FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 18325

FusionGeneSummary for KCNQ1_GALNTL6

check button Fusion gene summary
Fusion gene informationFusion gene name: KCNQ1_GALNTL6
Fusion gene ID: 18325
HgeneTgene
Gene symbol

KCNQ1

GALNTL6

Gene ID

3784

442117

Gene namepotassium voltage-gated channel subfamily Q member 1polypeptide N-acetylgalactosaminyltransferase like 6
SynonymsATFB1|ATFB3|JLNS1|KCNA8|KCNA9|KVLQT1|Kv1.9|Kv7.1|LQT|LQT1|RWS|SQT2|WRSGALNACT20|GALNT17|GalNAc-T6L
Cytomap

11p15.5-p15.4

4q34.1

Type of geneprotein-codingprotein-coding
Descriptionpotassium voltage-gated channel subfamily KQT member 1IKs producing slow voltage-gated potassium channel subunit alpha KvLQT1kidney and cardiac voltage dependend K+ channelpotassium channel, voltage gated KQT-like subfamily Q, member 1potassium voltagpolypeptide N-acetylgalactosaminyltransferase-like 6GaNTase 17GalNAc transferase 17UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 17UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 20UDP-N-acetyl-alpha-D-gala
Modification date2018052720180523
UniProtAcc

P51787

Q49A17

Ensembl transtripts involved in fusion geneENST00000155840, ENST00000335475, 
ENST00000526095, 
ENST00000506823, 
ENST00000508122, ENST00000457021, 
ENST00000511251, 
Fusion gene scores* DoF score12 X 8 X 8=7687 X 5 X 7=245
# samples 127
** MAII scorelog2(12/768*10)=-2.67807190511264
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(7/245*10)=-1.8073549220576
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: KCNQ1 [Title/Abstract] AND GALNTL6 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneKCNQ1

GO:0035690

cellular response to drug

9108097

HgeneKCNQ1

GO:0060306

regulation of membrane repolarization

11299204

HgeneKCNQ1

GO:0071320

cellular response to cAMP

11299204|16002409

HgeneKCNQ1

GO:0071435

potassium ion export

8900283|10400998

HgeneKCNQ1

GO:0071805

potassium ion transmembrane transport

9354802|11299204|16002409

HgeneKCNQ1

GO:0086011

membrane repolarization during action potential

8900283|11299204|19646991

HgeneKCNQ1

GO:0097623

potassium ion export across plasma membrane

17289006

HgeneKCNQ1

GO:1901381

positive regulation of potassium ion transmembrane transport

8900283

TgeneGALNTL6

GO:0018243

protein O-linked glycosylation via threonine

22186971


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVCOADTCGA-D5-5538-01AKCNQ1chr11

2799267

+GALNTL6chr4

173930329

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000155840ENST00000506823KCNQ1chr11

