_ALK_ENST00000389048_chr2_29498362_-_1146aa
MPRHHAGGEEGGAAGLWVKSGAAAAAAGGGRLGSGMKDVESGRGRVLLNSAAARGDGLLLLGTRAATLGGGGGGLRESRRGKQGARMSLL
GKPLSYTSSQSCRRNVKYRRVQNYLYNVLERPRGWAFIYHAFWLQMVAWWGQGSRAIVAFDNISISLDCYLTISGEDKILQNTAPKSRNL
FERNPNKELKPGENSPRQTPIFDPTVHWLFTTCGASGPHGPTQAQCNNAYQNSNLSVEVGSEGPLKGIQIWKVPATDTYSISGYGAAGGK
GGKNTMMRSHGVSVLGIFNLEKDDMLYILVGQQGEDACPSTNQLIQKVCIGENNVIEEEIRVNRSVHEWAGGGGGGGGATYVFKMKDGVP
VPLIIAAGGGGRAYGAKTDTFHPERLENNSSVLGLNGNSGAAGGGGGWNDNTSLLWAGKSLQEGATGGHSCPQAMKKWGWETRGGFGGGG
GGCSSGGGGGGTIGGNAASNNDPEMDGEDGVSFISPLGILYTPALKVMEGHGEVNIKHTLNCSHCEVDECHMDPESHKVICFCDHGTVLA
EDGVSCIVSPTPEPHLPLSLILSVVTSALVAALVLAFSGIMIVYRRKHQELQAMQMELQSPEYKLSKLRTSTIMTDYNPNYCFAGKTSSI
SDLKEVPRKNITLIRGLGHGAFGEVTEGQVSGMPNDPSPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRFIL
LELMAGGDLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQTLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYRASYTRK
GGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGTMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPN
FAIILERIEYCTQDPDVINTALPIETGPLVEEEEKVPVRPKDPEGVPPLLVSQQAKREEERSPAAPPPLPTTSSGKAAKKPTAAEISVRV
PRGPAVEGGHVNMAFSQSNPPSELHKVHGSRNKPTSLWNPTYGSWFTEKPTKKNNPIAKKEPHDRGNLGLEGSCTVPPNVATGRLPGASL

>In-frame_KCNQ5_ENST00000370398_chr6_73332315_+_ALK_ENST00000389048_chr2_29498362_-_1148aa
MPRHHAGGEEGGAAGLWVKSGAAAAAAGGGRLGSGMKDVESGRGRVLLNSAAARGDGLLLLGTRAATLGGGGGGLRESRRGKQGARMSLL
GKPLSYTSSQSCRRNVKYRRVQNYLYNVLERPRGWAFIYHAFVFWLQMVAWWGQGSRAIVAFDNISISLDCYLTISGEDKILQNTAPKSR
NLFERNPNKELKPGENSPRQTPIFDPTVHWLFTTCGASGPHGPTQAQCNNAYQNSNLSVEVGSEGPLKGIQIWKVPATDTYSISGYGAAG
GKGGKNTMMRSHGVSVLGIFNLEKDDMLYILVGQQGEDACPSTNQLIQKVCIGENNVIEEEIRVNRSVHEWAGGGGGGGGATYVFKMKDG
VPVPLIIAAGGGGRAYGAKTDTFHPERLENNSSVLGLNGNSGAAGGGGGWNDNTSLLWAGKSLQEGATGGHSCPQAMKKWGWETRGGFGG
GGGGCSSGGGGGGTIGGNAASNNDPEMDGEDGVSFISPLGILYTPALKVMEGHGEVNIKHTLNCSHCEVDECHMDPESHKVICFCDHGTV
LAEDGVSCIVSPTPEPHLPLSLILSVVTSALVAALVLAFSGIMIVYRRKHQELQAMQMELQSPEYKLSKLRTSTIMTDYNPNYCFAGKTS
SISDLKEVPRKNITLIRGLGHGAFGEVTEGQVSGMPNDPSPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRF
ILLELMAGGDLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQTLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYRASYT
RKGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGTMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDR
PNFAIILERIEYCTQDPDVINTALPIETGPLVEEEEKVPVRPKDPEGVPPLLVSQQAKREEERSPAAPPPLPTTSSGKAAKKPTAAEISV
RVPRGPAVEGGHVNMAFSQSNPPSELHKVHGSRNKPTSLWNPTYGSWFTEKPTKKNNPIAKKEPHDRGNLGLEGSCTVPPNVATGRLPGA

>In-frame_KCNQ5_ENST00000370392_chr6_73332315_+_ALK_ENST00000389048_chr2_29498362_-_1148aa
MPRHHAGGEEGGAAGLWVKSGAAAAAAGGGRLGSGMKDVESGRGRVLLNSAAARGDGLLLLGTRAATLGGGGGGLRESRRGKQGARMSLL
GKPLSYTSSQSCRRNVKYRRVQNYLYNVLERPRGWAFIYHAFVFWLQMVAWWGQGSRAIVAFDNISISLDCYLTISGEDKILQNTAPKSR
NLFERNPNKELKPGENSPRQTPIFDPTVHWLFTTCGASGPHGPTQAQCNNAYQNSNLSVEVGSEGPLKGIQIWKVPATDTYSISGYGAAG
GKGGKNTMMRSHGVSVLGIFNLEKDDMLYILVGQQGEDACPSTNQLIQKVCIGENNVIEEEIRVNRSVHEWAGGGGGGGGATYVFKMKDG
VPVPLIIAAGGGGRAYGAKTDTFHPERLENNSSVLGLNGNSGAAGGGGGWNDNTSLLWAGKSLQEGATGGHSCPQAMKKWGWETRGGFGG
GGGGCSSGGGGGGTIGGNAASNNDPEMDGEDGVSFISPLGILYTPALKVMEGHGEVNIKHTLNCSHCEVDECHMDPESHKVICFCDHGTV
LAEDGVSCIVSPTPEPHLPLSLILSVVTSALVAALVLAFSGIMIVYRRKHQELQAMQMELQSPEYKLSKLRTSTIMTDYNPNYCFAGKTS
SISDLKEVPRKNITLIRGLGHGAFGEVTEGQVSGMPNDPSPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRF
ILLELMAGGDLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQTLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYRASYT
RKGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGTMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDR
PNFAIILERIEYCTQDPDVINTALPIETGPLVEEEEKVPVRPKDPEGVPPLLVSQQAKREEERSPAAPPPLPTTSSGKAAKKPTAAEISV
RVPRGPAVEGGHVNMAFSQSNPPSELHKVHGSRNKPTSLWNPTYGSWFTEKPTKKNNPIAKKEPHDRGNLGLEGSCTVPPNVATGRLPGA

>In-frame_KCNQ5_ENST00000355635_chr6_73332315_+_ALK_ENST00000389048_chr2_29498362_-_1148aa
MPRHHAGGEEGGAAGLWVKSGAAAAAAGGGRLGSGMKDVESGRGRVLLNSAAARGDGLLLLGTRAATLGGGGGGLRESRRGKQGARMSLL
GKPLSYTSSQSCRRNVKYRRVQNYLYNVLERPRGWAFIYHAFVFWLQMVAWWGQGSRAIVAFDNISISLDCYLTISGEDKILQNTAPKSR
NLFERNPNKELKPGENSPRQTPIFDPTVHWLFTTCGASGPHGPTQAQCNNAYQNSNLSVEVGSEGPLKGIQIWKVPATDTYSISGYGAAG
GKGGKNTMMRSHGVSVLGIFNLEKDDMLYILVGQQGEDACPSTNQLIQKVCIGENNVIEEEIRVNRSVHEWAGGGGGGGGATYVFKMKDG
VPVPLIIAAGGGGRAYGAKTDTFHPERLENNSSVLGLNGNSGAAGGGGGWNDNTSLLWAGKSLQEGATGGHSCPQAMKKWGWETRGGFGG
GGGGCSSGGGGGGTIGGNAASNNDPEMDGEDGVSFISPLGILYTPALKVMEGHGEVNIKHTLNCSHCEVDECHMDPESHKVICFCDHGTV
LAEDGVSCIVSPTPEPHLPLSLILSVVTSALVAALVLAFSGIMIVYRRKHQELQAMQMELQSPEYKLSKLRTSTIMTDYNPNYCFAGKTS
SISDLKEVPRKNITLIRGLGHGAFGEVTEGQVSGMPNDPSPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRF
ILLELMAGGDLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQTLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYRASYT
RKGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGTMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDR
PNFAIILERIEYCTQDPDVINTALPIETGPLVEEEEKVPVRPKDPEGVPPLLVSQQAKREEERSPAAPPPLPTTSSGKAAKKPTAAEISV
RVPRGPAVEGGHVNMAFSQSNPPSELHKVHGSRNKPTSLWNPTYGSWFTEKPTKKNNPIAKKEPHDRGNLGLEGSCTVPPNVATGRLPGA

>In-frame_KCNQ5_ENST00000414165_chr6_73332315_+_ALK_ENST00000389048_chr2_29498362_-_1148aa
MPRHHAGGEEGGAAGLWVKSGAAAAAAGGGRLGSGMKDVESGRGRVLLNSAAARGDGLLLLGTRAATLGGGGGGLRESRRGKQGARMSLL
GKPLSYTSSQSCRRNVKYRRVQNYLYNVLERPRGWAFIYHAFVFWLQMVAWWGQGSRAIVAFDNISISLDCYLTISGEDKILQNTAPKSR
NLFERNPNKELKPGENSPRQTPIFDPTVHWLFTTCGASGPHGPTQAQCNNAYQNSNLSVEVGSEGPLKGIQIWKVPATDTYSISGYGAAG
GKGGKNTMMRSHGVSVLGIFNLEKDDMLYILVGQQGEDACPSTNQLIQKVCIGENNVIEEEIRVNRSVHEWAGGGGGGGGATYVFKMKDG
VPVPLIIAAGGGGRAYGAKTDTFHPERLENNSSVLGLNGNSGAAGGGGGWNDNTSLLWAGKSLQEGATGGHSCPQAMKKWGWETRGGFGG
GGGGCSSGGGGGGTIGGNAASNNDPEMDGEDGVSFISPLGILYTPALKVMEGHGEVNIKHTLNCSHCEVDECHMDPESHKVICFCDHGTV
LAEDGVSCIVSPTPEPHLPLSLILSVVTSALVAALVLAFSGIMIVYRRKHQELQAMQMELQSPEYKLSKLRTSTIMTDYNPNYCFAGKTS
SISDLKEVPRKNITLIRGLGHGAFGEVTEGQVSGMPNDPSPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRF
ILLELMAGGDLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQTLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYRASYT
RKGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGTMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDR
PNFAIILERIEYCTQDPDVINTALPIETGPLVEEEEKVPVRPKDPEGVPPLLVSQQAKREEERSPAAPPPLPTTSSGKAAKKPTAAEISV
RVPRGPAVEGGHVNMAFSQSNPPSELHKVHGSRNKPTSLWNPTYGSWFTEKPTKKNNPIAKKEPHDRGNLGLEGSCTVPPNVATGRLPGA

>In-frame_KCNQ5_ENST00000402622_chr6_73332315_+_ALK_ENST00000389048_chr2_29498362_-_1148aa
MPRHHAGGEEGGAAGLWVKSGAAAAAAGGGRLGSGMKDVESGRGRVLLNSAAARGDGLLLLGTRAATLGGGGGGLRESRRGKQGARMSLL
GKPLSYTSSQSCRRNVKYRRVQNYLYNVLERPRGWAFIYHAFVFWLQMVAWWGQGSRAIVAFDNISISLDCYLTISGEDKILQNTAPKSR
NLFERNPNKELKPGENSPRQTPIFDPTVHWLFTTCGASGPHGPTQAQCNNAYQNSNLSVEVGSEGPLKGIQIWKVPATDTYSISGYGAAG
GKGGKNTMMRSHGVSVLGIFNLEKDDMLYILVGQQGEDACPSTNQLIQKVCIGENNVIEEEIRVNRSVHEWAGGGGGGGGATYVFKMKDG
VPVPLIIAAGGGGRAYGAKTDTFHPERLENNSSVLGLNGNSGAAGGGGGWNDNTSLLWAGKSLQEGATGGHSCPQAMKKWGWETRGGFGG
GGGGCSSGGGGGGTIGGNAASNNDPEMDGEDGVSFISPLGILYTPALKVMEGHGEVNIKHTLNCSHCEVDECHMDPESHKVICFCDHGTV
LAEDGVSCIVSPTPEPHLPLSLILSVVTSALVAALVLAFSGIMIVYRRKHQELQAMQMELQSPEYKLSKLRTSTIMTDYNPNYCFAGKTS
SISDLKEVPRKNITLIRGLGHGAFGEVTEGQVSGMPNDPSPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRF
ILLELMAGGDLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQTLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYRASYT
RKGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGTMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDR
PNFAIILERIEYCTQDPDVINTALPIETGPLVEEEEKVPVRPKDPEGVPPLLVSQQAKREEERSPAAPPPLPTTSSGKAAKKPTAAEISV
RVPRGPAVEGGHVNMAFSQSNPPSELHKVHGSRNKPTSLWNPTYGSWFTEKPTKKNNPIAKKEPHDRGNLGLEGSCTVPPNVATGRLPGA

>In-frame_KCNQ5_ENST00000403813_chr6_73332315_+_ALK_ENST00000389048_chr2_29498362_-_1148aa
MPRHHAGGEEGGAAGLWVKSGAAAAAAGGGRLGSGMKDVESGRGRVLLNSAAARGDGLLLLGTRAATLGGGGGGLRESRRGKQGARMSLL
GKPLSYTSSQSCRRNVKYRRVQNYLYNVLERPRGWAFIYHAFVFWLQMVAWWGQGSRAIVAFDNISISLDCYLTISGEDKILQNTAPKSR
NLFERNPNKELKPGENSPRQTPIFDPTVHWLFTTCGASGPHGPTQAQCNNAYQNSNLSVEVGSEGPLKGIQIWKVPATDTYSISGYGAAG
GKGGKNTMMRSHGVSVLGIFNLEKDDMLYILVGQQGEDACPSTNQLIQKVCIGENNVIEEEIRVNRSVHEWAGGGGGGGGATYVFKMKDG
VPVPLIIAAGGGGRAYGAKTDTFHPERLENNSSVLGLNGNSGAAGGGGGWNDNTSLLWAGKSLQEGATGGHSCPQAMKKWGWETRGGFGG
GGGGCSSGGGGGGTIGGNAASNNDPEMDGEDGVSFISPLGILYTPALKVMEGHGEVNIKHTLNCSHCEVDECHMDPESHKVICFCDHGTV
LAEDGVSCIVSPTPEPHLPLSLILSVVTSALVAALVLAFSGIMIVYRRKHQELQAMQMELQSPEYKLSKLRTSTIMTDYNPNYCFAGKTS
SISDLKEVPRKNITLIRGLGHGAFGEVTEGQVSGMPNDPSPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRF
ILLELMAGGDLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQTLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYRASYT
RKGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGTMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDR
PNFAIILERIEYCTQDPDVINTALPIETGPLVEEEEKVPVRPKDPEGVPPLLVSQQAKREEERSPAAPPPLPTTSSGKAAKKPTAAEISV
RVPRGPAVEGGHVNMAFSQSNPPSELHKVHGSRNKPTSLWNPTYGSWFTEKPTKKNNPIAKKEPHDRGNLGLEGSCTVPPNVATGRLPGA