2799267

+GALNTL6chr4

173930329

+
In-frameENST00000155840ENST00000508122KCNQ1chr11

2799267

+GALNTL6chr4

173930329

+
5CDS-intronENST00000155840ENST00000457021KCNQ1chr11

2799267

+GALNTL6chr4

173930329

+
5CDS-intronENST00000155840ENST00000511251KCNQ1chr11

2799267

+GALNTL6chr4

173930329

+
In-frameENST00000335475ENST00000506823KCNQ1chr11

2799267

+GALNTL6chr4

173930329

+
In-frameENST00000335475ENST00000508122KCNQ1chr11

2799267

+GALNTL6chr4

173930329

+
5CDS-intronENST00000335475ENST00000457021KCNQ1chr11

2799267

+GALNTL6chr4

173930329

+
5CDS-intronENST00000335475ENST00000511251KCNQ1chr11

2799267

+GALNTL6chr4

173930329

+
3UTR-3CDSENST00000526095ENST00000506823KCNQ1chr11

2799267

+GALNTL6chr4

173930329

+
3UTR-3CDSENST00000526095ENST00000508122KCNQ1chr11

2799267

+GALNTL6chr4

173930329

+
3UTR-intronENST00000526095ENST00000457021KCNQ1chr11

2799267

+GALNTL6chr4

173930329

+
3UTR-intronENST00000526095ENST00000511251KCNQ1chr11

2799267

+GALNTL6chr4

173930329

+

Top

FusionProtFeatures for KCNQ1_GALNTL6


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
KCNQ1

P51787

GALNTL6

Q49A17

Catalyzes the initial reaction in O-linkedoligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on theprotein receptor. {ECO:0000250}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneKCNQ1chr11:2799267chr4:173930329ENST00000155840+1516300_320598677IntramembranePore-forming%3B Name%3DSegment H5
HgeneKCNQ1chr11:2799267chr4:173930329ENST00000335475+1516300_320471550IntramembranePore-forming%3B Name%3DSegment H5
HgeneKCNQ1chr11:2799267chr4:173930329ENST00000155840+1516312_317598677MotifSelectivity filter
HgeneKCNQ1chr11:2799267chr4:173930329ENST00000335475+1516312_317471550MotifSelectivity filter
HgeneKCNQ1chr11:2799267chr4:173930329ENST00000155840+1516143_147598677Topological domainExtracellular
HgeneKCNQ1chr11:2799267chr4:173930329ENST00000155840+1516169_196598677Topological domainCytoplasmic
HgeneKCNQ1chr11:2799267chr4:173930329ENST00000155840+15161_121598677Topological domainCytoplasmic
HgeneKCNQ1chr11:2799267chr4:173930329ENST00000155840+1516218_225598677Topological domainExtracellular
HgeneKCNQ1chr11:2799267chr4:173930329ENST00000155840+1516249_261598677Topological domainCytoplasmic
HgeneKCNQ1chr11:2799267chr4:173930329ENST00000155840+1516283_299598677Topological domainExtracellular
HgeneKCNQ1chr11:2799267chr4:173930329ENST00000155840+1516321_327598677Topological domainExtracellular
HgeneKCNQ1chr11:2799267chr4:173930329ENST00000335475+1516143_147471550Topological domainExtracellular
HgeneKCNQ1chr11:2799267chr4:173930329ENST00000335475+1516169_196471550Topological domainCytoplasmic
HgeneKCNQ1chr11:2799267chr4:173930329ENST00000335475+15161_121471550Topological domainCytoplasmic
HgeneKCNQ1chr11:2799267chr4:173930329ENST00000335475+1516218_225471550Topological domainExtracellular
HgeneKCNQ1chr11:2799267chr4:173930329ENST00000335475+1516249_261471550Topological domainCytoplasmic
HgeneKCNQ1chr11:2799267chr4:173930329ENST00000335475+1516283_299471550Topological domainExtracellular
HgeneKCNQ1chr11:2799267chr4:173930329ENST00000335475+1516321_327471550Topological domainExtracellular
HgeneKCNQ1chr11:2799267chr4:173930329ENST00000155840+1516122_142598677TransmembraneHelical%3B Name%3DSegment S1
HgeneKCNQ1chr11:2799267chr4:173930329ENST00000155840+1516148_168598677TransmembraneHelical%3B Name%3DSegment S2
HgeneKCNQ1chr11:2799267chr4:173930329ENST00000155840+1516197_217598677TransmembraneHelical%3B Name%3DSegment S3
HgeneKCNQ1chr11:2799267chr4:173930329ENST00000155840+1516226_248598677TransmembraneHelical%3B Voltage-sensor%3B Name%3DSegment S4
HgeneKCNQ1chr11:2799267chr4:173930329ENST00000155840+1516262_282598677TransmembraneHelical%3B Name%3DSegment S5
HgeneKCNQ1chr11:2799267chr4:173930329ENST00000155840+1516328_348598677TransmembraneHelical%3B Name%3DSegment S6
HgeneKCNQ1chr11:2799267chr4:173930329ENST00000335475+1516122_142471550TransmembraneHelical%3B Name%3DSegment S1
HgeneKCNQ1chr11:2799267chr4:173930329ENST00000335475+1516148_168471550TransmembraneHelical%3B Name%3DSegment S2
HgeneKCNQ1chr11:2799267chr4:173930329ENST00000335475+1516197_217471550TransmembraneHelical%3B Name%3DSegment S3
HgeneKCNQ1chr11:2799267chr4:173930329ENST00000335475+1516226_248471550TransmembraneHelical%3B Voltage-sensor%3B Name%3DSegment S4
HgeneKCNQ1chr11:2799267chr4:173930329ENST00000335475+1516262_282471550TransmembraneHelical%3B Name%3DSegment S5
HgeneKCNQ1chr11:2799267chr4:173930329ENST00000335475+1516328_348471550TransmembraneHelical%3B Name%3DSegment S6
TgeneGALNTL6chr11:2799267chr4:173930329ENST00000508122+812453_585440585DomainRicin B-type lectin

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneKCNQ1chr11:2799267chr4:173930329ENST00000155840+1516585_621598677Coiled coilOntology_term=ECO:0000269
HgeneKCNQ1chr11:2799267chr4:173930329ENST00000335475+1516585_621471550Coiled coilOntology_term=ECO:0000269
HgeneKCNQ1chr11:2799267chr4:173930329ENST00000155840+1516589_620598677RegionC-terminal assembly domain
HgeneKCNQ1chr11:2799267chr4:173930329ENST00000335475+1516589_620471550RegionC-terminal assembly domain
HgeneKCNQ1chr11:2799267chr4:173930329ENST00000155840+1516349_676598677Topological domainCytoplasmic
HgeneKCNQ1chr11:2799267chr4:173930329ENST00000335475+1516349_676471550Topological domainCytoplasmic
TgeneGALNTL6chr11:2799267chr4:173930329ENST00000506823+913453_585457602DomainRicin B-type lectin
TgeneGALNTL6chr11:2799267chr4:173930329ENST00000506823+913139_248457602RegionNote=Catalytic subdomain A
TgeneGALNTL6chr11:2799267chr4:173930329ENST00000506823+913306_368457602RegionNote=Catalytic subdomain B
TgeneGALNTL6chr11:2799267chr4:173930329ENST00000508122+812139_248440585RegionNote=Catalytic subdomain A
TgeneGALNTL6chr11:2799267chr4:173930329ENST00000508122+812306_368440585RegionNote=Catalytic subdomain B
TgeneGALNTL6chr11:2799267chr4:173930329ENST00000506823+9131_7457602Topological domainCytoplasmic
TgeneGALNTL6chr11:2799267chr4:173930329ENST00000506823+91329_601457602Topological domainLumenal
TgeneGALNTL6chr11:2799267chr4:173930329ENST00000508122+8121_7440585Topological domainCytoplasmic
TgeneGALNTL6chr11:2799267chr4:173930329ENST00000508122+81229_601440585Topological domainLumenal
TgeneGALNTL6chr11:2799267chr4:173930329ENST00000506823+9138_28457602TransmembraneHelical%3B Signal-anchor for type II membrane protein
TgeneGALNTL6chr11:2799267chr4:173930329ENST00000508122+8128_28440585TransmembraneHelical%3B Signal-anchor for type II membrane protein


Top

FusionGeneSequence for KCNQ1_GALNTL6


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_KCNQ1_ENST00000155840_chr11_2799267_+_GALNTL6_ENST00000506823_chr4_173930329_+_743aa
MAAASSPPRAERKRWGWGRLPGARRGSAGLAKKCPFSLELAEGGPAGGALYAPIAPGAPGPAPPASPAAPAAPPVASDLGPRPPVSLDPR
VSIYSTRRPVLARTHVQGRVYNFLERPTGWKCFVYHFAVFLIVLVCLIFSVLSTIEQYAALATGTLFWMEIVLVVFFGTEYVVRLWSAGC
RSKYVGLWGRLRFARKPISIIDLIVVVASMVVLCVGSKGQVFATSAIRGIRFLQILRMLHVDRQGGTWRLLGSVVFIHRQELITTLYIGF
LGLIFSSYFVYLAEKDAVNESGRVEFGSYADALWWGVVTVTTIGYGDKVPQTWVGKTIASCFSVFAISFFALPAGILGSGFALKVQQKQR
QKHFNRQIPAAASLIQTAWRCYAAENPDSSTWKIYIRKAPRSHTLLSPSPKPKKSVVVKKKKFKLDKDNGVTPGEKMLTVPHITCDPPEE
RRLDHFSVDGYDSSVRKSPTLLEVSMPHFMRTNSFAEDLDLEGETLLTPITHISQLREHHRATIKVIRRMQYFVAKKKFQQARKPYDVRD
VIEQYSQGHLNLMVRIKELQRRLDQSIGKPSLFISVSEKSKDRGSNTIGARLNRVEDKIRNVAANLCVDSKHGATGTELRLDICVKDGSE
RTWSHEQLFTFGWREDIRPGEPLHTRKFCFDAISHNSPVTLYDCHGMKGNQLWGYRKDRTLFHPVSNSCMDCNPAEKKIFMARCDPLSET

>In-frame_KCNQ1_ENST00000155840_chr11_2799267_+_GALNTL6_ENST00000508122_chr4_173930329_+_743aa
MAAASSPPRAERKRWGWGRLPGARRGSAGLAKKCPFSLELAEGGPAGGALYAPIAPGAPGPAPPASPAAPAAPPVASDLGPRPPVSLDPR
VSIYSTRRPVLARTHVQGRVYNFLERPTGWKCFVYHFAVFLIVLVCLIFSVLSTIEQYAALATGTLFWMEIVLVVFFGTEYVVRLWSAGC
RSKYVGLWGRLRFARKPISIIDLIVVVASMVVLCVGSKGQVFATSAIRGIRFLQILRMLHVDRQGGTWRLLGSVVFIHRQELITTLYIGF
LGLIFSSYFVYLAEKDAVNESGRVEFGSYADALWWGVVTVTTIGYGDKVPQTWVGKTIASCFSVFAISFFALPAGILGSGFALKVQQKQR
QKHFNRQIPAAASLIQTAWRCYAAENPDSSTWKIYIRKAPRSHTLLSPSPKPKKSVVVKKKKFKLDKDNGVTPGEKMLTVPHITCDPPEE
RRLDHFSVDGYDSSVRKSPTLLEVSMPHFMRTNSFAEDLDLEGETLLTPITHISQLREHHRATIKVIRRMQYFVAKKKFQQARKPYDVRD
VIEQYSQGHLNLMVRIKELQRRLDQSIGKPSLFISVSEKSKDRGSNTIGARLNRVEDKIRNVAANLCVDSKHGATGTELRLDICVKDGSE
RTWSHEQLFTFGWREDIRPGEPLHTRKFCFDAISHNSPVTLYDCHGMKGNQLWGYRKDRTLFHPVSNSCMDCNPAEKKIFMARCDPLSET

>In-frame_KCNQ1_ENST00000335475_chr11_2799267_+_GALNTL6_ENST00000506823_chr4_173930329_+_616aa
MDFLIVLVCLIFSVLSTIEQYAALATGTLFWMEIVLVVFFGTEYVVRLWSAGCRSKYVGLWGRLRFARKPISIIDLIVVVASMVVLCVGS
KGQVFATSAIRGIRFLQILRMLHVDRQGGTWRLLGSVVFIHRQELITTLYIGFLGLIFSSYFVYLAEKDAVNESGRVEFGSYADALWWGV
VTVTTIGYGDKVPQTWVGKTIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAASLIQTAWRCYAAENPDSSTWKIYIR
KAPRSHTLLSPSPKPKKSVVVKKKKFKLDKDNGVTPGEKMLTVPHITCDPPEERRLDHFSVDGYDSSVRKSPTLLEVSMPHFMRTNSFAE
DLDLEGETLLTPITHISQLREHHRATIKVIRRMQYFVAKKKFQQARKPYDVRDVIEQYSQGHLNLMVRIKELQRRLDQSIGKPSLFISVS
EKSKDRGSNTIGARLNRVEDKIRNVAANLCVDSKHGATGTELRLDICVKDGSERTWSHEQLFTFGWREDIRPGEPLHTRKFCFDAISHNS

>In-frame_KCNQ1_ENST00000335475_chr11_2799267_+_GALNTL6_ENST00000508122_chr4_173930329_+_616aa
MDFLIVLVCLIFSVLSTIEQYAALATGTLFWMEIVLVVFFGTEYVVRLWSAGCRSKYVGLWGRLRFARKPISIIDLIVVVASMVVLCVGS
KGQVFATSAIRGIRFLQILRMLHVDRQGGTWRLLGSVVFIHRQELITTLYIGFLGLIFSSYFVYLAEKDAVNESGRVEFGSYADALWWGV
VTVTTIGYGDKVPQTWVGKTIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAASLIQTAWRCYAAENPDSSTWKIYIR
KAPRSHTLLSPSPKPKKSVVVKKKKFKLDKDNGVTPGEKMLTVPHITCDPPEERRLDHFSVDGYDSSVRKSPTLLEVSMPHFMRTNSFAE
DLDLEGETLLTPITHISQLREHHRATIKVIRRMQYFVAKKKFQQARKPYDVRDVIEQYSQGHLNLMVRIKELQRRLDQSIGKPSLFISVS
EKSKDRGSNTIGARLNRVEDKIRNVAANLCVDSKHGATGTELRLDICVKDGSERTWSHEQLFTFGWREDIRPGEPLHTRKFCFDAISHNS