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_KCNQ5_ENST00000342056_chr6_73332315_+_ALK_ENST00000389048_chr2_29498362_-_3444nt
ATGCCCCGCCACCACGCGGGAGGAGAGGAGGGCGGCGCCGCCGGGCTCTGGGTGAAGAGCGGCGCAGCGGCGGCGGCGGCGGGCGGGGGG
CGCTTGGGCAGCGGCATGAAGGATGTGGAGTCCGGCCGGGGCAGGGTGCTGCTGAACTCGGCAGCCGCCAGGGGCGACGGCCTGCTACTG
CTGGGCACCCGCGCGGCCACGCTCGGTGGCGGCGGCGGTGGCCTGAGGGAGAGCCGCCGGGGCAAGCAGGGGGCCCGGATGAGCCTGCTG
GGGAAGCCGCTCTCTTACACGAGTAGCCAGAGCTGCCGGCGCAACGTCAAGTACCGGCGGGTGCAGAACTACCTGTACAACGTGCTGGAG
AGACCCCGCGGCTGGGCGTTCATCTACCACGCTTTCGTGTTCTGGCTGCAGATGGTCGCATGGTGGGGACAAGGATCCAGAGCCATCGTG
GCTTTTGACAATATCTCCATCAGCCTGGACTGCTACCTCACCATTAGCGGAGAGGACAAGATCCTGCAGAATACAGCACCCAAATCAAGA
AACCTGTTTGAGAGAAACCCAAACAAGGAGCTGAAACCCGGGGAAAATTCACCAAGACAGACCCCCATCTTTGACCCTACAGTTCATTGG
CTGTTCACCACATGTGGGGCCAGCGGGCCCCATGGCCCCACCCAGGCACAGTGCAACAACGCCTACCAGAACTCCAACCTGAGCGTGGAG
GTGGGGAGCGAGGGCCCCCTGAAAGGCATCCAGATCTGGAAGGTGCCAGCCACCGACACCTACAGCATCTCGGGCTACGGAGCTGCTGGC
GGGAAAGGCGGGAAGAACACCATGATGCGGTCCCACGGCGTGTCTGTGCTGGGCATCTTCAACCTGGAGAAGGATGACATGCTGTACATC
CTGGTTGGGCAGCAGGGAGAGGACGCCTGCCCCAGTACAAACCAGTTAATCCAGAAAGTCTGCATTGGAGAGAACAATGTGATAGAAGAA
GAAATCCGTGTGAACAGAAGCGTGCATGAGTGGGCAGGAGGCGGAGGAGGAGGGGGTGGAGCCACCTACGTATTTAAGATGAAGGATGGA
GTGCCGGTGCCCCTGATCATTGCAGCCGGAGGTGGTGGCAGGGCCTACGGGGCCAAGACAGACACGTTCCACCCAGAGAGACTGGAGAAT
AACTCCTCGGTTCTAGGGCTAAACGGCAATTCCGGAGCCGCAGGTGGTGGAGGTGGCTGGAATGATAACACTTCCTTGCTCTGGGCCGGA
AAATCTTTGCAGGAGGGTGCCACCGGAGGACATTCCTGCCCCCAGGCCATGAAGAAGTGGGGGTGGGAGACAAGAGGGGGTTTCGGAGGG
GGTGGAGGGGGGTGCTCCTCAGGTGGAGGAGGCGGAGGATATATAGGCGGCAATGCAGCCTCAAACAATGACCCCGAAATGGATGGGGAA
GATGGGGTTTCCTTCATCAGTCCACTGGGCATCCTGTACACCCCAGCTTTAAAAGTGATGGAAGGCCACGGGGAAGTGAATATTAAGCAT
TATCTAAACTGCAGTCACTGTGAGGTAGACGAATGTCACATGGACCCTGAAAGCCACAAGGTCATCTGCTTCTGTGACCACGGGACGGTG
CTGGCTGAGGATGGCGTCTCCTGCATTGTGTCACCCACCCCGGAGCCACACCTGCCACTCTCGCTGATCCTCTCTGTGGTGACCTCTGCC
CTCGTGGCCGCCCTGGTCCTGGCTTTCTCCGGCATCATGATTGTGTACCGCCGGAAGCACCAGGAGCTGCAAGCCATGCAGATGGAGCTG
CAGAGCCCTGAGTACAAGCTGAGCAAGCTCCGCACCTCGACCATCATGACCGACTACAACCCCAACTACTGCTTTGCTGGCAAGACCTCC
TCCATCAGTGACCTGAAGGAGGTGCCGCGGAAAAACATCACCCTCATTCGGGGTCTGGGCCATGGCGCCTTTGGGGAGGTGTATGAAGGC
CAGGTGTCCGGAATGCCCAACGACCCAAGCCCCCTGCAAGTGGCTGTGAAGACGCTGCCTGAAGTGTGCTCTGAACAGGACGAACTGGAT
TTCCTCATGGAAGCCCTGATCATCAGCAAATTCAACCACCAGAACATTGTTCGCTGCATTGGGGTGAGCCTGCAATCCCTGCCCCGGTTC
ATCCTGCTGGAGCTCATGGCGGGGGGAGACCTCAAGTCCTTCCTCCGAGAGACCCGCCCTCGCCCGAGCCAGCCCTCCTCCCTGGCCATG
CTGGACCTTCTGCACGTGGCTCGGGACATTGCCTGTGGCTGTCAGTATTTGGAGGAAAACCACTTCATCCACCGAGACATTGCTGCCAGA
AACTGCCTCTTGACCTGTCCAGGCCCTGGAAGAGTGGCCAAGATTGGAGACTTCGGGATGGCCCGAGACATCTACAGGGCGAGCTACTAT
AGAAAGGGAGGCTGTGCCATGCTGCCAGTTAAGTGGATGCCCCCAGAGGCCTTCATGGAAGGAATATTCACTTCTAAAACAGACACATGG
TCCTTTGGAGTGCTGCTATGGGAAATCTTTTCTCTTGGATATATGCCATACCCCAGCAAAAGCAACCAGGAAGTTCTGGAGTTTGTCACC
AGTGGAGGCCGGATGGACCCACCCAAGAACTGCCCTGGGCCTGTATACCGGATAATGACTCAGTGCTGGCAACATCAGCCTGAAGACAGG
CCCAACTTTGCCATCATTTTGGAGAGGATTGAATACTGCACCCAGGACCCGGATGTAATCAACACCGCTTTGCCGATAGAATATGGTCCA
CTTGTGGAAGAGGAAGAGAAAGTGCCTGTGAGGCCCAAGGACCCTGAGGGGGTTCCTCCTCTCCTGGTCTCTCAACAGGCAAAACGGGAG
GAGGAGCGCAGCCCAGCTGCCCCACCACCTCTGCCTACCACCTCCTCTGGCAAGGCTGCAAAGAAACCCACAGCTGCAGAGATCTCTGTT
CGAGTCCCTAGAGGGCCGGCCGTGGAAGGGGGACACGTGAATATGGCATTCTCTCAGTCCAACCCTCCTTCGGAGTTGCACAAGGTCCAC
GGATCCAGAAACAAGCCCACCAGCTTGTGGAACCCAACGTACGGCTCCTGGTTTACAGAGAAACCCACCAAAAAGAATAATCCTATAGCA
AAGAAGGAGCCACACGACAGGGGTAACCTGGGGCTGGAGGGAAGCTGTACTGTCCCACCTAACGTTGCAACTGGGAGACTTCCGGGGGCC
TCACTGCTCCTAGAGCCCTCTTCGCTGACTGCCAATATGAAGGAGGTACCTCTGTTCAGGCTACGTCACTTCCCTTGTGGGAATGTCAAT
TACGGCTACCAGCAACAGGGCTTGCCCTTAGAAGCCGCTACTGCCCCTGGAGCTGGTCATTACGAGGATACCATTCTGAAAAGCAAGAAT

>In-frame_KCNQ5_ENST00000355194_chr6_73332315_+_ALK_ENST00000389048_chr2_29498362_-_3438nt
ATGCCCCGCCACCACGCGGGAGGAGAGGAGGGCGGCGCCGCCGGGCTCTGGGTGAAGAGCGGCGCAGCGGCGGCGGCGGCGGGCGGGGGG
CGCTTGGGCAGCGGCATGAAGGATGTGGAGTCCGGCCGGGGCAGGGTGCTGCTGAACTCGGCAGCCGCCAGGGGCGACGGCCTGCTACTG
CTGGGCACCCGCGCGGCCACGCTCGGTGGCGGCGGCGGTGGCCTGAGGGAGAGCCGCCGGGGCAAGCAGGGGGCCCGGATGAGCCTGCTG
GGGAAGCCGCTCTCTTACACGAGTAGCCAGAGCTGCCGGCGCAACGTCAAGTACCGGCGGGTGCAGAACTACCTGTACAACGTGCTGGAG
AGACCCCGCGGCTGGGCGTTCATCTACCACGCGTTCTGGCTGCAGATGGTCGCATGGTGGGGACAAGGATCCAGAGCCATCGTGGCTTTT
GACAATATCTCCATCAGCCTGGACTGCTACCTCACCATTAGCGGAGAGGACAAGATCCTGCAGAATACAGCACCCAAATCAAGAAACCTG
TTTGAGAGAAACCCAAACAAGGAGCTGAAACCCGGGGAAAATTCACCAAGACAGACCCCCATCTTTGACCCTACAGTTCATTGGCTGTTC
ACCACATGTGGGGCCAGCGGGCCCCATGGCCCCACCCAGGCACAGTGCAACAACGCCTACCAGAACTCCAACCTGAGCGTGGAGGTGGGG
AGCGAGGGCCCCCTGAAAGGCATCCAGATCTGGAAGGTGCCAGCCACCGACACCTACAGCATCTCGGGCTACGGAGCTGCTGGCGGGAAA
GGCGGGAAGAACACCATGATGCGGTCCCACGGCGTGTCTGTGCTGGGCATCTTCAACCTGGAGAAGGATGACATGCTGTACATCCTGGTT
GGGCAGCAGGGAGAGGACGCCTGCCCCAGTACAAACCAGTTAATCCAGAAAGTCTGCATTGGAGAGAACAATGTGATAGAAGAAGAAATC
CGTGTGAACAGAAGCGTGCATGAGTGGGCAGGAGGCGGAGGAGGAGGGGGTGGAGCCACCTACGTATTTAAGATGAAGGATGGAGTGCCG
GTGCCCCTGATCATTGCAGCCGGAGGTGGTGGCAGGGCCTACGGGGCCAAGACAGACACGTTCCACCCAGAGAGACTGGAGAATAACTCC
TCGGTTCTAGGGCTAAACGGCAATTCCGGAGCCGCAGGTGGTGGAGGTGGCTGGAATGATAACACTTCCTTGCTCTGGGCCGGAAAATCT
TTGCAGGAGGGTGCCACCGGAGGACATTCCTGCCCCCAGGCCATGAAGAAGTGGGGGTGGGAGACAAGAGGGGGTTTCGGAGGGGGTGGA
GGGGGGTGCTCCTCAGGTGGAGGAGGCGGAGGATATATAGGCGGCAATGCAGCCTCAAACAATGACCCCGAAATGGATGGGGAAGATGGG
GTTTCCTTCATCAGTCCACTGGGCATCCTGTACACCCCAGCTTTAAAAGTGATGGAAGGCCACGGGGAAGTGAATATTAAGCATTATCTA
AACTGCAGTCACTGTGAGGTAGACGAATGTCACATGGACCCTGAAAGCCACAAGGTCATCTGCTTCTGTGACCACGGGACGGTGCTGGCT
GAGGATGGCGTCTCCTGCATTGTGTCACCCACCCCGGAGCCACACCTGCCACTCTCGCTGATCCTCTCTGTGGTGACCTCTGCCCTCGTG
GCCGCCCTGGTCCTGGCTTTCTCCGGCATCATGATTGTGTACCGCCGGAAGCACCAGGAGCTGCAAGCCATGCAGATGGAGCTGCAGAGC
CCTGAGTACAAGCTGAGCAAGCTCCGCACCTCGACCATCATGACCGACTACAACCCCAACTACTGCTTTGCTGGCAAGACCTCCTCCATC
AGTGACCTGAAGGAGGTGCCGCGGAAAAACATCACCCTCATTCGGGGTCTGGGCCATGGCGCCTTTGGGGAGGTGTATGAAGGCCAGGTG
TCCGGAATGCCCAACGACCCAAGCCCCCTGCAAGTGGCTGTGAAGACGCTGCCTGAAGTGTGCTCTGAACAGGACGAACTGGATTTCCTC
ATGGAAGCCCTGATCATCAGCAAATTCAACCACCAGAACATTGTTCGCTGCATTGGGGTGAGCCTGCAATCCCTGCCCCGGTTCATCCTG
CTGGAGCTCATGGCGGGGGGAGACCTCAAGTCCTTCCTCCGAGAGACCCGCCCTCGCCCGAGCCAGCCCTCCTCCCTGGCCATGCTGGAC
CTTCTGCACGTGGCTCGGGACATTGCCTGTGGCTGTCAGTATTTGGAGGAAAACCACTTCATCCACCGAGACATTGCTGCCAGAAACTGC
CTCTTGACCTGTCCAGGCCCTGGAAGAGTGGCCAAGATTGGAGACTTCGGGATGGCCCGAGACATCTACAGGGCGAGCTACTATAGAAAG
GGAGGCTGTGCCATGCTGCCAGTTAAGTGGATGCCCCCAGAGGCCTTCATGGAAGGAATATTCACTTCTAAAACAGACACATGGTCCTTT
GGAGTGCTGCTATGGGAAATCTTTTCTCTTGGATATATGCCATACCCCAGCAAAAGCAACCAGGAAGTTCTGGAGTTTGTCACCAGTGGA
GGCCGGATGGACCCACCCAAGAACTGCCCTGGGCCTGTATACCGGATAATGACTCAGTGCTGGCAACATCAGCCTGAAGACAGGCCCAAC
TTTGCCATCATTTTGGAGAGGATTGAATACTGCACCCAGGACCCGGATGTAATCAACACCGCTTTGCCGATAGAATATGGTCCACTTGTG
GAAGAGGAAGAGAAAGTGCCTGTGAGGCCCAAGGACCCTGAGGGGGTTCCTCCTCTCCTGGTCTCTCAACAGGCAAAACGGGAGGAGGAG
CGCAGCCCAGCTGCCCCACCACCTCTGCCTACCACCTCCTCTGGCAAGGCTGCAAAGAAACCCACAGCTGCAGAGATCTCTGTTCGAGTC
CCTAGAGGGCCGGCCGTGGAAGGGGGACACGTGAATATGGCATTCTCTCAGTCCAACCCTCCTTCGGAGTTGCACAAGGTCCACGGATCC
AGAAACAAGCCCACCAGCTTGTGGAACCCAACGTACGGCTCCTGGTTTACAGAGAAACCCACCAAAAAGAATAATCCTATAGCAAAGAAG
GAGCCACACGACAGGGGTAACCTGGGGCTGGAGGGAAGCTGTACTGTCCCACCTAACGTTGCAACTGGGAGACTTCCGGGGGCCTCACTG
CTCCTAGAGCCCTCTTCGCTGACTGCCAATATGAAGGAGGTACCTCTGTTCAGGCTACGTCACTTCCCTTGTGGGAATGTCAATTACGGC
TACCAGCAACAGGGCTTGCCCTTAGAAGCCGCTACTGCCCCTGGAGCTGGTCATTACGAGGATACCATTCTGAAAAGCAAGAATAGCATG

>In-frame_KCNQ5_ENST00000370398_chr6_73332315_+_ALK_ENST00000389048_chr2_29498362_-_3444nt
ATGCCCCGCCACCACGCGGGAGGAGAGGAGGGCGGCGCCGCCGGGCTCTGGGTGAAGAGCGGCGCAGCGGCGGCGGCGGCGGGCGGGGGG
CGCTTGGGCAGCGGCATGAAGGATGTGGAGTCCGGCCGGGGCAGGGTGCTGCTGAACTCGGCAGCCGCCAGGGGCGACGGCCTGCTACTG
CTGGGCACCCGCGCGGCCACGCTCGGTGGCGGCGGCGGTGGCCTGAGGGAGAGCCGCCGGGGCAAGCAGGGGGCCCGGATGAGCCTGCTG
GGGAAGCCGCTCTCTTACACGAGTAGCCAGAGCTGCCGGCGCAACGTCAAGTACCGGCGGGTGCAGAACTACCTGTACAACGTGCTGGAG
AGACCCCGCGGCTGGGCGTTCATCTACCACGCTTTCGTGTTCTGGCTGCAGATGGTCGCATGGTGGGGACAAGGATCCAGAGCCATCGTG
GCTTTTGACAATATCTCCATCAGCCTGGACTGCTACCTCACCATTAGCGGAGAGGACAAGATCCTGCAGAATACAGCACCCAAATCAAGA
AACCTGTTTGAGAGAAACCCAAACAAGGAGCTGAAACCCGGGGAAAATTCACCAAGACAGACCCCCATCTTTGACCCTACAGTTCATTGG
CTGTTCACCACATGTGGGGCCAGCGGGCCCCATGGCCCCACCCAGGCACAGTGCAACAACGCCTACCAGAACTCCAACCTGAGCGTGGAG
GTGGGGAGCGAGGGCCCCCTGAAAGGCATCCAGATCTGGAAGGTGCCAGCCACCGACACCTACAGCATCTCGGGCTACGGAGCTGCTGGC
GGGAAAGGCGGGAAGAACACCATGATGCGGTCCCACGGCGTGTCTGTGCTGGGCATCTTCAACCTGGAGAAGGATGACATGCTGTACATC
CTGGTTGGGCAGCAGGGAGAGGACGCCTGCCCCAGTACAAACCAGTTAATCCAGAAAGTCTGCATTGGAGAGAACAATGTGATAGAAGAA
GAAATCCGTGTGAACAGAAGCGTGCATGAGTGGGCAGGAGGCGGAGGAGGAGGGGGTGGAGCCACCTACGTATTTAAGATGAAGGATGGA
GTGCCGGTGCCCCTGATCATTGCAGCCGGAGGTGGTGGCAGGGCCTACGGGGCCAAGACAGACACGTTCCACCCAGAGAGACTGGAGAAT
AACTCCTCGGTTCTAGGGCTAAACGGCAATTCCGGAGCCGCAGGTGGTGGAGGTGGCTGGAATGATAACACTTCCTTGCTCTGGGCCGGA
AAATCTTTGCAGGAGGGTGCCACCGGAGGACATTCCTGCCCCCAGGCCATGAAGAAGTGGGGGTGGGAGACAAGAGGGGGTTTCGGAGGG
GGTGGAGGGGGGTGCTCCTCAGGTGGAGGAGGCGGAGGATATATAGGCGGCAATGCAGCCTCAAACAATGACCCCGAAATGGATGGGGAA
GATGGGGTTTCCTTCATCAGTCCACTGGGCATCCTGTACACCCCAGCTTTAAAAGTGATGGAAGGCCACGGGGAAGTGAATATTAAGCAT
TATCTAAACTGCAGTCACTGTGAGGTAGACGAATGTCACATGGACCCTGAAAGCCACAAGGTCATCTGCTTCTGTGACCACGGGACGGTG
CTGGCTGAGGATGGCGTCTCCTGCATTGTGTCACCCACCCCGGAGCCACACCTGCCACTCTCGCTGATCCTCTCTGTGGTGACCTCTGCC
CTCGTGGCCGCCCTGGTCCTGGCTTTCTCCGGCATCATGATTGTGTACCGCCGGAAGCACCAGGAGCTGCAAGCCATGCAGATGGAGCTG
CAGAGCCCTGAGTACAAGCTGAGCAAGCTCCGCACCTCGACCATCATGACCGACTACAACCCCAACTACTGCTTTGCTGGCAAGACCTCC
TCCATCAGTGACCTGAAGGAGGTGCCGCGGAAAAACATCACCCTCATTCGGGGTCTGGGCCATGGCGCCTTTGGGGAGGTGTATGAAGGC
CAGGTGTCCGGAATGCCCAACGACCCAAGCCCCCTGCAAGTGGCTGTGAAGACGCTGCCTGAAGTGTGCTCTGAACAGGACGAACTGGAT
TTCCTCATGGAAGCCCTGATCATCAGCAAATTCAACCACCAGAACATTGTTCGCTGCATTGGGGTGAGCCTGCAATCCCTGCCCCGGTTC
ATCCTGCTGGAGCTCATGGCGGGGGGAGACCTCAAGTCCTTCCTCCGAGAGACCCGCCCTCGCCCGAGCCAGCCCTCCTCCCTGGCCATG
CTGGACCTTCTGCACGTGGCTCGGGACATTGCCTGTGGCTGTCAGTATTTGGAGGAAAACCACTTCATCCACCGAGACATTGCTGCCAGA
AACTGCCTCTTGACCTGTCCAGGCCCTGGAAGAGTGGCCAAGATTGGAGACTTCGGGATGGCCCGAGACATCTACAGGGCGAGCTACTAT
AGAAAGGGAGGCTGTGCCATGCTGCCAGTTAAGTGGATGCCCCCAGAGGCCTTCATGGAAGGAATATTCACTTCTAAAACAGACACATGG
TCCTTTGGAGTGCTGCTATGGGAAATCTTTTCTCTTGGATATATGCCATACCCCAGCAAAAGCAACCAGGAAGTTCTGGAGTTTGTCACC
AGTGGAGGCCGGATGGACCCACCCAAGAACTGCCCTGGGCCTGTATACCGGATAATGACTCAGTGCTGGCAACATCAGCCTGAAGACAGG
CCCAACTTTGCCATCATTTTGGAGAGGATTGAATACTGCACCCAGGACCCGGATGTAATCAACACCGCTTTGCCGATAGAATATGGTCCA
CTTGTGGAAGAGGAAGAGAAAGTGCCTGTGAGGCCCAAGGACCCTGAGGGGGTTCCTCCTCTCCTGGTCTCTCAACAGGCAAAACGGGAG
GAGGAGCGCAGCCCAGCTGCCCCACCACCTCTGCCTACCACCTCCTCTGGCAAGGCTGCAAAGAAACCCACAGCTGCAGAGATCTCTGTT
CGAGTCCCTAGAGGGCCGGCCGTGGAAGGGGGACACGTGAATATGGCATTCTCTCAGTCCAACCCTCCTTCGGAGTTGCACAAGGTCCAC
GGATCCAGAAACAAGCCCACCAGCTTGTGGAACCCAACGTACGGCTCCTGGTTTACAGAGAAACCCACCAAAAAGAATAATCCTATAGCA
AAGAAGGAGCCACACGACAGGGGTAACCTGGGGCTGGAGGGAAGCTGTACTGTCCCACCTAACGTTGCAACTGGGAGACTTCCGGGGGCC
TCACTGCTCCTAGAGCCCTCTTCGCTGACTGCCAATATGAAGGAGGTACCTCTGTTCAGGCTACGTCACTTCCCTTGTGGGAATGTCAAT
TACGGCTACCAGCAACAGGGCTTGCCCTTAGAAGCCGCTACTGCCCCTGGAGCTGGTCATTACGAGGATACCATTCTGAAAAGCAAGAAT