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_KCNQ1_ENST00000155840_chr11_2799267_+_GALNTL6_ENST00000506823_chr4_173930329_+_2229nt
ATGGCCGCGGCCTCCTCCCCGCCCAGGGCCGAGAGGAAGCGCTGGGGTTGGGGCCGCCTGCCAGGCGCCCGGCGGGGCAGCGCGGGCCTG
GCCAAGAAGTGCCCCTTCTCGCTGGAGCTGGCGGAGGGCGGCCCGGCGGGCGGCGCGCTCTACGCGCCCATCGCGCCCGGCGCCCCAGGT
CCCGCGCCCCCTGCGTCCCCGGCCGCGCCCGCCGCGCCCCCAGTTGCCTCCGACCTTGGCCCGCGGCCGCCGGTGAGCCTAGACCCGCGC
GTCTCCATCTACAGCACGCGCCGCCCGGTGTTGGCGCGCACCCACGTCCAGGGCCGCGTCTACAACTTCCTCGAGCGTCCCACCGGCTGG
AAATGCTTCGTTTACCACTTCGCCGTCTTCCTCATCGTCCTGGTCTGCCTCATCTTCAGCGTGCTGTCCACCATCGAGCAGTATGCCGCC
CTGGCCACGGGGACTCTCTTCTGGATGGAGATCGTGCTGGTGGTGTTCTTCGGGACGGAGTACGTGGTCCGCCTCTGGTCCGCCGGCTGC
CGCAGCAAGTACGTGGGCCTCTGGGGGCGGCTGCGCTTTGCCCGGAAGCCCATTTCCATCATCGACCTCATCGTGGTCGTGGCCTCCATG
GTGGTCCTCTGCGTGGGCTCCAAGGGGCAGGTGTTTGCCACGTCGGCCATCAGGGGCATCCGCTTCCTGCAGATCCTGAGGATGCTACAC
GTCGACCGCCAGGGAGGCACCTGGAGGCTCCTGGGCTCCGTGGTCTTCATCCACCGCCAGGAGCTGATAACCACCCTGTACATCGGCTTC
CTGGGCCTCATCTTCTCCTCGTACTTTGTGTACCTGGCTGAGAAGGACGCGGTGAACGAGTCAGGCCGCGTGGAGTTCGGCAGCTACGCA
GATGCGCTGTGGTGGGGGGTGGTCACAGTCACCACCATCGGCTATGGGGACAAGGTGCCCCAGACGTGGGTCGGGAAGACCATCGCCTCC
TGCTTCTCTGTCTTTGCCATCTCCTTCTTTGCGCTCCCAGCGGGGATTCTTGGCTCGGGGTTTGCCCTGAAGGTGCAGCAGAAGCAGAGG
CAGAAGCACTTCAACCGGCAGATCCCGGCGGCAGCCTCACTCATTCAGACCGCATGGAGGTGCTATGCTGCCGAGAACCCCGACTCCTCC
ACCTGGAAGATCTACATCCGGAAGGCCCCCCGGAGCCACACTCTGCTGTCACCCAGCCCCAAACCCAAGAAGTCTGTGGTGGTAAAGAAA
AAAAAGTTCAAGCTGGACAAAGACAATGGGGTGACTCCTGGAGAGAAGATGCTCACAGTCCCCCATATCACGTGCGACCCCCCAGAAGAG
CGGCGGCTGGACCACTTCTCTGTCGACGGCTATGACAGTTCTGTAAGGAAGAGCCCAACACTGCTGGAAGTGAGCATGCCCCATTTCATG
AGAACCAACAGCTTCGCCGAGGACCTGGACCTGGAAGGGGAGACTCTGCTGACACCCATCACCCACATCTCACAGCTGCGGGAACACCAT
CGGGCCACCATTAAGGTCATTCGACGCATGCAGTACTTTGTGGCCAAGAAGAAATTCCAGCAAGCGCGGAAGCCTTACGATGTGCGGGAC
GTCATTGAGCAGTACTCGCAGGGCCACCTCAACCTCATGGTGCGCATCAAGGAGCTGCAGAGGAGGCTGGACCAGTCCATTGGGAAGCCC
TCACTGTTCATCTCCGTCTCAGAAAAGAGCAAGGATCGCGGCAGCAACACGATCGGCGCCCGCCTGAACCGAGTAGAAGACAAGATCCGA
AATGTGGCAGCAAATCTCTGTGTGGACAGCAAGCATGGAGCCACCGGAACAGAGCTGAGGCTGGACATCTGTGTCAAGGATGGTTCTGAA
AGAACATGGTCTCATGAACAGCTTTTTACCTTTGGATGGAGAGAAGATATTCGACCCGGTGAGCCACTGCATACCCGGAAATTCTGCTTT
GATGCGATCTCACACAACAGCCCCGTTACACTCTATGACTGTCATGGCATGAAGGGGAACCAGCTCTGGGGATACCGGAAGGACAGAACA
TTATTCCATCCTGTGAGCAACAGCTGCATGGATTGCAACCCCGCAGAGAAGAAGATTTTCATGGCCAGATGTGACCCTCTCTCTGAGACT