>In-frame_KCNQ5_ENST00000370392_chr6_73332315_+_ALK_ENST00000389048_chr2_29498362_-_3444nt
ATGCCCCGCCACCACGCGGGAGGAGAGGAGGGCGGCGCCGCCGGGCTCTGGGTGAAGAGCGGCGCAGCGGCGGCGGCGGCGGGCGGGGGG
CGCTTGGGCAGCGGCATGAAGGATGTGGAGTCCGGCCGGGGCAGGGTGCTGCTGAACTCGGCAGCCGCCAGGGGCGACGGCCTGCTACTG
CTGGGCACCCGCGCGGCCACGCTCGGTGGCGGCGGCGGTGGCCTGAGGGAGAGCCGCCGGGGCAAGCAGGGGGCCCGGATGAGCCTGCTG
GGGAAGCCGCTCTCTTACACGAGTAGCCAGAGCTGCCGGCGCAACGTCAAGTACCGGCGGGTGCAGAACTACCTGTACAACGTGCTGGAG
AGACCCCGCGGCTGGGCGTTCATCTACCACGCTTTCGTGTTCTGGCTGCAGATGGTCGCATGGTGGGGACAAGGATCCAGAGCCATCGTG
GCTTTTGACAATATCTCCATCAGCCTGGACTGCTACCTCACCATTAGCGGAGAGGACAAGATCCTGCAGAATACAGCACCCAAATCAAGA
AACCTGTTTGAGAGAAACCCAAACAAGGAGCTGAAACCCGGGGAAAATTCACCAAGACAGACCCCCATCTTTGACCCTACAGTTCATTGG
CTGTTCACCACATGTGGGGCCAGCGGGCCCCATGGCCCCACCCAGGCACAGTGCAACAACGCCTACCAGAACTCCAACCTGAGCGTGGAG
GTGGGGAGCGAGGGCCCCCTGAAAGGCATCCAGATCTGGAAGGTGCCAGCCACCGACACCTACAGCATCTCGGGCTACGGAGCTGCTGGC
GGGAAAGGCGGGAAGAACACCATGATGCGGTCCCACGGCGTGTCTGTGCTGGGCATCTTCAACCTGGAGAAGGATGACATGCTGTACATC
CTGGTTGGGCAGCAGGGAGAGGACGCCTGCCCCAGTACAAACCAGTTAATCCAGAAAGTCTGCATTGGAGAGAACAATGTGATAGAAGAA
GAAATCCGTGTGAACAGAAGCGTGCATGAGTGGGCAGGAGGCGGAGGAGGAGGGGGTGGAGCCACCTACGTATTTAAGATGAAGGATGGA
GTGCCGGTGCCCCTGATCATTGCAGCCGGAGGTGGTGGCAGGGCCTACGGGGCCAAGACAGACACGTTCCACCCAGAGAGACTGGAGAAT
AACTCCTCGGTTCTAGGGCTAAACGGCAATTCCGGAGCCGCAGGTGGTGGAGGTGGCTGGAATGATAACACTTCCTTGCTCTGGGCCGGA
AAATCTTTGCAGGAGGGTGCCACCGGAGGACATTCCTGCCCCCAGGCCATGAAGAAGTGGGGGTGGGAGACAAGAGGGGGTTTCGGAGGG
GGTGGAGGGGGGTGCTCCTCAGGTGGAGGAGGCGGAGGATATATAGGCGGCAATGCAGCCTCAAACAATGACCCCGAAATGGATGGGGAA
GATGGGGTTTCCTTCATCAGTCCACTGGGCATCCTGTACACCCCAGCTTTAAAAGTGATGGAAGGCCACGGGGAAGTGAATATTAAGCAT
TATCTAAACTGCAGTCACTGTGAGGTAGACGAATGTCACATGGACCCTGAAAGCCACAAGGTCATCTGCTTCTGTGACCACGGGACGGTG
CTGGCTGAGGATGGCGTCTCCTGCATTGTGTCACCCACCCCGGAGCCACACCTGCCACTCTCGCTGATCCTCTCTGTGGTGACCTCTGCC
CTCGTGGCCGCCCTGGTCCTGGCTTTCTCCGGCATCATGATTGTGTACCGCCGGAAGCACCAGGAGCTGCAAGCCATGCAGATGGAGCTG
CAGAGCCCTGAGTACAAGCTGAGCAAGCTCCGCACCTCGACCATCATGACCGACTACAACCCCAACTACTGCTTTGCTGGCAAGACCTCC
TCCATCAGTGACCTGAAGGAGGTGCCGCGGAAAAACATCACCCTCATTCGGGGTCTGGGCCATGGCGCCTTTGGGGAGGTGTATGAAGGC
CAGGTGTCCGGAATGCCCAACGACCCAAGCCCCCTGCAAGTGGCTGTGAAGACGCTGCCTGAAGTGTGCTCTGAACAGGACGAACTGGAT
TTCCTCATGGAAGCCCTGATCATCAGCAAATTCAACCACCAGAACATTGTTCGCTGCATTGGGGTGAGCCTGCAATCCCTGCCCCGGTTC
ATCCTGCTGGAGCTCATGGCGGGGGGAGACCTCAAGTCCTTCCTCCGAGAGACCCGCCCTCGCCCGAGCCAGCCCTCCTCCCTGGCCATG
CTGGACCTTCTGCACGTGGCTCGGGACATTGCCTGTGGCTGTCAGTATTTGGAGGAAAACCACTTCATCCACCGAGACATTGCTGCCAGA
AACTGCCTCTTGACCTGTCCAGGCCCTGGAAGAGTGGCCAAGATTGGAGACTTCGGGATGGCCCGAGACATCTACAGGGCGAGCTACTAT
AGAAAGGGAGGCTGTGCCATGCTGCCAGTTAAGTGGATGCCCCCAGAGGCCTTCATGGAAGGAATATTCACTTCTAAAACAGACACATGG
TCCTTTGGAGTGCTGCTATGGGAAATCTTTTCTCTTGGATATATGCCATACCCCAGCAAAAGCAACCAGGAAGTTCTGGAGTTTGTCACC
AGTGGAGGCCGGATGGACCCACCCAAGAACTGCCCTGGGCCTGTATACCGGATAATGACTCAGTGCTGGCAACATCAGCCTGAAGACAGG
CCCAACTTTGCCATCATTTTGGAGAGGATTGAATACTGCACCCAGGACCCGGATGTAATCAACACCGCTTTGCCGATAGAATATGGTCCA
CTTGTGGAAGAGGAAGAGAAAGTGCCTGTGAGGCCCAAGGACCCTGAGGGGGTTCCTCCTCTCCTGGTCTCTCAACAGGCAAAACGGGAG
GAGGAGCGCAGCCCAGCTGCCCCACCACCTCTGCCTACCACCTCCTCTGGCAAGGCTGCAAAGAAACCCACAGCTGCAGAGATCTCTGTT
CGAGTCCCTAGAGGGCCGGCCGTGGAAGGGGGACACGTGAATATGGCATTCTCTCAGTCCAACCCTCCTTCGGAGTTGCACAAGGTCCAC
GGATCCAGAAACAAGCCCACCAGCTTGTGGAACCCAACGTACGGCTCCTGGTTTACAGAGAAACCCACCAAAAAGAATAATCCTATAGCA
AAGAAGGAGCCACACGACAGGGGTAACCTGGGGCTGGAGGGAAGCTGTACTGTCCCACCTAACGTTGCAACTGGGAGACTTCCGGGGGCC
TCACTGCTCCTAGAGCCCTCTTCGCTGACTGCCAATATGAAGGAGGTACCTCTGTTCAGGCTACGTCACTTCCCTTGTGGGAATGTCAAT
TACGGCTACCAGCAACAGGGCTTGCCCTTAGAAGCCGCTACTGCCCCTGGAGCTGGTCATTACGAGGATACCATTCTGAAAAGCAAGAAT

>In-frame_KCNQ5_ENST00000355635_chr6_73332315_+_ALK_ENST00000389048_chr2_29498362_-_3444nt
ATGCCCCGCCACCACGCGGGAGGAGAGGAGGGCGGCGCCGCCGGGCTCTGGGTGAAGAGCGGCGCAGCGGCGGCGGCGGCGGGCGGGGGG
CGCTTGGGCAGCGGCATGAAGGATGTGGAGTCCGGCCGGGGCAGGGTGCTGCTGAACTCGGCAGCCGCCAGGGGCGACGGCCTGCTACTG
CTGGGCACCCGCGCGGCCACGCTCGGTGGCGGCGGCGGTGGCCTGAGGGAGAGCCGCCGGGGCAAGCAGGGGGCCCGGATGAGCCTGCTG
GGGAAGCCGCTCTCTTACACGAGTAGCCAGAGCTGCCGGCGCAACGTCAAGTACCGGCGGGTGCAGAACTACCTGTACAACGTGCTGGAG
AGACCCCGCGGCTGGGCGTTCATCTACCACGCTTTCGTGTTCTGGCTGCAGATGGTCGCATGGTGGGGACAAGGATCCAGAGCCATCGTG
GCTTTTGACAATATCTCCATCAGCCTGGACTGCTACCTCACCATTAGCGGAGAGGACAAGATCCTGCAGAATACAGCACCCAAATCAAGA
AACCTGTTTGAGAGAAACCCAAACAAGGAGCTGAAACCCGGGGAAAATTCACCAAGACAGACCCCCATCTTTGACCCTACAGTTCATTGG
CTGTTCACCACATGTGGGGCCAGCGGGCCCCATGGCCCCACCCAGGCACAGTGCAACAACGCCTACCAGAACTCCAACCTGAGCGTGGAG
GTGGGGAGCGAGGGCCCCCTGAAAGGCATCCAGATCTGGAAGGTGCCAGCCACCGACACCTACAGCATCTCGGGCTACGGAGCTGCTGGC
GGGAAAGGCGGGAAGAACACCATGATGCGGTCCCACGGCGTGTCTGTGCTGGGCATCTTCAACCTGGAGAAGGATGACATGCTGTACATC
CTGGTTGGGCAGCAGGGAGAGGACGCCTGCCCCAGTACAAACCAGTTAATCCAGAAAGTCTGCATTGGAGAGAACAATGTGATAGAAGAA
GAAATCCGTGTGAACAGAAGCGTGCATGAGTGGGCAGGAGGCGGAGGAGGAGGGGGTGGAGCCACCTACGTATTTAAGATGAAGGATGGA
GTGCCGGTGCCCCTGATCATTGCAGCCGGAGGTGGTGGCAGGGCCTACGGGGCCAAGACAGACACGTTCCACCCAGAGAGACTGGAGAAT
AACTCCTCGGTTCTAGGGCTAAACGGCAATTCCGGAGCCGCAGGTGGTGGAGGTGGCTGGAATGATAACACTTCCTTGCTCTGGGCCGGA
AAATCTTTGCAGGAGGGTGCCACCGGAGGACATTCCTGCCCCCAGGCCATGAAGAAGTGGGGGTGGGAGACAAGAGGGGGTTTCGGAGGG
GGTGGAGGGGGGTGCTCCTCAGGTGGAGGAGGCGGAGGATATATAGGCGGCAATGCAGCCTCAAACAATGACCCCGAAATGGATGGGGAA
GATGGGGTTTCCTTCATCAGTCCACTGGGCATCCTGTACACCCCAGCTTTAAAAGTGATGGAAGGCCACGGGGAAGTGAATATTAAGCAT
TATCTAAACTGCAGTCACTGTGAGGTAGACGAATGTCACATGGACCCTGAAAGCCACAAGGTCATCTGCTTCTGTGACCACGGGACGGTG
CTGGCTGAGGATGGCGTCTCCTGCATTGTGTCACCCACCCCGGAGCCACACCTGCCACTCTCGCTGATCCTCTCTGTGGTGACCTCTGCC
CTCGTGGCCGCCCTGGTCCTGGCTTTCTCCGGCATCATGATTGTGTACCGCCGGAAGCACCAGGAGCTGCAAGCCATGCAGATGGAGCTG
CAGAGCCCTGAGTACAAGCTGAGCAAGCTCCGCACCTCGACCATCATGACCGACTACAACCCCAACTACTGCTTTGCTGGCAAGACCTCC
TCCATCAGTGACCTGAAGGAGGTGCCGCGGAAAAACATCACCCTCATTCGGGGTCTGGGCCATGGCGCCTTTGGGGAGGTGTATGAAGGC
CAGGTGTCCGGAATGCCCAACGACCCAAGCCCCCTGCAAGTGGCTGTGAAGACGCTGCCTGAAGTGTGCTCTGAACAGGACGAACTGGAT
TTCCTCATGGAAGCCCTGATCATCAGCAAATTCAACCACCAGAACATTGTTCGCTGCATTGGGGTGAGCCTGCAATCCCTGCCCCGGTTC
ATCCTGCTGGAGCTCATGGCGGGGGGAGACCTCAAGTCCTTCCTCCGAGAGACCCGCCCTCGCCCGAGCCAGCCCTCCTCCCTGGCCATG
CTGGACCTTCTGCACGTGGCTCGGGACATTGCCTGTGGCTGTCAGTATTTGGAGGAAAACCACTTCATCCACCGAGACATTGCTGCCAGA
AACTGCCTCTTGACCTGTCCAGGCCCTGGAAGAGTGGCCAAGATTGGAGACTTCGGGATGGCCCGAGACATCTACAGGGCGAGCTACTAT
AGAAAGGGAGGCTGTGCCATGCTGCCAGTTAAGTGGATGCCCCCAGAGGCCTTCATGGAAGGAATATTCACTTCTAAAACAGACACATGG
TCCTTTGGAGTGCTGCTATGGGAAATCTTTTCTCTTGGATATATGCCATACCCCAGCAAAAGCAACCAGGAAGTTCTGGAGTTTGTCACC
AGTGGAGGCCGGATGGACCCACCCAAGAACTGCCCTGGGCCTGTATACCGGATAATGACTCAGTGCTGGCAACATCAGCCTGAAGACAGG
CCCAACTTTGCCATCATTTTGGAGAGGATTGAATACTGCACCCAGGACCCGGATGTAATCAACACCGCTTTGCCGATAGAATATGGTCCA
CTTGTGGAAGAGGAAGAGAAAGTGCCTGTGAGGCCCAAGGACCCTGAGGGGGTTCCTCCTCTCCTGGTCTCTCAACAGGCAAAACGGGAG
GAGGAGCGCAGCCCAGCTGCCCCACCACCTCTGCCTACCACCTCCTCTGGCAAGGCTGCAAAGAAACCCACAGCTGCAGAGATCTCTGTT
CGAGTCCCTAGAGGGCCGGCCGTGGAAGGGGGACACGTGAATATGGCATTCTCTCAGTCCAACCCTCCTTCGGAGTTGCACAAGGTCCAC
GGATCCAGAAACAAGCCCACCAGCTTGTGGAACCCAACGTACGGCTCCTGGTTTACAGAGAAACCCACCAAAAAGAATAATCCTATAGCA
AAGAAGGAGCCACACGACAGGGGTAACCTGGGGCTGGAGGGAAGCTGTACTGTCCCACCTAACGTTGCAACTGGGAGACTTCCGGGGGCC
TCACTGCTCCTAGAGCCCTCTTCGCTGACTGCCAATATGAAGGAGGTACCTCTGTTCAGGCTACGTCACTTCCCTTGTGGGAATGTCAAT
TACGGCTACCAGCAACAGGGCTTGCCCTTAGAAGCCGCTACTGCCCCTGGAGCTGGTCATTACGAGGATACCATTCTGAAAAGCAAGAAT