>In-frame_KCNQ1_ENST00000155840_chr11_2799267_+_GALNTL6_ENST00000508122_chr4_173930329_+_2229nt
ATGGCCGCGGCCTCCTCCCCGCCCAGGGCCGAGAGGAAGCGCTGGGGTTGGGGCCGCCTGCCAGGCGCCCGGCGGGGCAGCGCGGGCCTG
GCCAAGAAGTGCCCCTTCTCGCTGGAGCTGGCGGAGGGCGGCCCGGCGGGCGGCGCGCTCTACGCGCCCATCGCGCCCGGCGCCCCAGGT
CCCGCGCCCCCTGCGTCCCCGGCCGCGCCCGCCGCGCCCCCAGTTGCCTCCGACCTTGGCCCGCGGCCGCCGGTGAGCCTAGACCCGCGC
GTCTCCATCTACAGCACGCGCCGCCCGGTGTTGGCGCGCACCCACGTCCAGGGCCGCGTCTACAACTTCCTCGAGCGTCCCACCGGCTGG
AAATGCTTCGTTTACCACTTCGCCGTCTTCCTCATCGTCCTGGTCTGCCTCATCTTCAGCGTGCTGTCCACCATCGAGCAGTATGCCGCC
CTGGCCACGGGGACTCTCTTCTGGATGGAGATCGTGCTGGTGGTGTTCTTCGGGACGGAGTACGTGGTCCGCCTCTGGTCCGCCGGCTGC
CGCAGCAAGTACGTGGGCCTCTGGGGGCGGCTGCGCTTTGCCCGGAAGCCCATTTCCATCATCGACCTCATCGTGGTCGTGGCCTCCATG
GTGGTCCTCTGCGTGGGCTCCAAGGGGCAGGTGTTTGCCACGTCGGCCATCAGGGGCATCCGCTTCCTGCAGATCCTGAGGATGCTACAC
GTCGACCGCCAGGGAGGCACCTGGAGGCTCCTGGGCTCCGTGGTCTTCATCCACCGCCAGGAGCTGATAACCACCCTGTACATCGGCTTC
CTGGGCCTCATCTTCTCCTCGTACTTTGTGTACCTGGCTGAGAAGGACGCGGTGAACGAGTCAGGCCGCGTGGAGTTCGGCAGCTACGCA
GATGCGCTGTGGTGGGGGGTGGTCACAGTCACCACCATCGGCTATGGGGACAAGGTGCCCCAGACGTGGGTCGGGAAGACCATCGCCTCC
TGCTTCTCTGTCTTTGCCATCTCCTTCTTTGCGCTCCCAGCGGGGATTCTTGGCTCGGGGTTTGCCCTGAAGGTGCAGCAGAAGCAGAGG
CAGAAGCACTTCAACCGGCAGATCCCGGCGGCAGCCTCACTCATTCAGACCGCATGGAGGTGCTATGCTGCCGAGAACCCCGACTCCTCC
ACCTGGAAGATCTACATCCGGAAGGCCCCCCGGAGCCACACTCTGCTGTCACCCAGCCCCAAACCCAAGAAGTCTGTGGTGGTAAAGAAA
AAAAAGTTCAAGCTGGACAAAGACAATGGGGTGACTCCTGGAGAGAAGATGCTCACAGTCCCCCATATCACGTGCGACCCCCCAGAAGAG
CGGCGGCTGGACCACTTCTCTGTCGACGGCTATGACAGTTCTGTAAGGAAGAGCCCAACACTGCTGGAAGTGAGCATGCCCCATTTCATG
AGAACCAACAGCTTCGCCGAGGACCTGGACCTGGAAGGGGAGACTCTGCTGACACCCATCACCCACATCTCACAGCTGCGGGAACACCAT
CGGGCCACCATTAAGGTCATTCGACGCATGCAGTACTTTGTGGCCAAGAAGAAATTCCAGCAAGCGCGGAAGCCTTACGATGTGCGGGAC
GTCATTGAGCAGTACTCGCAGGGCCACCTCAACCTCATGGTGCGCATCAAGGAGCTGCAGAGGAGGCTGGACCAGTCCATTGGGAAGCCC
TCACTGTTCATCTCCGTCTCAGAAAAGAGCAAGGATCGCGGCAGCAACACGATCGGCGCCCGCCTGAACCGAGTAGAAGACAAGATCCGA
AATGTGGCAGCAAATCTCTGTGTGGACAGCAAGCATGGAGCCACCGGAACAGAGCTGAGGCTGGACATCTGTGTCAAGGATGGTTCTGAA
AGAACATGGTCTCATGAACAGCTTTTTACCTTTGGATGGAGAGAAGATATTCGACCCGGTGAGCCACTGCATACCCGGAAATTCTGCTTT
GATGCGATCTCACACAACAGCCCCGTTACACTCTATGACTGTCATGGCATGAAGGGGAACCAGCTCTGGGGATACCGGAAGGACAGAACA
TTATTCCATCCTGTGAGCAACAGCTGCATGGATTGCAACCCCGCAGAGAAGAAGATTTTCATGGCCAGATGTGACCCTCTCTCTGAGACT

>In-frame_KCNQ1_ENST00000335475_chr11_2799267_+_GALNTL6_ENST00000506823_chr4_173930329_+_1848nt
ATGGACTTCCTCATCGTCCTGGTCTGCCTCATCTTCAGCGTGCTGTCCACCATCGAGCAGTATGCCGCCCTGGCCACGGGGACTCTCTTC
TGGATGGAGATCGTGCTGGTGGTGTTCTTCGGGACGGAGTACGTGGTCCGCCTCTGGTCCGCCGGCTGCCGCAGCAAGTACGTGGGCCTC
TGGGGGCGGCTGCGCTTTGCCCGGAAGCCCATTTCCATCATCGACCTCATCGTGGTCGTGGCCTCCATGGTGGTCCTCTGCGTGGGCTCC
AAGGGGCAGGTGTTTGCCACGTCGGCCATCAGGGGCATCCGCTTCCTGCAGATCCTGAGGATGCTACACGTCGACCGCCAGGGAGGCACC
TGGAGGCTCCTGGGCTCCGTGGTCTTCATCCACCGCCAGGAGCTGATAACCACCCTGTACATCGGCTTCCTGGGCCTCATCTTCTCCTCG
TACTTTGTGTACCTGGCTGAGAAGGACGCGGTGAACGAGTCAGGCCGCGTGGAGTTCGGCAGCTACGCAGATGCGCTGTGGTGGGGGGTG
GTCACAGTCACCACCATCGGCTATGGGGACAAGGTGCCCCAGACGTGGGTCGGGAAGACCATCGCCTCCTGCTTCTCTGTCTTTGCCATC
TCCTTCTTTGCGCTCCCAGCGGGGATTCTTGGCTCGGGGTTTGCCCTGAAGGTGCAGCAGAAGCAGAGGCAGAAGCACTTCAACCGGCAG
ATCCCGGCGGCAGCCTCACTCATTCAGACCGCATGGAGGTGCTATGCTGCCGAGAACCCCGACTCCTCCACCTGGAAGATCTACATCCGG
AAGGCCCCCCGGAGCCACACTCTGCTGTCACCCAGCCCCAAACCCAAGAAGTCTGTGGTGGTAAAGAAAAAAAAGTTCAAGCTGGACAAA
GACAATGGGGTGACTCCTGGAGAGAAGATGCTCACAGTCCCCCATATCACGTGCGACCCCCCAGAAGAGCGGCGGCTGGACCACTTCTCT
GTCGACGGCTATGACAGTTCTGTAAGGAAGAGCCCAACACTGCTGGAAGTGAGCATGCCCCATTTCATGAGAACCAACAGCTTCGCCGAG
GACCTGGACCTGGAAGGGGAGACTCTGCTGACACCCATCACCCACATCTCACAGCTGCGGGAACACCATCGGGCCACCATTAAGGTCATT
CGACGCATGCAGTACTTTGTGGCCAAGAAGAAATTCCAGCAAGCGCGGAAGCCTTACGATGTGCGGGACGTCATTGAGCAGTACTCGCAG
GGCCACCTCAACCTCATGGTGCGCATCAAGGAGCTGCAGAGGAGGCTGGACCAGTCCATTGGGAAGCCCTCACTGTTCATCTCCGTCTCA
GAAAAGAGCAAGGATCGCGGCAGCAACACGATCGGCGCCCGCCTGAACCGAGTAGAAGACAAGATCCGAAATGTGGCAGCAAATCTCTGT
GTGGACAGCAAGCATGGAGCCACCGGAACAGAGCTGAGGCTGGACATCTGTGTCAAGGATGGTTCTGAAAGAACATGGTCTCATGAACAG
CTTTTTACCTTTGGATGGAGAGAAGATATTCGACCCGGTGAGCCACTGCATACCCGGAAATTCTGCTTTGATGCGATCTCACACAACAGC
CCCGTTACACTCTATGACTGTCATGGCATGAAGGGGAACCAGCTCTGGGGATACCGGAAGGACAGAACATTATTCCATCCTGTGAGCAAC
AGCTGCATGGATTGCAACCCCGCAGAGAAGAAGATTTTCATGGCCAGATGTGACCCTCTCTCTGAGACTCAGCAGTGGATTTTTGAACAC

>In-frame_KCNQ1_ENST00000335475_chr11_2799267_+_GALNTL6_ENST00000508122_chr4_173930329_+_1848nt
ATGGACTTCCTCATCGTCCTGGTCTGCCTCATCTTCAGCGTGCTGTCCACCATCGAGCAGTATGCCGCCCTGGCCACGGGGACTCTCTTC
TGGATGGAGATCGTGCTGGTGGTGTTCTTCGGGACGGAGTACGTGGTCCGCCTCTGGTCCGCCGGCTGCCGCAGCAAGTACGTGGGCCTC
TGGGGGCGGCTGCGCTTTGCCCGGAAGCCCATTTCCATCATCGACCTCATCGTGGTCGTGGCCTCCATGGTGGTCCTCTGCGTGGGCTCC
AAGGGGCAGGTGTTTGCCACGTCGGCCATCAGGGGCATCCGCTTCCTGCAGATCCTGAGGATGCTACACGTCGACCGCCAGGGAGGCACC
TGGAGGCTCCTGGGCTCCGTGGTCTTCATCCACCGCCAGGAGCTGATAACCACCCTGTACATCGGCTTCCTGGGCCTCATCTTCTCCTCG
TACTTTGTGTACCTGGCTGAGAAGGACGCGGTGAACGAGTCAGGCCGCGTGGAGTTCGGCAGCTACGCAGATGCGCTGTGGTGGGGGGTG
GTCACAGTCACCACCATCGGCTATGGGGACAAGGTGCCCCAGACGTGGGTCGGGAAGACCATCGCCTCCTGCTTCTCTGTCTTTGCCATC
TCCTTCTTTGCGCTCCCAGCGGGGATTCTTGGCTCGGGGTTTGCCCTGAAGGTGCAGCAGAAGCAGAGGCAGAAGCACTTCAACCGGCAG
ATCCCGGCGGCAGCCTCACTCATTCAGACCGCATGGAGGTGCTATGCTGCCGAGAACCCCGACTCCTCCACCTGGAAGATCTACATCCGG
AAGGCCCCCCGGAGCCACACTCTGCTGTCACCCAGCCCCAAACCCAAGAAGTCTGTGGTGGTAAAGAAAAAAAAGTTCAAGCTGGACAAA
GACAATGGGGTGACTCCTGGAGAGAAGATGCTCACAGTCCCCCATATCACGTGCGACCCCCCAGAAGAGCGGCGGCTGGACCACTTCTCT
GTCGACGGCTATGACAGTTCTGTAAGGAAGAGCCCAACACTGCTGGAAGTGAGCATGCCCCATTTCATGAGAACCAACAGCTTCGCCGAG
GACCTGGACCTGGAAGGGGAGACTCTGCTGACACCCATCACCCACATCTCACAGCTGCGGGAACACCATCGGGCCACCATTAAGGTCATT
CGACGCATGCAGTACTTTGTGGCCAAGAAGAAATTCCAGCAAGCGCGGAAGCCTTACGATGTGCGGGACGTCATTGAGCAGTACTCGCAG
GGCCACCTCAACCTCATGGTGCGCATCAAGGAGCTGCAGAGGAGGCTGGACCAGTCCATTGGGAAGCCCTCACTGTTCATCTCCGTCTCA
GAAAAGAGCAAGGATCGCGGCAGCAACACGATCGGCGCCCGCCTGAACCGAGTAGAAGACAAGATCCGAAATGTGGCAGCAAATCTCTGT
GTGGACAGCAAGCATGGAGCCACCGGAACAGAGCTGAGGCTGGACATCTGTGTCAAGGATGGTTCTGAAAGAACATGGTCTCATGAACAG
CTTTTTACCTTTGGATGGAGAGAAGATATTCGACCCGGTGAGCCACTGCATACCCGGAAATTCTGCTTTGATGCGATCTCACACAACAGC
CCCGTTACACTCTATGACTGTCATGGCATGAAGGGGAACCAGCTCTGGGGATACCGGAAGGACAGAACATTATTCCATCCTGTGAGCAAC
AGCTGCATGGATTGCAACCCCGCAGAGAAGAAGATTTTCATGGCCAGATGTGACCCTCTCTCTGAGACTCAGCAGTGGATTTTTGAACAC