>In-frame_KCNQ5_ENST00000414165_chr6_73332315_+_ALK_ENST00000389048_chr2_29498362_-_3444nt
ATGCCCCGCCACCACGCGGGAGGAGAGGAGGGCGGCGCCGCCGGGCTCTGGGTGAAGAGCGGCGCAGCGGCGGCGGCGGCGGGCGGGGGG
CGCTTGGGCAGCGGCATGAAGGATGTGGAGTCCGGCCGGGGCAGGGTGCTGCTGAACTCGGCAGCCGCCAGGGGCGACGGCCTGCTACTG
CTGGGCACCCGCGCGGCCACGCTCGGTGGCGGCGGCGGTGGCCTGAGGGAGAGCCGCCGGGGCAAGCAGGGGGCCCGGATGAGCCTGCTG
GGGAAGCCGCTCTCTTACACGAGTAGCCAGAGCTGCCGGCGCAACGTCAAGTACCGGCGGGTGCAGAACTACCTGTACAACGTGCTGGAG
AGACCCCGCGGCTGGGCGTTCATCTACCACGCTTTCGTGTTCTGGCTGCAGATGGTCGCATGGTGGGGACAAGGATCCAGAGCCATCGTG
GCTTTTGACAATATCTCCATCAGCCTGGACTGCTACCTCACCATTAGCGGAGAGGACAAGATCCTGCAGAATACAGCACCCAAATCAAGA
AACCTGTTTGAGAGAAACCCAAACAAGGAGCTGAAACCCGGGGAAAATTCACCAAGACAGACCCCCATCTTTGACCCTACAGTTCATTGG
CTGTTCACCACATGTGGGGCCAGCGGGCCCCATGGCCCCACCCAGGCACAGTGCAACAACGCCTACCAGAACTCCAACCTGAGCGTGGAG
GTGGGGAGCGAGGGCCCCCTGAAAGGCATCCAGATCTGGAAGGTGCCAGCCACCGACACCTACAGCATCTCGGGCTACGGAGCTGCTGGC
GGGAAAGGCGGGAAGAACACCATGATGCGGTCCCACGGCGTGTCTGTGCTGGGCATCTTCAACCTGGAGAAGGATGACATGCTGTACATC
CTGGTTGGGCAGCAGGGAGAGGACGCCTGCCCCAGTACAAACCAGTTAATCCAGAAAGTCTGCATTGGAGAGAACAATGTGATAGAAGAA
GAAATCCGTGTGAACAGAAGCGTGCATGAGTGGGCAGGAGGCGGAGGAGGAGGGGGTGGAGCCACCTACGTATTTAAGATGAAGGATGGA
GTGCCGGTGCCCCTGATCATTGCAGCCGGAGGTGGTGGCAGGGCCTACGGGGCCAAGACAGACACGTTCCACCCAGAGAGACTGGAGAAT
AACTCCTCGGTTCTAGGGCTAAACGGCAATTCCGGAGCCGCAGGTGGTGGAGGTGGCTGGAATGATAACACTTCCTTGCTCTGGGCCGGA
AAATCTTTGCAGGAGGGTGCCACCGGAGGACATTCCTGCCCCCAGGCCATGAAGAAGTGGGGGTGGGAGACAAGAGGGGGTTTCGGAGGG
GGTGGAGGGGGGTGCTCCTCAGGTGGAGGAGGCGGAGGATATATAGGCGGCAATGCAGCCTCAAACAATGACCCCGAAATGGATGGGGAA
GATGGGGTTTCCTTCATCAGTCCACTGGGCATCCTGTACACCCCAGCTTTAAAAGTGATGGAAGGCCACGGGGAAGTGAATATTAAGCAT
TATCTAAACTGCAGTCACTGTGAGGTAGACGAATGTCACATGGACCCTGAAAGCCACAAGGTCATCTGCTTCTGTGACCACGGGACGGTG
CTGGCTGAGGATGGCGTCTCCTGCATTGTGTCACCCACCCCGGAGCCACACCTGCCACTCTCGCTGATCCTCTCTGTGGTGACCTCTGCC
CTCGTGGCCGCCCTGGTCCTGGCTTTCTCCGGCATCATGATTGTGTACCGCCGGAAGCACCAGGAGCTGCAAGCCATGCAGATGGAGCTG
CAGAGCCCTGAGTACAAGCTGAGCAAGCTCCGCACCTCGACCATCATGACCGACTACAACCCCAACTACTGCTTTGCTGGCAAGACCTCC
TCCATCAGTGACCTGAAGGAGGTGCCGCGGAAAAACATCACCCTCATTCGGGGTCTGGGCCATGGCGCCTTTGGGGAGGTGTATGAAGGC
CAGGTGTCCGGAATGCCCAACGACCCAAGCCCCCTGCAAGTGGCTGTGAAGACGCTGCCTGAAGTGTGCTCTGAACAGGACGAACTGGAT
TTCCTCATGGAAGCCCTGATCATCAGCAAATTCAACCACCAGAACATTGTTCGCTGCATTGGGGTGAGCCTGCAATCCCTGCCCCGGTTC
ATCCTGCTGGAGCTCATGGCGGGGGGAGACCTCAAGTCCTTCCTCCGAGAGACCCGCCCTCGCCCGAGCCAGCCCTCCTCCCTGGCCATG
CTGGACCTTCTGCACGTGGCTCGGGACATTGCCTGTGGCTGTCAGTATTTGGAGGAAAACCACTTCATCCACCGAGACATTGCTGCCAGA
AACTGCCTCTTGACCTGTCCAGGCCCTGGAAGAGTGGCCAAGATTGGAGACTTCGGGATGGCCCGAGACATCTACAGGGCGAGCTACTAT
AGAAAGGGAGGCTGTGCCATGCTGCCAGTTAAGTGGATGCCCCCAGAGGCCTTCATGGAAGGAATATTCACTTCTAAAACAGACACATGG
TCCTTTGGAGTGCTGCTATGGGAAATCTTTTCTCTTGGATATATGCCATACCCCAGCAAAAGCAACCAGGAAGTTCTGGAGTTTGTCACC
AGTGGAGGCCGGATGGACCCACCCAAGAACTGCCCTGGGCCTGTATACCGGATAATGACTCAGTGCTGGCAACATCAGCCTGAAGACAGG
CCCAACTTTGCCATCATTTTGGAGAGGATTGAATACTGCACCCAGGACCCGGATGTAATCAACACCGCTTTGCCGATAGAATATGGTCCA
CTTGTGGAAGAGGAAGAGAAAGTGCCTGTGAGGCCCAAGGACCCTGAGGGGGTTCCTCCTCTCCTGGTCTCTCAACAGGCAAAACGGGAG
GAGGAGCGCAGCCCAGCTGCCCCACCACCTCTGCCTACCACCTCCTCTGGCAAGGCTGCAAAGAAACCCACAGCTGCAGAGATCTCTGTT
CGAGTCCCTAGAGGGCCGGCCGTGGAAGGGGGACACGTGAATATGGCATTCTCTCAGTCCAACCCTCCTTCGGAGTTGCACAAGGTCCAC
GGATCCAGAAACAAGCCCACCAGCTTGTGGAACCCAACGTACGGCTCCTGGTTTACAGAGAAACCCACCAAAAAGAATAATCCTATAGCA
AAGAAGGAGCCACACGACAGGGGTAACCTGGGGCTGGAGGGAAGCTGTACTGTCCCACCTAACGTTGCAACTGGGAGACTTCCGGGGGCC
TCACTGCTCCTAGAGCCCTCTTCGCTGACTGCCAATATGAAGGAGGTACCTCTGTTCAGGCTACGTCACTTCCCTTGTGGGAATGTCAAT
TACGGCTACCAGCAACAGGGCTTGCCCTTAGAAGCCGCTACTGCCCCTGGAGCTGGTCATTACGAGGATACCATTCTGAAAAGCAAGAAT

>In-frame_KCNQ5_ENST00000402622_chr6_73332315_+_ALK_ENST00000389048_chr2_29498362_-_3444nt
ATGCCCCGCCACCACGCGGGAGGAGAGGAGGGCGGCGCCGCCGGGCTCTGGGTGAAGAGCGGCGCAGCGGCGGCGGCGGCGGGCGGGGGG
CGCTTGGGCAGCGGCATGAAGGATGTGGAGTCCGGCCGGGGCAGGGTGCTGCTGAACTCGGCAGCCGCCAGGGGCGACGGCCTGCTACTG
CTGGGCACCCGCGCGGCCACGCTCGGTGGCGGCGGCGGTGGCCTGAGGGAGAGCCGCCGGGGCAAGCAGGGGGCCCGGATGAGCCTGCTG
GGGAAGCCGCTCTCTTACACGAGTAGCCAGAGCTGCCGGCGCAACGTCAAGTACCGGCGGGTGCAGAACTACCTGTACAACGTGCTGGAG
AGACCCCGCGGCTGGGCGTTCATCTACCACGCTTTCGTGTTCTGGCTGCAGATGGTCGCATGGTGGGGACAAGGATCCAGAGCCATCGTG
GCTTTTGACAATATCTCCATCAGCCTGGACTGCTACCTCACCATTAGCGGAGAGGACAAGATCCTGCAGAATACAGCACCCAAATCAAGA
AACCTGTTTGAGAGAAACCCAAACAAGGAGCTGAAACCCGGGGAAAATTCACCAAGACAGACCCCCATCTTTGACCCTACAGTTCATTGG
CTGTTCACCACATGTGGGGCCAGCGGGCCCCATGGCCCCACCCAGGCACAGTGCAACAACGCCTACCAGAACTCCAACCTGAGCGTGGAG
GTGGGGAGCGAGGGCCCCCTGAAAGGCATCCAGATCTGGAAGGTGCCAGCCACCGACACCTACAGCATCTCGGGCTACGGAGCTGCTGGC
GGGAAAGGCGGGAAGAACACCATGATGCGGTCCCACGGCGTGTCTGTGCTGGGCATCTTCAACCTGGAGAAGGATGACATGCTGTACATC
CTGGTTGGGCAGCAGGGAGAGGACGCCTGCCCCAGTACAAACCAGTTAATCCAGAAAGTCTGCATTGGAGAGAACAATGTGATAGAAGAA
GAAATCCGTGTGAACAGAAGCGTGCATGAGTGGGCAGGAGGCGGAGGAGGAGGGGGTGGAGCCACCTACGTATTTAAGATGAAGGATGGA
GTGCCGGTGCCCCTGATCATTGCAGCCGGAGGTGGTGGCAGGGCCTACGGGGCCAAGACAGACACGTTCCACCCAGAGAGACTGGAGAAT
AACTCCTCGGTTCTAGGGCTAAACGGCAATTCCGGAGCCGCAGGTGGTGGAGGTGGCTGGAATGATAACACTTCCTTGCTCTGGGCCGGA
AAATCTTTGCAGGAGGGTGCCACCGGAGGACATTCCTGCCCCCAGGCCATGAAGAAGTGGGGGTGGGAGACAAGAGGGGGTTTCGGAGGG
GGTGGAGGGGGGTGCTCCTCAGGTGGAGGAGGCGGAGGATATATAGGCGGCAATGCAGCCTCAAACAATGACCCCGAAATGGATGGGGAA
GATGGGGTTTCCTTCATCAGTCCACTGGGCATCCTGTACACCCCAGCTTTAAAAGTGATGGAAGGCCACGGGGAAGTGAATATTAAGCAT
TATCTAAACTGCAGTCACTGTGAGGTAGACGAATGTCACATGGACCCTGAAAGCCACAAGGTCATCTGCTTCTGTGACCACGGGACGGTG
CTGGCTGAGGATGGCGTCTCCTGCATTGTGTCACCCACCCCGGAGCCACACCTGCCACTCTCGCTGATCCTCTCTGTGGTGACCTCTGCC
CTCGTGGCCGCCCTGGTCCTGGCTTTCTCCGGCATCATGATTGTGTACCGCCGGAAGCACCAGGAGCTGCAAGCCATGCAGATGGAGCTG
CAGAGCCCTGAGTACAAGCTGAGCAAGCTCCGCACCTCGACCATCATGACCGACTACAACCCCAACTACTGCTTTGCTGGCAAGACCTCC
TCCATCAGTGACCTGAAGGAGGTGCCGCGGAAAAACATCACCCTCATTCGGGGTCTGGGCCATGGCGCCTTTGGGGAGGTGTATGAAGGC
CAGGTGTCCGGAATGCCCAACGACCCAAGCCCCCTGCAAGTGGCTGTGAAGACGCTGCCTGAAGTGTGCTCTGAACAGGACGAACTGGAT
TTCCTCATGGAAGCCCTGATCATCAGCAAATTCAACCACCAGAACATTGTTCGCTGCATTGGGGTGAGCCTGCAATCCCTGCCCCGGTTC
ATCCTGCTGGAGCTCATGGCGGGGGGAGACCTCAAGTCCTTCCTCCGAGAGACCCGCCCTCGCCCGAGCCAGCCCTCCTCCCTGGCCATG
CTGGACCTTCTGCACGTGGCTCGGGACATTGCCTGTGGCTGTCAGTATTTGGAGGAAAACCACTTCATCCACCGAGACATTGCTGCCAGA
AACTGCCTCTTGACCTGTCCAGGCCCTGGAAGAGTGGCCAAGATTGGAGACTTCGGGATGGCCCGAGACATCTACAGGGCGAGCTACTAT
AGAAAGGGAGGCTGTGCCATGCTGCCAGTTAAGTGGATGCCCCCAGAGGCCTTCATGGAAGGAATATTCACTTCTAAAACAGACACATGG
TCCTTTGGAGTGCTGCTATGGGAAATCTTTTCTCTTGGATATATGCCATACCCCAGCAAAAGCAACCAGGAAGTTCTGGAGTTTGTCACC
AGTGGAGGCCGGATGGACCCACCCAAGAACTGCCCTGGGCCTGTATACCGGATAATGACTCAGTGCTGGCAACATCAGCCTGAAGACAGG
CCCAACTTTGCCATCATTTTGGAGAGGATTGAATACTGCACCCAGGACCCGGATGTAATCAACACCGCTTTGCCGATAGAATATGGTCCA
CTTGTGGAAGAGGAAGAGAAAGTGCCTGTGAGGCCCAAGGACCCTGAGGGGGTTCCTCCTCTCCTGGTCTCTCAACAGGCAAAACGGGAG
GAGGAGCGCAGCCCAGCTGCCCCACCACCTCTGCCTACCACCTCCTCTGGCAAGGCTGCAAAGAAACCCACAGCTGCAGAGATCTCTGTT
CGAGTCCCTAGAGGGCCGGCCGTGGAAGGGGGACACGTGAATATGGCATTCTCTCAGTCCAACCCTCCTTCGGAGTTGCACAAGGTCCAC
GGATCCAGAAACAAGCCCACCAGCTTGTGGAACCCAACGTACGGCTCCTGGTTTACAGAGAAACCCACCAAAAAGAATAATCCTATAGCA
AAGAAGGAGCCACACGACAGGGGTAACCTGGGGCTGGAGGGAAGCTGTACTGTCCCACCTAACGTTGCAACTGGGAGACTTCCGGGGGCC
TCACTGCTCCTAGAGCCCTCTTCGCTGACTGCCAATATGAAGGAGGTACCTCTGTTCAGGCTACGTCACTTCCCTTGTGGGAATGTCAAT
TACGGCTACCAGCAACAGGGCTTGCCCTTAGAAGCCGCTACTGCCCCTGGAGCTGGTCATTACGAGGATACCATTCTGAAAAGCAAGAAT

>In-frame_KCNQ5_ENST00000403813_chr6_73332315_+_ALK_ENST00000389048_chr2_29498362_-_3444nt
ATGCCCCGCCACCACGCGGGAGGAGAGGAGGGCGGCGCCGCCGGGCTCTGGGTGAAGAGCGGCGCAGCGGCGGCGGCGGCGGGCGGGGGG
CGCTTGGGCAGCGGCATGAAGGATGTGGAGTCCGGCCGGGGCAGGGTGCTGCTGAACTCGGCAGCCGCCAGGGGCGACGGCCTGCTACTG
CTGGGCACCCGCGCGGCCACGCTCGGTGGCGGCGGCGGTGGCCTGAGGGAGAGCCGCCGGGGCAAGCAGGGGGCCCGGATGAGCCTGCTG
GGGAAGCCGCTCTCTTACACGAGTAGCCAGAGCTGCCGGCGCAACGTCAAGTACCGGCGGGTGCAGAACTACCTGTACAACGTGCTGGAG
AGACCCCGCGGCTGGGCGTTCATCTACCACGCTTTCGTGTTCTGGCTGCAGATGGTCGCATGGTGGGGACAAGGATCCAGAGCCATCGTG
GCTTTTGACAATATCTCCATCAGCCTGGACTGCTACCTCACCATTAGCGGAGAGGACAAGATCCTGCAGAATACAGCACCCAAATCAAGA
AACCTGTTTGAGAGAAACCCAAACAAGGAGCTGAAACCCGGGGAAAATTCACCAAGACAGACCCCCATCTTTGACCCTACAGTTCATTGG
CTGTTCACCACATGTGGGGCCAGCGGGCCCCATGGCCCCACCCAGGCACAGTGCAACAACGCCTACCAGAACTCCAACCTGAGCGTGGAG
GTGGGGAGCGAGGGCCCCCTGAAAGGCATCCAGATCTGGAAGGTGCCAGCCACCGACACCTACAGCATCTCGGGCTACGGAGCTGCTGGC
GGGAAAGGCGGGAAGAACACCATGATGCGGTCCCACGGCGTGTCTGTGCTGGGCATCTTCAACCTGGAGAAGGATGACATGCTGTACATC
CTGGTTGGGCAGCAGGGAGAGGACGCCTGCCCCAGTACAAACCAGTTAATCCAGAAAGTCTGCATTGGAGAGAACAATGTGATAGAAGAA
GAAATCCGTGTGAACAGAAGCGTGCATGAGTGGGCAGGAGGCGGAGGAGGAGGGGGTGGAGCCACCTACGTATTTAAGATGAAGGATGGA
GTGCCGGTGCCCCTGATCATTGCAGCCGGAGGTGGTGGCAGGGCCTACGGGGCCAAGACAGACACGTTCCACCCAGAGAGACTGGAGAAT
AACTCCTCGGTTCTAGGGCTAAACGGCAATTCCGGAGCCGCAGGTGGTGGAGGTGGCTGGAATGATAACACTTCCTTGCTCTGGGCCGGA
AAATCTTTGCAGGAGGGTGCCACCGGAGGACATTCCTGCCCCCAGGCCATGAAGAAGTGGGGGTGGGAGACAAGAGGGGGTTTCGGAGGG
GGTGGAGGGGGGTGCTCCTCAGGTGGAGGAGGCGGAGGATATATAGGCGGCAATGCAGCCTCAAACAATGACCCCGAAATGGATGGGGAA
GATGGGGTTTCCTTCATCAGTCCACTGGGCATCCTGTACACCCCAGCTTTAAAAGTGATGGAAGGCCACGGGGAAGTGAATATTAAGCAT
TATCTAAACTGCAGTCACTGTGAGGTAGACGAATGTCACATGGACCCTGAAAGCCACAAGGTCATCTGCTTCTGTGACCACGGGACGGTG
CTGGCTGAGGATGGCGTCTCCTGCATTGTGTCACCCACCCCGGAGCCACACCTGCCACTCTCGCTGATCCTCTCTGTGGTGACCTCTGCC
CTCGTGGCCGCCCTGGTCCTGGCTTTCTCCGGCATCATGATTGTGTACCGCCGGAAGCACCAGGAGCTGCAAGCCATGCAGATGGAGCTG
CAGAGCCCTGAGTACAAGCTGAGCAAGCTCCGCACCTCGACCATCATGACCGACTACAACCCCAACTACTGCTTTGCTGGCAAGACCTCC
TCCATCAGTGACCTGAAGGAGGTGCCGCGGAAAAACATCACCCTCATTCGGGGTCTGGGCCATGGCGCCTTTGGGGAGGTGTATGAAGGC
CAGGTGTCCGGAATGCCCAACGACCCAAGCCCCCTGCAAGTGGCTGTGAAGACGCTGCCTGAAGTGTGCTCTGAACAGGACGAACTGGAT
TTCCTCATGGAAGCCCTGATCATCAGCAAATTCAACCACCAGAACATTGTTCGCTGCATTGGGGTGAGCCTGCAATCCCTGCCCCGGTTC
ATCCTGCTGGAGCTCATGGCGGGGGGAGACCTCAAGTCCTTCCTCCGAGAGACCCGCCCTCGCCCGAGCCAGCCCTCCTCCCTGGCCATG
CTGGACCTTCTGCACGTGGCTCGGGACATTGCCTGTGGCTGTCAGTATTTGGAGGAAAACCACTTCATCCACCGAGACATTGCTGCCAGA
AACTGCCTCTTGACCTGTCCAGGCCCTGGAAGAGTGGCCAAGATTGGAGACTTCGGGATGGCCCGAGACATCTACAGGGCGAGCTACTAT
AGAAAGGGAGGCTGTGCCATGCTGCCAGTTAAGTGGATGCCCCCAGAGGCCTTCATGGAAGGAATATTCACTTCTAAAACAGACACATGG
TCCTTTGGAGTGCTGCTATGGGAAATCTTTTCTCTTGGATATATGCCATACCCCAGCAAAAGCAACCAGGAAGTTCTGGAGTTTGTCACC
AGTGGAGGCCGGATGGACCCACCCAAGAACTGCCCTGGGCCTGTATACCGGATAATGACTCAGTGCTGGCAACATCAGCCTGAAGACAGG
CCCAACTTTGCCATCATTTTGGAGAGGATTGAATACTGCACCCAGGACCCGGATGTAATCAACACCGCTTTGCCGATAGAATATGGTCCA
CTTGTGGAAGAGGAAGAGAAAGTGCCTGTGAGGCCCAAGGACCCTGAGGGGGTTCCTCCTCTCCTGGTCTCTCAACAGGCAAAACGGGAG
GAGGAGCGCAGCCCAGCTGCCCCACCACCTCTGCCTACCACCTCCTCTGGCAAGGCTGCAAAGAAACCCACAGCTGCAGAGATCTCTGTT
CGAGTCCCTAGAGGGCCGGCCGTGGAAGGGGGACACGTGAATATGGCATTCTCTCAGTCCAACCCTCCTTCGGAGTTGCACAAGGTCCAC
GGATCCAGAAACAAGCCCACCAGCTTGTGGAACCCAACGTACGGCTCCTGGTTTACAGAGAAACCCACCAAAAAGAATAATCCTATAGCA
AAGAAGGAGCCACACGACAGGGGTAACCTGGGGCTGGAGGGAAGCTGTACTGTCCCACCTAACGTTGCAACTGGGAGACTTCCGGGGGCC
TCACTGCTCCTAGAGCCCTCTTCGCTGACTGCCAATATGAAGGAGGTACCTCTGTTCAGGCTACGTCACTTCCCTTGTGGGAATGTCAAT
TACGGCTACCAGCAACAGGGCTTGCCCTTAGAAGCCGCTACTGCCCCTGGAGCTGGTCATTACGAGGATACCATTCTGAAAAGCAAGAAT


* Fusion transcript sequences (Full-length transcript).
>In-frame_KCNQ5_ENST00000342056_chr6_73332315_+_ALK_ENST00000389048_chr2_29498362_-_4292nt
GGCTGGGTGTGCGCGCGTGGGAGCGCGCCTCGGAGCGCCCCGCACTCCCCCACTCTATCCCCGGGGGCAGTTTGGGAAGGAGGGAGTGGT
AGTCGCGGGAATGAGGGAGCAAGAGAAACCCTCTCAAAGTGACGCCCCAAACAGGTCCGGATTTAGAATTCGAAGCTAAAGGCTGTTAGA
AATTGGGACTCCTCGGCCTCCTCTGCAGCCCCTCCTTTCCCGCCCCGAAGCCCGGGCGGTTTGCTGGCTGCCTGCTTCCCCGCCCCCGGC
TCAGAGGTCTCTGGCTGGCGGGCGCCCCGTCGGCCGCCGGCTTCCTCCTTGAAACCCGCCGGCGCACATGAGGCCGCTGCCCCCGCCGCA
GGCGCTGGCGGCCCCCTCGCGGTGCCCGTGGTGATGCCATGCCCCGCCACCACGCGGGAGGAGAGGAGGGCGGCGCCGCCGGGCTCTGGG
TGAAGAGCGGCGCAGCGGCGGCGGCGGCGGGCGGGGGGCGCTTGGGCAGCGGCATGAAGGATGTGGAGTCCGGCCGGGGCAGGGTGCTGC
TGAACTCGGCAGCCGCCAGGGGCGACGGCCTGCTACTGCTGGGCACCCGCGCGGCCACGCTCGGTGGCGGCGGCGGTGGCCTGAGGGAGA
GCCGCCGGGGCAAGCAGGGGGCCCGGATGAGCCTGCTGGGGAAGCCGCTCTCTTACACGAGTAGCCAGAGCTGCCGGCGCAACGTCAAGT
ACCGGCGGGTGCAGAACTACCTGTACAACGTGCTGGAGAGACCCCGCGGCTGGGCGTTCATCTACCACGCTTTCGTGTTCTGGCTGCAGA
TGGTCGCATGGTGGGGACAAGGATCCAGAGCCATCGTGGCTTTTGACAATATCTCCATCAGCCTGGACTGCTACCTCACCATTAGCGGAG
AGGACAAGATCCTGCAGAATACAGCACCCAAATCAAGAAACCTGTTTGAGAGAAACCCAAACAAGGAGCTGAAACCCGGGGAAAATTCAC
CAAGACAGACCCCCATCTTTGACCCTACAGTTCATTGGCTGTTCACCACATGTGGGGCCAGCGGGCCCCATGGCCCCACCCAGGCACAGT
GCAACAACGCCTACCAGAACTCCAACCTGAGCGTGGAGGTGGGGAGCGAGGGCCCCCTGAAAGGCATCCAGATCTGGAAGGTGCCAGCCA
CCGACACCTACAGCATCTCGGGCTACGGAGCTGCTGGCGGGAAAGGCGGGAAGAACACCATGATGCGGTCCCACGGCGTGTCTGTGCTGG
GCATCTTCAACCTGGAGAAGGATGACATGCTGTACATCCTGGTTGGGCAGCAGGGAGAGGACGCCTGCCCCAGTACAAACCAGTTAATCC
AGAAAGTCTGCATTGGAGAGAACAATGTGATAGAAGAAGAAATCCGTGTGAACAGAAGCGTGCATGAGTGGGCAGGAGGCGGAGGAGGAG
GGGGTGGAGCCACCTACGTATTTAAGATGAAGGATGGAGTGCCGGTGCCCCTGATCATTGCAGCCGGAGGTGGTGGCAGGGCCTACGGGG
CCAAGACAGACACGTTCCACCCAGAGAGACTGGAGAATAACTCCTCGGTTCTAGGGCTAAACGGCAATTCCGGAGCCGCAGGTGGTGGAG
GTGGCTGGAATGATAACACTTCCTTGCTCTGGGCCGGAAAATCTTTGCAGGAGGGTGCCACCGGAGGACATTCCTGCCCCCAGGCCATGA
AGAAGTGGGGGTGGGAGACAAGAGGGGGTTTCGGAGGGGGTGGAGGGGGGTGCTCCTCAGGTGGAGGAGGCGGAGGATATATAGGCGGCA
ATGCAGCCTCAAACAATGACCCCGAAATGGATGGGGAAGATGGGGTTTCCTTCATCAGTCCACTGGGCATCCTGTACACCCCAGCTTTAA
AAGTGATGGAAGGCCACGGGGAAGTGAATATTAAGCATTATCTAAACTGCAGTCACTGTGAGGTAGACGAATGTCACATGGACCCTGAAA
GCCACAAGGTCATCTGCTTCTGTGACCACGGGACGGTGCTGGCTGAGGATGGCGTCTCCTGCATTGTGTCACCCACCCCGGAGCCACACC
TGCCACTCTCGCTGATCCTCTCTGTGGTGACCTCTGCCCTCGTGGCCGCCCTGGTCCTGGCTTTCTCCGGCATCATGATTGTGTACCGCC
GGAAGCACCAGGAGCTGCAAGCCATGCAGATGGAGCTGCAGAGCCCTGAGTACAAGCTGAGCAAGCTCCGCACCTCGACCATCATGACCG
ACTACAACCCCAACTACTGCTTTGCTGGCAAGACCTCCTCCATCAGTGACCTGAAGGAGGTGCCGCGGAAAAACATCACCCTCATTCGGG
GTCTGGGCCATGGCGCCTTTGGGGAGGTGTATGAAGGCCAGGTGTCCGGAATGCCCAACGACCCAAGCCCCCTGCAAGTGGCTGTGAAGA
CGCTGCCTGAAGTGTGCTCTGAACAGGACGAACTGGATTTCCTCATGGAAGCCCTGATCATCAGCAAATTCAACCACCAGAACATTGTTC
GCTGCATTGGGGTGAGCCTGCAATCCCTGCCCCGGTTCATCCTGCTGGAGCTCATGGCGGGGGGAGACCTCAAGTCCTTCCTCCGAGAGA
CCCGCCCTCGCCCGAGCCAGCCCTCCTCCCTGGCCATGCTGGACCTTCTGCACGTGGCTCGGGACATTGCCTGTGGCTGTCAGTATTTGG
AGGAAAACCACTTCATCCACCGAGACATTGCTGCCAGAAACTGCCTCTTGACCTGTCCAGGCCCTGGAAGAGTGGCCAAGATTGGAGACT
TCGGGATGGCCCGAGACATCTACAGGGCGAGCTACTATAGAAAGGGAGGCTGTGCCATGCTGCCAGTTAAGTGGATGCCCCCAGAGGCCT
TCATGGAAGGAATATTCACTTCTAAAACAGACACATGGTCCTTTGGAGTGCTGCTATGGGAAATCTTTTCTCTTGGATATATGCCATACC
CCAGCAAAAGCAACCAGGAAGTTCTGGAGTTTGTCACCAGTGGAGGCCGGATGGACCCACCCAAGAACTGCCCTGGGCCTGTATACCGGA
TAATGACTCAGTGCTGGCAACATCAGCCTGAAGACAGGCCCAACTTTGCCATCATTTTGGAGAGGATTGAATACTGCACCCAGGACCCGG
ATGTAATCAACACCGCTTTGCCGATAGAATATGGTCCACTTGTGGAAGAGGAAGAGAAAGTGCCTGTGAGGCCCAAGGACCCTGAGGGGG
TTCCTCCTCTCCTGGTCTCTCAACAGGCAAAACGGGAGGAGGAGCGCAGCCCAGCTGCCCCACCACCTCTGCCTACCACCTCCTCTGGCA
AGGCTGCAAAGAAACCCACAGCTGCAGAGATCTCTGTTCGAGTCCCTAGAGGGCCGGCCGTGGAAGGGGGACACGTGAATATGGCATTCT
CTCAGTCCAACCCTCCTTCGGAGTTGCACAAGGTCCACGGATCCAGAAACAAGCCCACCAGCTTGTGGAACCCAACGTACGGCTCCTGGT
TTACAGAGAAACCCACCAAAAAGAATAATCCTATAGCAAAGAAGGAGCCACACGACAGGGGTAACCTGGGGCTGGAGGGAAGCTGTACTG
TCCCACCTAACGTTGCAACTGGGAGACTTCCGGGGGCCTCACTGCTCCTAGAGCCCTCTTCGCTGACTGCCAATATGAAGGAGGTACCTC
TGTTCAGGCTACGTCACTTCCCTTGTGGGAATGTCAATTACGGCTACCAGCAACAGGGCTTGCCCTTAGAAGCCGCTACTGCCCCTGGAG
CTGGTCATTACGAGGATACCATTCTGAAAAGCAAGAATAGCATGAACCAGCCTGGGCCCTGAGCTCGGTCGCACACTCACTTCTCTTCCT
TGGGATCCCTAAGACCGTGGAGGAGAGAGAGGCAATGGCTCCTTCACAAACCAGAGACCAAATGTCACGTTTTGTTTTGTGCCAACCTAT
TTTGAAGTACCACCAAAAAAGCTGTATTTTGAAAATGCTTTAGAAAGGTTTTGAGCATGGGTTCATCCTATTCTTTCGAAAGAAGAAAAT
ATCATAAAAATGAGTGATAAATACAAGGCCCAGATGTGGTTGCATAAGGTTTTTATGCATGTTTGTTGTATACTTCCTTATGCTTCTTTC
AAATTGTGTGTGCTCTGCTTCAATGTAGTCAGAATTAGCTGCTTCTATGTTTCATAGTTGGGGTCATAGATGTTTCCTTGCCTTGTTGAT

>In-frame_KCNQ5_ENST00000355194_chr6_73332315_+_ALK_ENST00000389048_chr2_29498362_-_4235nt
ACTCTATCCCCGGGGGCAGTTTGGGAAGGAGGGAGTGGTAGTCGCGGGAATGAGGGAGCAAGAGAAACCCTCTCAAAGTGACGCCCCAAA
CAGGTCCGGATTTAGAATTCGAAGCTAAAGGCTGTTAGAAATTGGGACTCCTCGGCCTCCTCTGCAGCCCCTCCTTTCCCGCCCCGAAGC
CCGGGCGGTTTGCTGGCTGCCTGCTTCCCCGCCCCCGGCTCAGAGGTCTCTGGCTGGCGGGCGCCCCGTCGGCCGCCGGCTTCCTCCTTG
AAACCCGCCGGCGCACATGAGGCCGCTGCCCCCGCCGCAGGCGCTGGCGGCCCCCTCGCGGTGCCCGTGGTGATGCCATGCCCCGCCACC
ACGCGGGAGGAGAGGAGGGCGGCGCCGCCGGGCTCTGGGTGAAGAGCGGCGCAGCGGCGGCGGCGGCGGGCGGGGGGCGCTTGGGCAGCG
GCATGAAGGATGTGGAGTCCGGCCGGGGCAGGGTGCTGCTGAACTCGGCAGCCGCCAGGGGCGACGGCCTGCTACTGCTGGGCACCCGCG
CGGCCACGCTCGGTGGCGGCGGCGGTGGCCTGAGGGAGAGCCGCCGGGGCAAGCAGGGGGCCCGGATGAGCCTGCTGGGGAAGCCGCTCT
CTTACACGAGTAGCCAGAGCTGCCGGCGCAACGTCAAGTACCGGCGGGTGCAGAACTACCTGTACAACGTGCTGGAGAGACCCCGCGGCT
GGGCGTTCATCTACCACGCGTTCTGGCTGCAGATGGTCGCATGGTGGGGACAAGGATCCAGAGCCATCGTGGCTTTTGACAATATCTCCA
TCAGCCTGGACTGCTACCTCACCATTAGCGGAGAGGACAAGATCCTGCAGAATACAGCACCCAAATCAAGAAACCTGTTTGAGAGAAACC
CAAACAAGGAGCTGAAACCCGGGGAAAATTCACCAAGACAGACCCCCATCTTTGACCCTACAGTTCATTGGCTGTTCACCACATGTGGGG
CCAGCGGGCCCCATGGCCCCACCCAGGCACAGTGCAACAACGCCTACCAGAACTCCAACCTGAGCGTGGAGGTGGGGAGCGAGGGCCCCC
TGAAAGGCATCCAGATCTGGAAGGTGCCAGCCACCGACACCTACAGCATCTCGGGCTACGGAGCTGCTGGCGGGAAAGGCGGGAAGAACA
CCATGATGCGGTCCCACGGCGTGTCTGTGCTGGGCATCTTCAACCTGGAGAAGGATGACATGCTGTACATCCTGGTTGGGCAGCAGGGAG
AGGACGCCTGCCCCAGTACAAACCAGTTAATCCAGAAAGTCTGCATTGGAGAGAACAATGTGATAGAAGAAGAAATCCGTGTGAACAGAA
GCGTGCATGAGTGGGCAGGAGGCGGAGGAGGAGGGGGTGGAGCCACCTACGTATTTAAGATGAAGGATGGAGTGCCGGTGCCCCTGATCA
TTGCAGCCGGAGGTGGTGGCAGGGCCTACGGGGCCAAGACAGACACGTTCCACCCAGAGAGACTGGAGAATAACTCCTCGGTTCTAGGGC
TAAACGGCAATTCCGGAGCCGCAGGTGGTGGAGGTGGCTGGAATGATAACACTTCCTTGCTCTGGGCCGGAAAATCTTTGCAGGAGGGTG
CCACCGGAGGACATTCCTGCCCCCAGGCCATGAAGAAGTGGGGGTGGGAGACAAGAGGGGGTTTCGGAGGGGGTGGAGGGGGGTGCTCCT
CAGGTGGAGGAGGCGGAGGATATATAGGCGGCAATGCAGCCTCAAACAATGACCCCGAAATGGATGGGGAAGATGGGGTTTCCTTCATCA
GTCCACTGGGCATCCTGTACACCCCAGCTTTAAAAGTGATGGAAGGCCACGGGGAAGTGAATATTAAGCATTATCTAAACTGCAGTCACT
GTGAGGTAGACGAATGTCACATGGACCCTGAAAGCCACAAGGTCATCTGCTTCTGTGACCACGGGACGGTGCTGGCTGAGGATGGCGTCT
CCTGCATTGTGTCACCCACCCCGGAGCCACACCTGCCACTCTCGCTGATCCTCTCTGTGGTGACCTCTGCCCTCGTGGCCGCCCTGGTCC
TGGCTTTCTCCGGCATCATGATTGTGTACCGCCGGAAGCACCAGGAGCTGCAAGCCATGCAGATGGAGCTGCAGAGCCCTGAGTACAAGC
TGAGCAAGCTCCGCACCTCGACCATCATGACCGACTACAACCCCAACTACTGCTTTGCTGGCAAGACCTCCTCCATCAGTGACCTGAAGG
AGGTGCCGCGGAAAAACATCACCCTCATTCGGGGTCTGGGCCATGGCGCCTTTGGGGAGGTGTATGAAGGCCAGGTGTCCGGAATGCCCA
ACGACCCAAGCCCCCTGCAAGTGGCTGTGAAGACGCTGCCTGAAGTGTGCTCTGAACAGGACGAACTGGATTTCCTCATGGAAGCCCTGA
TCATCAGCAAATTCAACCACCAGAACATTGTTCGCTGCATTGGGGTGAGCCTGCAATCCCTGCCCCGGTTCATCCTGCTGGAGCTCATGG
CGGGGGGAGACCTCAAGTCCTTCCTCCGAGAGACCCGCCCTCGCCCGAGCCAGCCCTCCTCCCTGGCCATGCTGGACCTTCTGCACGTGG
CTCGGGACATTGCCTGTGGCTGTCAGTATTTGGAGGAAAACCACTTCATCCACCGAGACATTGCTGCCAGAAACTGCCTCTTGACCTGTC
CAGGCCCTGGAAGAGTGGCCAAGATTGGAGACTTCGGGATGGCCCGAGACATCTACAGGGCGAGCTACTATAGAAAGGGAGGCTGTGCCA
TGCTGCCAGTTAAGTGGATGCCCCCAGAGGCCTTCATGGAAGGAATATTCACTTCTAAAACAGACACATGGTCCTTTGGAGTGCTGCTAT
GGGAAATCTTTTCTCTTGGATATATGCCATACCCCAGCAAAAGCAACCAGGAAGTTCTGGAGTTTGTCACCAGTGGAGGCCGGATGGACC
CACCCAAGAACTGCCCTGGGCCTGTATACCGGATAATGACTCAGTGCTGGCAACATCAGCCTGAAGACAGGCCCAACTTTGCCATCATTT
TGGAGAGGATTGAATACTGCACCCAGGACCCGGATGTAATCAACACCGCTTTGCCGATAGAATATGGTCCACTTGTGGAAGAGGAAGAGA
AAGTGCCTGTGAGGCCCAAGGACCCTGAGGGGGTTCCTCCTCTCCTGGTCTCTCAACAGGCAAAACGGGAGGAGGAGCGCAGCCCAGCTG
CCCCACCACCTCTGCCTACCACCTCCTCTGGCAAGGCTGCAAAGAAACCCACAGCTGCAGAGATCTCTGTTCGAGTCCCTAGAGGGCCGG
CCGTGGAAGGGGGACACGTGAATATGGCATTCTCTCAGTCCAACCCTCCTTCGGAGTTGCACAAGGTCCACGGATCCAGAAACAAGCCCA
CCAGCTTGTGGAACCCAACGTACGGCTCCTGGTTTACAGAGAAACCCACCAAAAAGAATAATCCTATAGCAAAGAAGGAGCCACACGACA
GGGGTAACCTGGGGCTGGAGGGAAGCTGTACTGTCCCACCTAACGTTGCAACTGGGAGACTTCCGGGGGCCTCACTGCTCCTAGAGCCCT
CTTCGCTGACTGCCAATATGAAGGAGGTACCTCTGTTCAGGCTACGTCACTTCCCTTGTGGGAATGTCAATTACGGCTACCAGCAACAGG
GCTTGCCCTTAGAAGCCGCTACTGCCCCTGGAGCTGGTCATTACGAGGATACCATTCTGAAAAGCAAGAATAGCATGAACCAGCCTGGGC
CCTGAGCTCGGTCGCACACTCACTTCTCTTCCTTGGGATCCCTAAGACCGTGGAGGAGAGAGAGGCAATGGCTCCTTCACAAACCAGAGA
CCAAATGTCACGTTTTGTTTTGTGCCAACCTATTTTGAAGTACCACCAAAAAAGCTGTATTTTGAAAATGCTTTAGAAAGGTTTTGAGCA
TGGGTTCATCCTATTCTTTCGAAAGAAGAAAATATCATAAAAATGAGTGATAAATACAAGGCCCAGATGTGGTTGCATAAGGTTTTTATG
CATGTTTGTTGTATACTTCCTTATGCTTCTTTCAAATTGTGTGTGCTCTGCTTCAATGTAGTCAGAATTAGCTGCTTCTATGTTTCATAG
TTGGGGTCATAGATGTTTCCTTGCCTTGTTGATGTGGACATGAGCCATTTGAGGGGAGAGGGAACGGAAATAAAGGAGTTATTTGTAATG