* Fusion transcript sequences (Full-length transcript).
>In-frame_KCNQ1_ENST00000155840_chr11_2799267_+_GALNTL6_ENST00000506823_chr4_173930329_+_3796nt
GCGGCGGGGCTGGCAGCAGTGGCTGCCCGCACTGCGCCCGGGCGCTCGCCTTCGCTGCAGCTCCCGGTGCCGCCGCTCGGGCCGGCCCCC
CGGCAGGCCCTCCTCGTTATGGCCGCGGCCTCCTCCCCGCCCAGGGCCGAGAGGAAGCGCTGGGGTTGGGGCCGCCTGCCAGGCGCCCGG
CGGGGCAGCGCGGGCCTGGCCAAGAAGTGCCCCTTCTCGCTGGAGCTGGCGGAGGGCGGCCCGGCGGGCGGCGCGCTCTACGCGCCCATC
GCGCCCGGCGCCCCAGGTCCCGCGCCCCCTGCGTCCCCGGCCGCGCCCGCCGCGCCCCCAGTTGCCTCCGACCTTGGCCCGCGGCCGCCG
GTGAGCCTAGACCCGCGCGTCTCCATCTACAGCACGCGCCGCCCGGTGTTGGCGCGCACCCACGTCCAGGGCCGCGTCTACAACTTCCTC
GAGCGTCCCACCGGCTGGAAATGCTTCGTTTACCACTTCGCCGTCTTCCTCATCGTCCTGGTCTGCCTCATCTTCAGCGTGCTGTCCACC
ATCGAGCAGTATGCCGCCCTGGCCACGGGGACTCTCTTCTGGATGGAGATCGTGCTGGTGGTGTTCTTCGGGACGGAGTACGTGGTCCGC
CTCTGGTCCGCCGGCTGCCGCAGCAAGTACGTGGGCCTCTGGGGGCGGCTGCGCTTTGCCCGGAAGCCCATTTCCATCATCGACCTCATC
GTGGTCGTGGCCTCCATGGTGGTCCTCTGCGTGGGCTCCAAGGGGCAGGTGTTTGCCACGTCGGCCATCAGGGGCATCCGCTTCCTGCAG
ATCCTGAGGATGCTACACGTCGACCGCCAGGGAGGCACCTGGAGGCTCCTGGGCTCCGTGGTCTTCATCCACCGCCAGGAGCTGATAACC
ACCCTGTACATCGGCTTCCTGGGCCTCATCTTCTCCTCGTACTTTGTGTACCTGGCTGAGAAGGACGCGGTGAACGAGTCAGGCCGCGTG
GAGTTCGGCAGCTACGCAGATGCGCTGTGGTGGGGGGTGGTCACAGTCACCACCATCGGCTATGGGGACAAGGTGCCCCAGACGTGGGTC
GGGAAGACCATCGCCTCCTGCTTCTCTGTCTTTGCCATCTCCTTCTTTGCGCTCCCAGCGGGGATTCTTGGCTCGGGGTTTGCCCTGAAG
GTGCAGCAGAAGCAGAGGCAGAAGCACTTCAACCGGCAGATCCCGGCGGCAGCCTCACTCATTCAGACCGCATGGAGGTGCTATGCTGCC
GAGAACCCCGACTCCTCCACCTGGAAGATCTACATCCGGAAGGCCCCCCGGAGCCACACTCTGCTGTCACCCAGCCCCAAACCCAAGAAG
TCTGTGGTGGTAAAGAAAAAAAAGTTCAAGCTGGACAAAGACAATGGGGTGACTCCTGGAGAGAAGATGCTCACAGTCCCCCATATCACG
TGCGACCCCCCAGAAGAGCGGCGGCTGGACCACTTCTCTGTCGACGGCTATGACAGTTCTGTAAGGAAGAGCCCAACACTGCTGGAAGTG
AGCATGCCCCATTTCATGAGAACCAACAGCTTCGCCGAGGACCTGGACCTGGAAGGGGAGACTCTGCTGACACCCATCACCCACATCTCA
CAGCTGCGGGAACACCATCGGGCCACCATTAAGGTCATTCGACGCATGCAGTACTTTGTGGCCAAGAAGAAATTCCAGCAAGCGCGGAAG
CCTTACGATGTGCGGGACGTCATTGAGCAGTACTCGCAGGGCCACCTCAACCTCATGGTGCGCATCAAGGAGCTGCAGAGGAGGCTGGAC
CAGTCCATTGGGAAGCCCTCACTGTTCATCTCCGTCTCAGAAAAGAGCAAGGATCGCGGCAGCAACACGATCGGCGCCCGCCTGAACCGA
GTAGAAGACAAGATCCGAAATGTGGCAGCAAATCTCTGTGTGGACAGCAAGCATGGAGCCACCGGAACAGAGCTGAGGCTGGACATCTGT
GTCAAGGATGGTTCTGAAAGAACATGGTCTCATGAACAGCTTTTTACCTTTGGATGGAGAGAAGATATTCGACCCGGTGAGCCACTGCAT