>In-frame_KCNQ5_ENST00000370398_chr6_73332315_+_ALK_ENST00000389048_chr2_29498362_-_4003nt
GGGCGCCCCGTCGGCCGCCGGCTTCCTCCTTGAAACCCGCCGGCGCACATGAGGCCGCTGCCCCCGCCGCAGGCGCTGGCGGCCCCCTCG
CGGTGCCCGTGGTGATGCCATGCCCCGCCACCACGCGGGAGGAGAGGAGGGCGGCGCCGCCGGGCTCTGGGTGAAGAGCGGCGCAGCGGC
GGCGGCGGCGGGCGGGGGGCGCTTGGGCAGCGGCATGAAGGATGTGGAGTCCGGCCGGGGCAGGGTGCTGCTGAACTCGGCAGCCGCCAG
GGGCGACGGCCTGCTACTGCTGGGCACCCGCGCGGCCACGCTCGGTGGCGGCGGCGGTGGCCTGAGGGAGAGCCGCCGGGGCAAGCAGGG
GGCCCGGATGAGCCTGCTGGGGAAGCCGCTCTCTTACACGAGTAGCCAGAGCTGCCGGCGCAACGTCAAGTACCGGCGGGTGCAGAACTA
CCTGTACAACGTGCTGGAGAGACCCCGCGGCTGGGCGTTCATCTACCACGCTTTCGTGTTCTGGCTGCAGATGGTCGCATGGTGGGGACA
AGGATCCAGAGCCATCGTGGCTTTTGACAATATCTCCATCAGCCTGGACTGCTACCTCACCATTAGCGGAGAGGACAAGATCCTGCAGAA
TACAGCACCCAAATCAAGAAACCTGTTTGAGAGAAACCCAAACAAGGAGCTGAAACCCGGGGAAAATTCACCAAGACAGACCCCCATCTT
TGACCCTACAGTTCATTGGCTGTTCACCACATGTGGGGCCAGCGGGCCCCATGGCCCCACCCAGGCACAGTGCAACAACGCCTACCAGAA
CTCCAACCTGAGCGTGGAGGTGGGGAGCGAGGGCCCCCTGAAAGGCATCCAGATCTGGAAGGTGCCAGCCACCGACACCTACAGCATCTC
GGGCTACGGAGCTGCTGGCGGGAAAGGCGGGAAGAACACCATGATGCGGTCCCACGGCGTGTCTGTGCTGGGCATCTTCAACCTGGAGAA
GGATGACATGCTGTACATCCTGGTTGGGCAGCAGGGAGAGGACGCCTGCCCCAGTACAAACCAGTTAATCCAGAAAGTCTGCATTGGAGA
GAACAATGTGATAGAAGAAGAAATCCGTGTGAACAGAAGCGTGCATGAGTGGGCAGGAGGCGGAGGAGGAGGGGGTGGAGCCACCTACGT
ATTTAAGATGAAGGATGGAGTGCCGGTGCCCCTGATCATTGCAGCCGGAGGTGGTGGCAGGGCCTACGGGGCCAAGACAGACACGTTCCA
CCCAGAGAGACTGGAGAATAACTCCTCGGTTCTAGGGCTAAACGGCAATTCCGGAGCCGCAGGTGGTGGAGGTGGCTGGAATGATAACAC
TTCCTTGCTCTGGGCCGGAAAATCTTTGCAGGAGGGTGCCACCGGAGGACATTCCTGCCCCCAGGCCATGAAGAAGTGGGGGTGGGAGAC
AAGAGGGGGTTTCGGAGGGGGTGGAGGGGGGTGCTCCTCAGGTGGAGGAGGCGGAGGATATATAGGCGGCAATGCAGCCTCAAACAATGA
CCCCGAAATGGATGGGGAAGATGGGGTTTCCTTCATCAGTCCACTGGGCATCCTGTACACCCCAGCTTTAAAAGTGATGGAAGGCCACGG
GGAAGTGAATATTAAGCATTATCTAAACTGCAGTCACTGTGAGGTAGACGAATGTCACATGGACCCTGAAAGCCACAAGGTCATCTGCTT
CTGTGACCACGGGACGGTGCTGGCTGAGGATGGCGTCTCCTGCATTGTGTCACCCACCCCGGAGCCACACCTGCCACTCTCGCTGATCCT
CTCTGTGGTGACCTCTGCCCTCGTGGCCGCCCTGGTCCTGGCTTTCTCCGGCATCATGATTGTGTACCGCCGGAAGCACCAGGAGCTGCA
AGCCATGCAGATGGAGCTGCAGAGCCCTGAGTACAAGCTGAGCAAGCTCCGCACCTCGACCATCATGACCGACTACAACCCCAACTACTG
CTTTGCTGGCAAGACCTCCTCCATCAGTGACCTGAAGGAGGTGCCGCGGAAAAACATCACCCTCATTCGGGGTCTGGGCCATGGCGCCTT
TGGGGAGGTGTATGAAGGCCAGGTGTCCGGAATGCCCAACGACCCAAGCCCCCTGCAAGTGGCTGTGAAGACGCTGCCTGAAGTGTGCTC
TGAACAGGACGAACTGGATTTCCTCATGGAAGCCCTGATCATCAGCAAATTCAACCACCAGAACATTGTTCGCTGCATTGGGGTGAGCCT
GCAATCCCTGCCCCGGTTCATCCTGCTGGAGCTCATGGCGGGGGGAGACCTCAAGTCCTTCCTCCGAGAGACCCGCCCTCGCCCGAGCCA
GCCCTCCTCCCTGGCCATGCTGGACCTTCTGCACGTGGCTCGGGACATTGCCTGTGGCTGTCAGTATTTGGAGGAAAACCACTTCATCCA
CCGAGACATTGCTGCCAGAAACTGCCTCTTGACCTGTCCAGGCCCTGGAAGAGTGGCCAAGATTGGAGACTTCGGGATGGCCCGAGACAT
CTACAGGGCGAGCTACTATAGAAAGGGAGGCTGTGCCATGCTGCCAGTTAAGTGGATGCCCCCAGAGGCCTTCATGGAAGGAATATTCAC
TTCTAAAACAGACACATGGTCCTTTGGAGTGCTGCTATGGGAAATCTTTTCTCTTGGATATATGCCATACCCCAGCAAAAGCAACCAGGA
AGTTCTGGAGTTTGTCACCAGTGGAGGCCGGATGGACCCACCCAAGAACTGCCCTGGGCCTGTATACCGGATAATGACTCAGTGCTGGCA
ACATCAGCCTGAAGACAGGCCCAACTTTGCCATCATTTTGGAGAGGATTGAATACTGCACCCAGGACCCGGATGTAATCAACACCGCTTT
GCCGATAGAATATGGTCCACTTGTGGAAGAGGAAGAGAAAGTGCCTGTGAGGCCCAAGGACCCTGAGGGGGTTCCTCCTCTCCTGGTCTC
TCAACAGGCAAAACGGGAGGAGGAGCGCAGCCCAGCTGCCCCACCACCTCTGCCTACCACCTCCTCTGGCAAGGCTGCAAAGAAACCCAC
AGCTGCAGAGATCTCTGTTCGAGTCCCTAGAGGGCCGGCCGTGGAAGGGGGACACGTGAATATGGCATTCTCTCAGTCCAACCCTCCTTC
GGAGTTGCACAAGGTCCACGGATCCAGAAACAAGCCCACCAGCTTGTGGAACCCAACGTACGGCTCCTGGTTTACAGAGAAACCCACCAA
AAAGAATAATCCTATAGCAAAGAAGGAGCCACACGACAGGGGTAACCTGGGGCTGGAGGGAAGCTGTACTGTCCCACCTAACGTTGCAAC
TGGGAGACTTCCGGGGGCCTCACTGCTCCTAGAGCCCTCTTCGCTGACTGCCAATATGAAGGAGGTACCTCTGTTCAGGCTACGTCACTT
CCCTTGTGGGAATGTCAATTACGGCTACCAGCAACAGGGCTTGCCCTTAGAAGCCGCTACTGCCCCTGGAGCTGGTCATTACGAGGATAC
CATTCTGAAAAGCAAGAATAGCATGAACCAGCCTGGGCCCTGAGCTCGGTCGCACACTCACTTCTCTTCCTTGGGATCCCTAAGACCGTG
GAGGAGAGAGAGGCAATGGCTCCTTCACAAACCAGAGACCAAATGTCACGTTTTGTTTTGTGCCAACCTATTTTGAAGTACCACCAAAAA
AGCTGTATTTTGAAAATGCTTTAGAAAGGTTTTGAGCATGGGTTCATCCTATTCTTTCGAAAGAAGAAAATATCATAAAAATGAGTGATA
AATACAAGGCCCAGATGTGGTTGCATAAGGTTTTTATGCATGTTTGTTGTATACTTCCTTATGCTTCTTTCAAATTGTGTGTGCTCTGCT
TCAATGTAGTCAGAATTAGCTGCTTCTATGTTTCATAGTTGGGGTCATAGATGTTTCCTTGCCTTGTTGATGTGGACATGAGCCATTTGA

>In-frame_KCNQ5_ENST00000370392_chr6_73332315_+_ALK_ENST00000389048_chr2_29498362_-_3978nt
CTCCTTGAAACCCGCCGGCGCACATGAGGCCGCTGCCCCCGCCGCAGGCGCTGGCGGCCCCCTCGCGGTGCCCGTGGTGATGCCATGCCC
CGCCACCACGCGGGAGGAGAGGAGGGCGGCGCCGCCGGGCTCTGGGTGAAGAGCGGCGCAGCGGCGGCGGCGGCGGGCGGGGGGCGCTTG
GGCAGCGGCATGAAGGATGTGGAGTCCGGCCGGGGCAGGGTGCTGCTGAACTCGGCAGCCGCCAGGGGCGACGGCCTGCTACTGCTGGGC
ACCCGCGCGGCCACGCTCGGTGGCGGCGGCGGTGGCCTGAGGGAGAGCCGCCGGGGCAAGCAGGGGGCCCGGATGAGCCTGCTGGGGAAG
CCGCTCTCTTACACGAGTAGCCAGAGCTGCCGGCGCAACGTCAAGTACCGGCGGGTGCAGAACTACCTGTACAACGTGCTGGAGAGACCC
CGCGGCTGGGCGTTCATCTACCACGCTTTCGTGTTCTGGCTGCAGATGGTCGCATGGTGGGGACAAGGATCCAGAGCCATCGTGGCTTTT
GACAATATCTCCATCAGCCTGGACTGCTACCTCACCATTAGCGGAGAGGACAAGATCCTGCAGAATACAGCACCCAAATCAAGAAACCTG
TTTGAGAGAAACCCAAACAAGGAGCTGAAACCCGGGGAAAATTCACCAAGACAGACCCCCATCTTTGACCCTACAGTTCATTGGCTGTTC
ACCACATGTGGGGCCAGCGGGCCCCATGGCCCCACCCAGGCACAGTGCAACAACGCCTACCAGAACTCCAACCTGAGCGTGGAGGTGGGG
AGCGAGGGCCCCCTGAAAGGCATCCAGATCTGGAAGGTGCCAGCCACCGACACCTACAGCATCTCGGGCTACGGAGCTGCTGGCGGGAAA
GGCGGGAAGAACACCATGATGCGGTCCCACGGCGTGTCTGTGCTGGGCATCTTCAACCTGGAGAAGGATGACATGCTGTACATCCTGGTT
GGGCAGCAGGGAGAGGACGCCTGCCCCAGTACAAACCAGTTAATCCAGAAAGTCTGCATTGGAGAGAACAATGTGATAGAAGAAGAAATC
CGTGTGAACAGAAGCGTGCATGAGTGGGCAGGAGGCGGAGGAGGAGGGGGTGGAGCCACCTACGTATTTAAGATGAAGGATGGAGTGCCG
GTGCCCCTGATCATTGCAGCCGGAGGTGGTGGCAGGGCCTACGGGGCCAAGACAGACACGTTCCACCCAGAGAGACTGGAGAATAACTCC
TCGGTTCTAGGGCTAAACGGCAATTCCGGAGCCGCAGGTGGTGGAGGTGGCTGGAATGATAACACTTCCTTGCTCTGGGCCGGAAAATCT
TTGCAGGAGGGTGCCACCGGAGGACATTCCTGCCCCCAGGCCATGAAGAAGTGGGGGTGGGAGACAAGAGGGGGTTTCGGAGGGGGTGGA
GGGGGGTGCTCCTCAGGTGGAGGAGGCGGAGGATATATAGGCGGCAATGCAGCCTCAAACAATGACCCCGAAATGGATGGGGAAGATGGG
GTTTCCTTCATCAGTCCACTGGGCATCCTGTACACCCCAGCTTTAAAAGTGATGGAAGGCCACGGGGAAGTGAATATTAAGCATTATCTA
AACTGCAGTCACTGTGAGGTAGACGAATGTCACATGGACCCTGAAAGCCACAAGGTCATCTGCTTCTGTGACCACGGGACGGTGCTGGCT
GAGGATGGCGTCTCCTGCATTGTGTCACCCACCCCGGAGCCACACCTGCCACTCTCGCTGATCCTCTCTGTGGTGACCTCTGCCCTCGTG
GCCGCCCTGGTCCTGGCTTTCTCCGGCATCATGATTGTGTACCGCCGGAAGCACCAGGAGCTGCAAGCCATGCAGATGGAGCTGCAGAGC
CCTGAGTACAAGCTGAGCAAGCTCCGCACCTCGACCATCATGACCGACTACAACCCCAACTACTGCTTTGCTGGCAAGACCTCCTCCATC
AGTGACCTGAAGGAGGTGCCGCGGAAAAACATCACCCTCATTCGGGGTCTGGGCCATGGCGCCTTTGGGGAGGTGTATGAAGGCCAGGTG
TCCGGAATGCCCAACGACCCAAGCCCCCTGCAAGTGGCTGTGAAGACGCTGCCTGAAGTGTGCTCTGAACAGGACGAACTGGATTTCCTC
ATGGAAGCCCTGATCATCAGCAAATTCAACCACCAGAACATTGTTCGCTGCATTGGGGTGAGCCTGCAATCCCTGCCCCGGTTCATCCTG
CTGGAGCTCATGGCGGGGGGAGACCTCAAGTCCTTCCTCCGAGAGACCCGCCCTCGCCCGAGCCAGCCCTCCTCCCTGGCCATGCTGGAC
CTTCTGCACGTGGCTCGGGACATTGCCTGTGGCTGTCAGTATTTGGAGGAAAACCACTTCATCCACCGAGACATTGCTGCCAGAAACTGC
CTCTTGACCTGTCCAGGCCCTGGAAGAGTGGCCAAGATTGGAGACTTCGGGATGGCCCGAGACATCTACAGGGCGAGCTACTATAGAAAG
GGAGGCTGTGCCATGCTGCCAGTTAAGTGGATGCCCCCAGAGGCCTTCATGGAAGGAATATTCACTTCTAAAACAGACACATGGTCCTTT
GGAGTGCTGCTATGGGAAATCTTTTCTCTTGGATATATGCCATACCCCAGCAAAAGCAACCAGGAAGTTCTGGAGTTTGTCACCAGTGGA
GGCCGGATGGACCCACCCAAGAACTGCCCTGGGCCTGTATACCGGATAATGACTCAGTGCTGGCAACATCAGCCTGAAGACAGGCCCAAC
TTTGCCATCATTTTGGAGAGGATTGAATACTGCACCCAGGACCCGGATGTAATCAACACCGCTTTGCCGATAGAATATGGTCCACTTGTG
GAAGAGGAAGAGAAAGTGCCTGTGAGGCCCAAGGACCCTGAGGGGGTTCCTCCTCTCCTGGTCTCTCAACAGGCAAAACGGGAGGAGGAG
CGCAGCCCAGCTGCCCCACCACCTCTGCCTACCACCTCCTCTGGCAAGGCTGCAAAGAAACCCACAGCTGCAGAGATCTCTGTTCGAGTC
CCTAGAGGGCCGGCCGTGGAAGGGGGACACGTGAATATGGCATTCTCTCAGTCCAACCCTCCTTCGGAGTTGCACAAGGTCCACGGATCC
AGAAACAAGCCCACCAGCTTGTGGAACCCAACGTACGGCTCCTGGTTTACAGAGAAACCCACCAAAAAGAATAATCCTATAGCAAAGAAG
GAGCCACACGACAGGGGTAACCTGGGGCTGGAGGGAAGCTGTACTGTCCCACCTAACGTTGCAACTGGGAGACTTCCGGGGGCCTCACTG
CTCCTAGAGCCCTCTTCGCTGACTGCCAATATGAAGGAGGTACCTCTGTTCAGGCTACGTCACTTCCCTTGTGGGAATGTCAATTACGGC
TACCAGCAACAGGGCTTGCCCTTAGAAGCCGCTACTGCCCCTGGAGCTGGTCATTACGAGGATACCATTCTGAAAAGCAAGAATAGCATG
AACCAGCCTGGGCCCTGAGCTCGGTCGCACACTCACTTCTCTTCCTTGGGATCCCTAAGACCGTGGAGGAGAGAGAGGCAATGGCTCCTT
CACAAACCAGAGACCAAATGTCACGTTTTGTTTTGTGCCAACCTATTTTGAAGTACCACCAAAAAAGCTGTATTTTGAAAATGCTTTAGA
AAGGTTTTGAGCATGGGTTCATCCTATTCTTTCGAAAGAAGAAAATATCATAAAAATGAGTGATAAATACAAGGCCCAGATGTGGTTGCA
TAAGGTTTTTATGCATGTTTGTTGTATACTTCCTTATGCTTCTTTCAAATTGTGTGTGCTCTGCTTCAATGTAGTCAGAATTAGCTGCTT
CTATGTTTCATAGTTGGGGTCATAGATGTTTCCTTGCCTTGTTGATGTGGACATGAGCCATTTGAGGGGAGAGGGAACGGAAATAAAGGA

>In-frame_KCNQ5_ENST00000355635_chr6_73332315_+_ALK_ENST00000389048_chr2_29498362_-_3894nt
ATGCCCCGCCACCACGCGGGAGGAGAGGAGGGCGGCGCCGCCGGGCTCTGGGTGAAGAGCGGCGCAGCGGCGGCGGCGGCGGGCGGGGGG
CGCTTGGGCAGCGGCATGAAGGATGTGGAGTCCGGCCGGGGCAGGGTGCTGCTGAACTCGGCAGCCGCCAGGGGCGACGGCCTGCTACTG
CTGGGCACCCGCGCGGCCACGCTCGGTGGCGGCGGCGGTGGCCTGAGGGAGAGCCGCCGGGGCAAGCAGGGGGCCCGGATGAGCCTGCTG
GGGAAGCCGCTCTCTTACACGAGTAGCCAGAGCTGCCGGCGCAACGTCAAGTACCGGCGGGTGCAGAACTACCTGTACAACGTGCTGGAG
AGACCCCGCGGCTGGGCGTTCATCTACCACGCTTTCGTGTTCTGGCTGCAGATGGTCGCATGGTGGGGACAAGGATCCAGAGCCATCGTG
GCTTTTGACAATATCTCCATCAGCCTGGACTGCTACCTCACCATTAGCGGAGAGGACAAGATCCTGCAGAATACAGCACCCAAATCAAGA
AACCTGTTTGAGAGAAACCCAAACAAGGAGCTGAAACCCGGGGAAAATTCACCAAGACAGACCCCCATCTTTGACCCTACAGTTCATTGG
CTGTTCACCACATGTGGGGCCAGCGGGCCCCATGGCCCCACCCAGGCACAGTGCAACAACGCCTACCAGAACTCCAACCTGAGCGTGGAG
GTGGGGAGCGAGGGCCCCCTGAAAGGCATCCAGATCTGGAAGGTGCCAGCCACCGACACCTACAGCATCTCGGGCTACGGAGCTGCTGGC
GGGAAAGGCGGGAAGAACACCATGATGCGGTCCCACGGCGTGTCTGTGCTGGGCATCTTCAACCTGGAGAAGGATGACATGCTGTACATC
CTGGTTGGGCAGCAGGGAGAGGACGCCTGCCCCAGTACAAACCAGTTAATCCAGAAAGTCTGCATTGGAGAGAACAATGTGATAGAAGAA
GAAATCCGTGTGAACAGAAGCGTGCATGAGTGGGCAGGAGGCGGAGGAGGAGGGGGTGGAGCCACCTACGTATTTAAGATGAAGGATGGA
GTGCCGGTGCCCCTGATCATTGCAGCCGGAGGTGGTGGCAGGGCCTACGGGGCCAAGACAGACACGTTCCACCCAGAGAGACTGGAGAAT
AACTCCTCGGTTCTAGGGCTAAACGGCAATTCCGGAGCCGCAGGTGGTGGAGGTGGCTGGAATGATAACACTTCCTTGCTCTGGGCCGGA
AAATCTTTGCAGGAGGGTGCCACCGGAGGACATTCCTGCCCCCAGGCCATGAAGAAGTGGGGGTGGGAGACAAGAGGGGGTTTCGGAGGG
GGTGGAGGGGGGTGCTCCTCAGGTGGAGGAGGCGGAGGATATATAGGCGGCAATGCAGCCTCAAACAATGACCCCGAAATGGATGGGGAA
GATGGGGTTTCCTTCATCAGTCCACTGGGCATCCTGTACACCCCAGCTTTAAAAGTGATGGAAGGCCACGGGGAAGTGAATATTAAGCAT
TATCTAAACTGCAGTCACTGTGAGGTAGACGAATGTCACATGGACCCTGAAAGCCACAAGGTCATCTGCTTCTGTGACCACGGGACGGTG
CTGGCTGAGGATGGCGTCTCCTGCATTGTGTCACCCACCCCGGAGCCACACCTGCCACTCTCGCTGATCCTCTCTGTGGTGACCTCTGCC
CTCGTGGCCGCCCTGGTCCTGGCTTTCTCCGGCATCATGATTGTGTACCGCCGGAAGCACCAGGAGCTGCAAGCCATGCAGATGGAGCTG
CAGAGCCCTGAGTACAAGCTGAGCAAGCTCCGCACCTCGACCATCATGACCGACTACAACCCCAACTACTGCTTTGCTGGCAAGACCTCC
TCCATCAGTGACCTGAAGGAGGTGCCGCGGAAAAACATCACCCTCATTCGGGGTCTGGGCCATGGCGCCTTTGGGGAGGTGTATGAAGGC
CAGGTGTCCGGAATGCCCAACGACCCAAGCCCCCTGCAAGTGGCTGTGAAGACGCTGCCTGAAGTGTGCTCTGAACAGGACGAACTGGAT
TTCCTCATGGAAGCCCTGATCATCAGCAAATTCAACCACCAGAACATTGTTCGCTGCATTGGGGTGAGCCTGCAATCCCTGCCCCGGTTC
ATCCTGCTGGAGCTCATGGCGGGGGGAGACCTCAAGTCCTTCCTCCGAGAGACCCGCCCTCGCCCGAGCCAGCCCTCCTCCCTGGCCATG
CTGGACCTTCTGCACGTGGCTCGGGACATTGCCTGTGGCTGTCAGTATTTGGAGGAAAACCACTTCATCCACCGAGACATTGCTGCCAGA
AACTGCCTCTTGACCTGTCCAGGCCCTGGAAGAGTGGCCAAGATTGGAGACTTCGGGATGGCCCGAGACATCTACAGGGCGAGCTACTAT
AGAAAGGGAGGCTGTGCCATGCTGCCAGTTAAGTGGATGCCCCCAGAGGCCTTCATGGAAGGAATATTCACTTCTAAAACAGACACATGG
TCCTTTGGAGTGCTGCTATGGGAAATCTTTTCTCTTGGATATATGCCATACCCCAGCAAAAGCAACCAGGAAGTTCTGGAGTTTGTCACC
AGTGGAGGCCGGATGGACCCACCCAAGAACTGCCCTGGGCCTGTATACCGGATAATGACTCAGTGCTGGCAACATCAGCCTGAAGACAGG
CCCAACTTTGCCATCATTTTGGAGAGGATTGAATACTGCACCCAGGACCCGGATGTAATCAACACCGCTTTGCCGATAGAATATGGTCCA
CTTGTGGAAGAGGAAGAGAAAGTGCCTGTGAGGCCCAAGGACCCTGAGGGGGTTCCTCCTCTCCTGGTCTCTCAACAGGCAAAACGGGAG
GAGGAGCGCAGCCCAGCTGCCCCACCACCTCTGCCTACCACCTCCTCTGGCAAGGCTGCAAAGAAACCCACAGCTGCAGAGATCTCTGTT
CGAGTCCCTAGAGGGCCGGCCGTGGAAGGGGGACACGTGAATATGGCATTCTCTCAGTCCAACCCTCCTTCGGAGTTGCACAAGGTCCAC
GGATCCAGAAACAAGCCCACCAGCTTGTGGAACCCAACGTACGGCTCCTGGTTTACAGAGAAACCCACCAAAAAGAATAATCCTATAGCA
AAGAAGGAGCCACACGACAGGGGTAACCTGGGGCTGGAGGGAAGCTGTACTGTCCCACCTAACGTTGCAACTGGGAGACTTCCGGGGGCC
TCACTGCTCCTAGAGCCCTCTTCGCTGACTGCCAATATGAAGGAGGTACCTCTGTTCAGGCTACGTCACTTCCCTTGTGGGAATGTCAAT
TACGGCTACCAGCAACAGGGCTTGCCCTTAGAAGCCGCTACTGCCCCTGGAGCTGGTCATTACGAGGATACCATTCTGAAAAGCAAGAAT
AGCATGAACCAGCCTGGGCCCTGAGCTCGGTCGCACACTCACTTCTCTTCCTTGGGATCCCTAAGACCGTGGAGGAGAGAGAGGCAATGG
CTCCTTCACAAACCAGAGACCAAATGTCACGTTTTGTTTTGTGCCAACCTATTTTGAAGTACCACCAAAAAAGCTGTATTTTGAAAATGC
TTTAGAAAGGTTTTGAGCATGGGTTCATCCTATTCTTTCGAAAGAAGAAAATATCATAAAAATGAGTGATAAATACAAGGCCCAGATGTG
GTTGCATAAGGTTTTTATGCATGTTTGTTGTATACTTCCTTATGCTTCTTTCAAATTGTGTGTGCTCTGCTTCAATGTAGTCAGAATTAG
CTGCTTCTATGTTTCATAGTTGGGGTCATAGATGTTTCCTTGCCTTGTTGATGTGGACATGAGCCATTTGAGGGGAGAGGGAACGGAAAT

>In-frame_KCNQ5_ENST00000414165_chr6_73332315_+_ALK_ENST00000389048_chr2_29498362_-_3894nt
ATGCCCCGCCACCACGCGGGAGGAGAGGAGGGCGGCGCCGCCGGGCTCTGGGTGAAGAGCGGCGCAGCGGCGGCGGCGGCGGGCGGGGGG
CGCTTGGGCAGCGGCATGAAGGATGTGGAGTCCGGCCGGGGCAGGGTGCTGCTGAACTCGGCAGCCGCCAGGGGCGACGGCCTGCTACTG
CTGGGCACCCGCGCGGCCACGCTCGGTGGCGGCGGCGGTGGCCTGAGGGAGAGCCGCCGGGGCAAGCAGGGGGCCCGGATGAGCCTGCTG
GGGAAGCCGCTCTCTTACACGAGTAGCCAGAGCTGCCGGCGCAACGTCAAGTACCGGCGGGTGCAGAACTACCTGTACAACGTGCTGGAG
AGACCCCGCGGCTGGGCGTTCATCTACCACGCTTTCGTGTTCTGGCTGCAGATGGTCGCATGGTGGGGACAAGGATCCAGAGCCATCGTG
GCTTTTGACAATATCTCCATCAGCCTGGACTGCTACCTCACCATTAGCGGAGAGGACAAGATCCTGCAGAATACAGCACCCAAATCAAGA
AACCTGTTTGAGAGAAACCCAAACAAGGAGCTGAAACCCGGGGAAAATTCACCAAGACAGACCCCCATCTTTGACCCTACAGTTCATTGG
CTGTTCACCACATGTGGGGCCAGCGGGCCCCATGGCCCCACCCAGGCACAGTGCAACAACGCCTACCAGAACTCCAACCTGAGCGTGGAG
GTGGGGAGCGAGGGCCCCCTGAAAGGCATCCAGATCTGGAAGGTGCCAGCCACCGACACCTACAGCATCTCGGGCTACGGAGCTGCTGGC
GGGAAAGGCGGGAAGAACACCATGATGCGGTCCCACGGCGTGTCTGTGCTGGGCATCTTCAACCTGGAGAAGGATGACATGCTGTACATC
CTGGTTGGGCAGCAGGGAGAGGACGCCTGCCCCAGTACAAACCAGTTAATCCAGAAAGTCTGCATTGGAGAGAACAATGTGATAGAAGAA
GAAATCCGTGTGAACAGAAGCGTGCATGAGTGGGCAGGAGGCGGAGGAGGAGGGGGTGGAGCCACCTACGTATTTAAGATGAAGGATGGA
GTGCCGGTGCCCCTGATCATTGCAGCCGGAGGTGGTGGCAGGGCCTACGGGGCCAAGACAGACACGTTCCACCCAGAGAGACTGGAGAAT
AACTCCTCGGTTCTAGGGCTAAACGGCAATTCCGGAGCCGCAGGTGGTGGAGGTGGCTGGAATGATAACACTTCCTTGCTCTGGGCCGGA
AAATCTTTGCAGGAGGGTGCCACCGGAGGACATTCCTGCCCCCAGGCCATGAAGAAGTGGGGGTGGGAGACAAGAGGGGGTTTCGGAGGG
GGTGGAGGGGGGTGCTCCTCAGGTGGAGGAGGCGGAGGATATATAGGCGGCAATGCAGCCTCAAACAATGACCCCGAAATGGATGGGGAA
GATGGGGTTTCCTTCATCAGTCCACTGGGCATCCTGTACACCCCAGCTTTAAAAGTGATGGAAGGCCACGGGGAAGTGAATATTAAGCAT
TATCTAAACTGCAGTCACTGTGAGGTAGACGAATGTCACATGGACCCTGAAAGCCACAAGGTCATCTGCTTCTGTGACCACGGGACGGTG
CTGGCTGAGGATGGCGTCTCCTGCATTGTGTCACCCACCCCGGAGCCACACCTGCCACTCTCGCTGATCCTCTCTGTGGTGACCTCTGCC
CTCGTGGCCGCCCTGGTCCTGGCTTTCTCCGGCATCATGATTGTGTACCGCCGGAAGCACCAGGAGCTGCAAGCCATGCAGATGGAGCTG
CAGAGCCCTGAGTACAAGCTGAGCAAGCTCCGCACCTCGACCATCATGACCGACTACAACCCCAACTACTGCTTTGCTGGCAAGACCTCC
TCCATCAGTGACCTGAAGGAGGTGCCGCGGAAAAACATCACCCTCATTCGGGGTCTGGGCCATGGCGCCTTTGGGGAGGTGTATGAAGGC
CAGGTGTCCGGAATGCCCAACGACCCAAGCCCCCTGCAAGTGGCTGTGAAGACGCTGCCTGAAGTGTGCTCTGAACAGGACGAACTGGAT
TTCCTCATGGAAGCCCTGATCATCAGCAAATTCAACCACCAGAACATTGTTCGCTGCATTGGGGTGAGCCTGCAATCCCTGCCCCGGTTC
ATCCTGCTGGAGCTCATGGCGGGGGGAGACCTCAAGTCCTTCCTCCGAGAGACCCGCCCTCGCCCGAGCCAGCCCTCCTCCCTGGCCATG
CTGGACCTTCTGCACGTGGCTCGGGACATTGCCTGTGGCTGTCAGTATTTGGAGGAAAACCACTTCATCCACCGAGACATTGCTGCCAGA
AACTGCCTCTTGACCTGTCCAGGCCCTGGAAGAGTGGCCAAGATTGGAGACTTCGGGATGGCCCGAGACATCTACAGGGCGAGCTACTAT
AGAAAGGGAGGCTGTGCCATGCTGCCAGTTAAGTGGATGCCCCCAGAGGCCTTCATGGAAGGAATATTCACTTCTAAAACAGACACATGG
TCCTTTGGAGTGCTGCTATGGGAAATCTTTTCTCTTGGATATATGCCATACCCCAGCAAAAGCAACCAGGAAGTTCTGGAGTTTGTCACC
AGTGGAGGCCGGATGGACCCACCCAAGAACTGCCCTGGGCCTGTATACCGGATAATGACTCAGTGCTGGCAACATCAGCCTGAAGACAGG
CCCAACTTTGCCATCATTTTGGAGAGGATTGAATACTGCACCCAGGACCCGGATGTAATCAACACCGCTTTGCCGATAGAATATGGTCCA
CTTGTGGAAGAGGAAGAGAAAGTGCCTGTGAGGCCCAAGGACCCTGAGGGGGTTCCTCCTCTCCTGGTCTCTCAACAGGCAAAACGGGAG
GAGGAGCGCAGCCCAGCTGCCCCACCACCTCTGCCTACCACCTCCTCTGGCAAGGCTGCAAAGAAACCCACAGCTGCAGAGATCTCTGTT
CGAGTCCCTAGAGGGCCGGCCGTGGAAGGGGGACACGTGAATATGGCATTCTCTCAGTCCAACCCTCCTTCGGAGTTGCACAAGGTCCAC
GGATCCAGAAACAAGCCCACCAGCTTGTGGAACCCAACGTACGGCTCCTGGTTTACAGAGAAACCCACCAAAAAGAATAATCCTATAGCA
AAGAAGGAGCCACACGACAGGGGTAACCTGGGGCTGGAGGGAAGCTGTACTGTCCCACCTAACGTTGCAACTGGGAGACTTCCGGGGGCC
TCACTGCTCCTAGAGCCCTCTTCGCTGACTGCCAATATGAAGGAGGTACCTCTGTTCAGGCTACGTCACTTCCCTTGTGGGAATGTCAAT
TACGGCTACCAGCAACAGGGCTTGCCCTTAGAAGCCGCTACTGCCCCTGGAGCTGGTCATTACGAGGATACCATTCTGAAAAGCAAGAAT
AGCATGAACCAGCCTGGGCCCTGAGCTCGGTCGCACACTCACTTCTCTTCCTTGGGATCCCTAAGACCGTGGAGGAGAGAGAGGCAATGG
CTCCTTCACAAACCAGAGACCAAATGTCACGTTTTGTTTTGTGCCAACCTATTTTGAAGTACCACCAAAAAAGCTGTATTTTGAAAATGC
TTTAGAAAGGTTTTGAGCATGGGTTCATCCTATTCTTTCGAAAGAAGAAAATATCATAAAAATGAGTGATAAATACAAGGCCCAGATGTG
GTTGCATAAGGTTTTTATGCATGTTTGTTGTATACTTCCTTATGCTTCTTTCAAATTGTGTGTGCTCTGCTTCAATGTAGTCAGAATTAG
CTGCTTCTATGTTTCATAGTTGGGGTCATAGATGTTTCCTTGCCTTGTTGATGTGGACATGAGCCATTTGAGGGGAGAGGGAACGGAAAT

>In-frame_KCNQ5_ENST00000402622_chr6_73332315_+_ALK_ENST00000389048_chr2_29498362_-_3894nt
ATGCCCCGCCACCACGCGGGAGGAGAGGAGGGCGGCGCCGCCGGGCTCTGGGTGAAGAGCGGCGCAGCGGCGGCGGCGGCGGGCGGGGGG
CGCTTGGGCAGCGGCATGAAGGATGTGGAGTCCGGCCGGGGCAGGGTGCTGCTGAACTCGGCAGCCGCCAGGGGCGACGGCCTGCTACTG
CTGGGCACCCGCGCGGCCACGCTCGGTGGCGGCGGCGGTGGCCTGAGGGAGAGCCGCCGGGGCAAGCAGGGGGCCCGGATGAGCCTGCTG
GGGAAGCCGCTCTCTTACACGAGTAGCCAGAGCTGCCGGCGCAACGTCAAGTACCGGCGGGTGCAGAACTACCTGTACAACGTGCTGGAG
AGACCCCGCGGCTGGGCGTTCATCTACCACGCTTTCGTGTTCTGGCTGCAGATGGTCGCATGGTGGGGACAAGGATCCAGAGCCATCGTG
GCTTTTGACAATATCTCCATCAGCCTGGACTGCTACCTCACCATTAGCGGAGAGGACAAGATCCTGCAGAATACAGCACCCAAATCAAGA
AACCTGTTTGAGAGAAACCCAAACAAGGAGCTGAAACCCGGGGAAAATTCACCAAGACAGACCCCCATCTTTGACCCTACAGTTCATTGG
CTGTTCACCACATGTGGGGCCAGCGGGCCCCATGGCCCCACCCAGGCACAGTGCAACAACGCCTACCAGAACTCCAACCTGAGCGTGGAG
GTGGGGAGCGAGGGCCCCCTGAAAGGCATCCAGATCTGGAAGGTGCCAGCCACCGACACCTACAGCATCTCGGGCTACGGAGCTGCTGGC
GGGAAAGGCGGGAAGAACACCATGATGCGGTCCCACGGCGTGTCTGTGCTGGGCATCTTCAACCTGGAGAAGGATGACATGCTGTACATC
CTGGTTGGGCAGCAGGGAGAGGACGCCTGCCCCAGTACAAACCAGTTAATCCAGAAAGTCTGCATTGGAGAGAACAATGTGATAGAAGAA
GAAATCCGTGTGAACAGAAGCGTGCATGAGTGGGCAGGAGGCGGAGGAGGAGGGGGTGGAGCCACCTACGTATTTAAGATGAAGGATGGA
GTGCCGGTGCCCCTGATCATTGCAGCCGGAGGTGGTGGCAGGGCCTACGGGGCCAAGACAGACACGTTCCACCCAGAGAGACTGGAGAAT
AACTCCTCGGTTCTAGGGCTAAACGGCAATTCCGGAGCCGCAGGTGGTGGAGGTGGCTGGAATGATAACACTTCCTTGCTCTGGGCCGGA
AAATCTTTGCAGGAGGGTGCCACCGGAGGACATTCCTGCCCCCAGGCCATGAAGAAGTGGGGGTGGGAGACAAGAGGGGGTTTCGGAGGG
GGTGGAGGGGGGTGCTCCTCAGGTGGAGGAGGCGGAGGATATATAGGCGGCAATGCAGCCTCAAACAATGACCCCGAAATGGATGGGGAA
GATGGGGTTTCCTTCATCAGTCCACTGGGCATCCTGTACACCCCAGCTTTAAAAGTGATGGAAGGCCACGGGGAAGTGAATATTAAGCAT
TATCTAAACTGCAGTCACTGTGAGGTAGACGAATGTCACATGGACCCTGAAAGCCACAAGGTCATCTGCTTCTGTGACCACGGGACGGTG
CTGGCTGAGGATGGCGTCTCCTGCATTGTGTCACCCACCCCGGAGCCACACCTGCCACTCTCGCTGATCCTCTCTGTGGTGACCTCTGCC
CTCGTGGCCGCCCTGGTCCTGGCTTTCTCCGGCATCATGATTGTGTACCGCCGGAAGCACCAGGAGCTGCAAGCCATGCAGATGGAGCTG
CAGAGCCCTGAGTACAAGCTGAGCAAGCTCCGCACCTCGACCATCATGACCGACTACAACCCCAACTACTGCTTTGCTGGCAAGACCTCC
TCCATCAGTGACCTGAAGGAGGTGCCGCGGAAAAACATCACCCTCATTCGGGGTCTGGGCCATGGCGCCTTTGGGGAGGTGTATGAAGGC
CAGGTGTCCGGAATGCCCAACGACCCAAGCCCCCTGCAAGTGGCTGTGAAGACGCTGCCTGAAGTGTGCTCTGAACAGGACGAACTGGAT
TTCCTCATGGAAGCCCTGATCATCAGCAAATTCAACCACCAGAACATTGTTCGCTGCATTGGGGTGAGCCTGCAATCCCTGCCCCGGTTC
ATCCTGCTGGAGCTCATGGCGGGGGGAGACCTCAAGTCCTTCCTCCGAGAGACCCGCCCTCGCCCGAGCCAGCCCTCCTCCCTGGCCATG
CTGGACCTTCTGCACGTGGCTCGGGACATTGCCTGTGGCTGTCAGTATTTGGAGGAAAACCACTTCATCCACCGAGACATTGCTGCCAGA
AACTGCCTCTTGACCTGTCCAGGCCCTGGAAGAGTGGCCAAGATTGGAGACTTCGGGATGGCCCGAGACATCTACAGGGCGAGCTACTAT
AGAAAGGGAGGCTGTGCCATGCTGCCAGTTAAGTGGATGCCCCCAGAGGCCTTCATGGAAGGAATATTCACTTCTAAAACAGACACATGG
TCCTTTGGAGTGCTGCTATGGGAAATCTTTTCTCTTGGATATATGCCATACCCCAGCAAAAGCAACCAGGAAGTTCTGGAGTTTGTCACC
AGTGGAGGCCGGATGGACCCACCCAAGAACTGCCCTGGGCCTGTATACCGGATAATGACTCAGTGCTGGCAACATCAGCCTGAAGACAGG
CCCAACTTTGCCATCATTTTGGAGAGGATTGAATACTGCACCCAGGACCCGGATGTAATCAACACCGCTTTGCCGATAGAATATGGTCCA
CTTGTGGAAGAGGAAGAGAAAGTGCCTGTGAGGCCCAAGGACCCTGAGGGGGTTCCTCCTCTCCTGGTCTCTCAACAGGCAAAACGGGAG
GAGGAGCGCAGCCCAGCTGCCCCACCACCTCTGCCTACCACCTCCTCTGGCAAGGCTGCAAAGAAACCCACAGCTGCAGAGATCTCTGTT
CGAGTCCCTAGAGGGCCGGCCGTGGAAGGGGGACACGTGAATATGGCATTCTCTCAGTCCAACCCTCCTTCGGAGTTGCACAAGGTCCAC
GGATCCAGAAACAAGCCCACCAGCTTGTGGAACCCAACGTACGGCTCCTGGTTTACAGAGAAACCCACCAAAAAGAATAATCCTATAGCA
AAGAAGGAGCCACACGACAGGGGTAACCTGGGGCTGGAGGGAAGCTGTACTGTCCCACCTAACGTTGCAACTGGGAGACTTCCGGGGGCC
TCACTGCTCCTAGAGCCCTCTTCGCTGACTGCCAATATGAAGGAGGTACCTCTGTTCAGGCTACGTCACTTCCCTTGTGGGAATGTCAAT
TACGGCTACCAGCAACAGGGCTTGCCCTTAGAAGCCGCTACTGCCCCTGGAGCTGGTCATTACGAGGATACCATTCTGAAAAGCAAGAAT
AGCATGAACCAGCCTGGGCCCTGAGCTCGGTCGCACACTCACTTCTCTTCCTTGGGATCCCTAAGACCGTGGAGGAGAGAGAGGCAATGG
CTCCTTCACAAACCAGAGACCAAATGTCACGTTTTGTTTTGTGCCAACCTATTTTGAAGTACCACCAAAAAAGCTGTATTTTGAAAATGC
TTTAGAAAGGTTTTGAGCATGGGTTCATCCTATTCTTTCGAAAGAAGAAAATATCATAAAAATGAGTGATAAATACAAGGCCCAGATGTG
GTTGCATAAGGTTTTTATGCATGTTTGTTGTATACTTCCTTATGCTTCTTTCAAATTGTGTGTGCTCTGCTTCAATGTAGTCAGAATTAG
CTGCTTCTATGTTTCATAGTTGGGGTCATAGATGTTTCCTTGCCTTGTTGATGTGGACATGAGCCATTTGAGGGGAGAGGGAACGGAAAT

>In-frame_KCNQ5_ENST00000403813_chr6_73332315_+_ALK_ENST00000389048_chr2_29498362_-_3894nt
ATGCCCCGCCACCACGCGGGAGGAGAGGAGGGCGGCGCCGCCGGGCTCTGGGTGAAGAGCGGCGCAGCGGCGGCGGCGGCGGGCGGGGGG
CGCTTGGGCAGCGGCATGAAGGATGTGGAGTCCGGCCGGGGCAGGGTGCTGCTGAACTCGGCAGCCGCCAGGGGCGACGGCCTGCTACTG
CTGGGCACCCGCGCGGCCACGCTCGGTGGCGGCGGCGGTGGCCTGAGGGAGAGCCGCCGGGGCAAGCAGGGGGCCCGGATGAGCCTGCTG
GGGAAGCCGCTCTCTTACACGAGTAGCCAGAGCTGCCGGCGCAACGTCAAGTACCGGCGGGTGCAGAACTACCTGTACAACGTGCTGGAG
AGACCCCGCGGCTGGGCGTTCATCTACCACGCTTTCGTGTTCTGGCTGCAGATGGTCGCATGGTGGGGACAAGGATCCAGAGCCATCGTG
GCTTTTGACAATATCTCCATCAGCCTGGACTGCTACCTCACCATTAGCGGAGAGGACAAGATCCTGCAGAATACAGCACCCAAATCAAGA
AACCTGTTTGAGAGAAACCCAAACAAGGAGCTGAAACCCGGGGAAAATTCACCAAGACAGACCCCCATCTTTGACCCTACAGTTCATTGG
CTGTTCACCACATGTGGGGCCAGCGGGCCCCATGGCCCCACCCAGGCACAGTGCAACAACGCCTACCAGAACTCCAACCTGAGCGTGGAG
GTGGGGAGCGAGGGCCCCCTGAAAGGCATCCAGATCTGGAAGGTGCCAGCCACCGACACCTACAGCATCTCGGGCTACGGAGCTGCTGGC
GGGAAAGGCGGGAAGAACACCATGATGCGGTCCCACGGCGTGTCTGTGCTGGGCATCTTCAACCTGGAGAAGGATGACATGCTGTACATC
CTGGTTGGGCAGCAGGGAGAGGACGCCTGCCCCAGTACAAACCAGTTAATCCAGAAAGTCTGCATTGGAGAGAACAATGTGATAGAAGAA
GAAATCCGTGTGAACAGAAGCGTGCATGAGTGGGCAGGAGGCGGAGGAGGAGGGGGTGGAGCCACCTACGTATTTAAGATGAAGGATGGA
GTGCCGGTGCCCCTGATCATTGCAGCCGGAGGTGGTGGCAGGGCCTACGGGGCCAAGACAGACACGTTCCACCCAGAGAGACTGGAGAAT
AACTCCTCGGTTCTAGGGCTAAACGGCAATTCCGGAGCCGCAGGTGGTGGAGGTGGCTGGAATGATAACACTTCCTTGCTCTGGGCCGGA
AAATCTTTGCAGGAGGGTGCCACCGGAGGACATTCCTGCCCCCAGGCCATGAAGAAGTGGGGGTGGGAGACAAGAGGGGGTTTCGGAGGG
GGTGGAGGGGGGTGCTCCTCAGGTGGAGGAGGCGGAGGATATATAGGCGGCAATGCAGCCTCAAACAATGACCCCGAAATGGATGGGGAA
GATGGGGTTTCCTTCATCAGTCCACTGGGCATCCTGTACACCCCAGCTTTAAAAGTGATGGAAGGCCACGGGGAAGTGAATATTAAGCAT
TATCTAAACTGCAGTCACTGTGAGGTAGACGAATGTCACATGGACCCTGAAAGCCACAAGGTCATCTGCTTCTGTGACCACGGGACGGTG
CTGGCTGAGGATGGCGTCTCCTGCATTGTGTCACCCACCCCGGAGCCACACCTGCCACTCTCGCTGATCCTCTCTGTGGTGACCTCTGCC
CTCGTGGCCGCCCTGGTCCTGGCTTTCTCCGGCATCATGATTGTGTACCGCCGGAAGCACCAGGAGCTGCAAGCCATGCAGATGGAGCTG
CAGAGCCCTGAGTACAAGCTGAGCAAGCTCCGCACCTCGACCATCATGACCGACTACAACCCCAACTACTGCTTTGCTGGCAAGACCTCC
TCCATCAGTGACCTGAAGGAGGTGCCGCGGAAAAACATCACCCTCATTCGGGGTCTGGGCCATGGCGCCTTTGGGGAGGTGTATGAAGGC
CAGGTGTCCGGAATGCCCAACGACCCAAGCCCCCTGCAAGTGGCTGTGAAGACGCTGCCTGAAGTGTGCTCTGAACAGGACGAACTGGAT
TTCCTCATGGAAGCCCTGATCATCAGCAAATTCAACCACCAGAACATTGTTCGCTGCATTGGGGTGAGCCTGCAATCCCTGCCCCGGTTC
ATCCTGCTGGAGCTCATGGCGGGGGGAGACCTCAAGTCCTTCCTCCGAGAGACCCGCCCTCGCCCGAGCCAGCCCTCCTCCCTGGCCATG
CTGGACCTTCTGCACGTGGCTCGGGACATTGCCTGTGGCTGTCAGTATTTGGAGGAAAACCACTTCATCCACCGAGACATTGCTGCCAGA
AACTGCCTCTTGACCTGTCCAGGCCCTGGAAGAGTGGCCAAGATTGGAGACTTCGGGATGGCCCGAGACATCTACAGGGCGAGCTACTAT
AGAAAGGGAGGCTGTGCCATGCTGCCAGTTAAGTGGATGCCCCCAGAGGCCTTCATGGAAGGAATATTCACTTCTAAAACAGACACATGG
TCCTTTGGAGTGCTGCTATGGGAAATCTTTTCTCTTGGATATATGCCATACCCCAGCAAAAGCAACCAGGAAGTTCTGGAGTTTGTCACC
AGTGGAGGCCGGATGGACCCACCCAAGAACTGCCCTGGGCCTGTATACCGGATAATGACTCAGTGCTGGCAACATCAGCCTGAAGACAGG
CCCAACTTTGCCATCATTTTGGAGAGGATTGAATACTGCACCCAGGACCCGGATGTAATCAACACCGCTTTGCCGATAGAATATGGTCCA
CTTGTGGAAGAGGAAGAGAAAGTGCCTGTGAGGCCCAAGGACCCTGAGGGGGTTCCTCCTCTCCTGGTCTCTCAACAGGCAAAACGGGAG
GAGGAGCGCAGCCCAGCTGCCCCACCACCTCTGCCTACCACCTCCTCTGGCAAGGCTGCAAAGAAACCCACAGCTGCAGAGATCTCTGTT
CGAGTCCCTAGAGGGCCGGCCGTGGAAGGGGGACACGTGAATATGGCATTCTCTCAGTCCAACCCTCCTTCGGAGTTGCACAAGGTCCAC
GGATCCAGAAACAAGCCCACCAGCTTGTGGAACCCAACGTACGGCTCCTGGTTTACAGAGAAACCCACCAAAAAGAATAATCCTATAGCA
AAGAAGGAGCCACACGACAGGGGTAACCTGGGGCTGGAGGGAAGCTGTACTGTCCCACCTAACGTTGCAACTGGGAGACTTCCGGGGGCC
TCACTGCTCCTAGAGCCCTCTTCGCTGACTGCCAATATGAAGGAGGTACCTCTGTTCAGGCTACGTCACTTCCCTTGTGGGAATGTCAAT
TACGGCTACCAGCAACAGGGCTTGCCCTTAGAAGCCGCTACTGCCCCTGGAGCTGGTCATTACGAGGATACCATTCTGAAAAGCAAGAAT
AGCATGAACCAGCCTGGGCCCTGAGCTCGGTCGCACACTCACTTCTCTTCCTTGGGATCCCTAAGACCGTGGAGGAGAGAGAGGCAATGG
CTCCTTCACAAACCAGAGACCAAATGTCACGTTTTGTTTTGTGCCAACCTATTTTGAAGTACCACCAAAAAAGCTGTATTTTGAAAATGC
TTTAGAAAGGTTTTGAGCATGGGTTCATCCTATTCTTTCGAAAGAAGAAAATATCATAAAAATGAGTGATAAATACAAGGCCCAGATGTG
GTTGCATAAGGTTTTTATGCATGTTTGTTGTATACTTCCTTATGCTTCTTTCAAATTGTGTGTGCTCTGCTTCAATGTAGTCAGAATTAG
CTGCTTCTATGTTTCATAGTTGGGGTCATAGATGTTTCCTTGCCTTGTTGATGTGGACATGAGCCATTTGAGGGGAGAGGGAACGGAAAT


Top

FusionGenePPI for KCNQ5_ALK


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
KCNQ5KCNQ3, DISC1, HCCS, MCOLN3, GABRE, KCNS3ALKPTN, SHC1, PLCG1, JAK3, SHC3, RAB35, HSPD1, MAP3K4, GRB2, SOCS1, PIK3CB, RAD17, IRF7, EPHB2, EIF4B, MAPK8IP3, CENPF, PLCB2, PDX1, STAT3, MAP2K7, JAK2, MAP3K5, MEP1B, GAK, EPHA1, UBASH3A, MTIF2, MYLK, MAP3K1, MAPK1, SOCS5, CDK13, SMC6, IRS4, KRT18, KRT74, IRS1, IKBKG, ZC3HC1, TNK2, ERRFI1, PIK3R1, HSP90AA1, BCAR1, ACTB, PDLIM3, VIM, TUBB4B, MYO6, MYH10, MYH9, TUBGCP2, ACTN4, CORO1C, FLII, BICD2, GNB2L1, SRC, PXN, PRKCQ, MYBPC2, CDK9, PPM1A, DUSP19


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for KCNQ5_ALK


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
HgeneKCNQ5Q9NR82DB04953EzogabinePotassium voltage-gated channel subfamily KQT member 5small moleculeapproved|investigational
TgeneALKQ9UM73DB08865CrizotinibALK tyrosine kinase receptorsmall moleculeapproved
TgeneALKQ9UM73DB09063CeritinibALK tyrosine kinase receptorsmall moleculeapproved

Top

RelatedDiseases for KCNQ5_ALK


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneKCNQ5C0027092Myopia1CTD_human
TgeneALKC0007131Non-Small Cell Lung Carcinoma28CTD_human
TgeneALKC0027819Neuroblastoma12CTD_human;ORPHANET
TgeneALKC0152013Adenocarcinoma of lung (disorder)8CTD_human
TgeneALKC0206180Ki-1+ Anaplastic Large Cell Lymphoma6CTD_human
TgeneALKC2751681NEUROBLASTOMA, SUSCEPTIBILITY TO, 34UNIPROT
TgeneALKC0018199Granuloma, Plasma Cell3CTD_human
TgeneALKC0007621Neoplastic Cell Transformation2CTD_human
TgeneALKC0027627Neoplasm Metastasis2CTD_human
TgeneALKC0001973Alcoholic Intoxication, Chronic1PSYGENET
TgeneALKC0006118Brain Neoplasms1CTD_human
TgeneALKC0007134Renal Cell Carcinoma1CTD_human
TgeneALKC0011570Mental Depression1PSYGENET
TgeneALKC0011581Depressive disorder1PSYGENET
TgeneALKC0027643Neoplasm Recurrence, Local1CTD_human
TgeneALKC0036341Schizophrenia1PSYGENET
TgeneALKC0079744Diffuse Large B-Cell Lymphoma1CTD_human
TgeneALKC0085269Plasma Cell Granuloma, Pulmonary1CTD_human
TgeneALKC0278601Inflammatory Breast Carcinoma1CTD_human