ACCCGGAAATTCTGCTTTGATGCGATCTCACACAACAGCCCCGTTACACTCTATGACTGTCATGGCATGAAGGGGAACCAGCTCTGGGGA
TACCGGAAGGACAGAACATTATTCCATCCTGTGAGCAACAGCTGCATGGATTGCAACCCCGCAGAGAAGAAGATTTTCATGGCCAGATGT
GACCCTCTCTCTGAGACTCAGCAGTGGATTTTTGAACACATTAATATGACTGTTTTAGAAAAATTTAACCACCATGCCAACTCCTAGAAA
GAAGAAAGGAAGAAAGAGTGATTACCTACAGGTTATAAATTAAATTTTAGCCAGCATCTGGGTCGAAGGAGTCAGGAATAACATTTCCTC
GATCCAGGAAGGCTGGTTTAAAAATTTGCAAATGCCATGTCAAAGTAGGTTGTTTTGAAGAACTTCCTGCATCTGAAGAACTTGGCTGAG
AATCTCACCAGCTGCTTCTGAGAACTCGAGACTAGCAGTTCCCTTGCTGGCCAAGGGCAAAGATAATTTAGGGACTTTTCAAAACAACTG
CTGAGCTAATAAATCCTAGCATTTCTCAGGTCAAATCCTGCAGTAGTGAGTAGCTATGAATGGATCCTATTAACTGGGTGGGAGGGGGGT
GAAAATGGAGTGCATGACTGCTCTGACAACCTGAGGATATCACAGGTTTAGAACTAGCCAAGCTTAAGGGGTGAGCTGTACTCTTTGGTG
CCATTCTCTGACTAAGAATGGGTTCAGCAGGTTTAACCCTTAAAAGTGCTGCAGATGATTTCAGAGTGCTCACACTATTCTGTTTTTTTT
ATTTTTATTTTTAAATGAGGGTGCAATATCTAATGTAAGACTTAAATTACATAATGAAATGGACATCCAGTGTTCCCATTCTTTCGTTTA
TATTTGCCATTTTTTTTTCAGAGCAAAGTTTCTTTTTTATGAAAGTTCATGCTCCATGAATCCACTGAATTTCTAATTCAGTGCCCTTCT
ATGAATCCAGTTAAAAACAAAAGCAAAAGCAAAAATCTATGCTATCAAGTTACTCCAAAGAAAGATTTCACAGAAGCAGCAAAACCATAT
AAGATTTAGGAGAGGGACTTCCCTGGGAAATCTATTTTTACTTTTCTATTATTTTTAAAATCTTAAAAGTCTGATATTTGTCCAGTCATA
ATTTTTATTAAGCAAGGAAATGGAGTGAGTTTGATGTAATTTGTTTAGGAGATTCTTAAACCCAAATAAATCTACACTCCAAGTGATATG
TGAAAATGGCTTAGTTCACTTCAATTCTGTTTAGTCAGTGGTGGGAGCTTAGAAGTGGTTTTATTTGTTCGTTTGTTTGGGTTTTGCTTT
TGTTTTTTATTTTTTTCTTGTTTTTTTTTTGTAGTGTTGAATTAATGATGTTCTTTTATTTGGAAGCTCATAAAAGGAATTACCATTAAT
AAAGTGTTTCTGACACCATTTTCTGTTAATGGGACAATATTTCGGGGATGAAGAAAGGAATGCTCCGAAAACTAAATGGAACACTTAATC
CTTAAAGCAATTTTTTACTGTTCAATAATATCACATTGGGGGAAGAAAACACAGGTATCAAGGTGGTTCTTGGGAAAAAAGAATCATGTT
TATTATATATCTCTCAAGTTTTTTTGGTATAAAAATGTTTTAACTTTGCTTTCTTTTTGGTTTTTGTTTGAAGTTGGTTTTCCTGTTAAT

>In-frame_KCNQ1_ENST00000155840_chr11_2799267_+_GALNTL6_ENST00000508122_chr4_173930329_+_2337nt
GCGGCGGGGCTGGCAGCAGTGGCTGCCCGCACTGCGCCCGGGCGCTCGCCTTCGCTGCAGCTCCCGGTGCCGCCGCTCGGGCCGGCCCCC
CGGCAGGCCCTCCTCGTTATGGCCGCGGCCTCCTCCCCGCCCAGGGCCGAGAGGAAGCGCTGGGGTTGGGGCCGCCTGCCAGGCGCCCGG
CGGGGCAGCGCGGGCCTGGCCAAGAAGTGCCCCTTCTCGCTGGAGCTGGCGGAGGGCGGCCCGGCGGGCGGCGCGCTCTACGCGCCCATC
GCGCCCGGCGCCCCAGGTCCCGCGCCCCCTGCGTCCCCGGCCGCGCCCGCCGCGCCCCCAGTTGCCTCCGACCTTGGCCCGCGGCCGCCG
GTGAGCCTAGACCCGCGCGTCTCCATCTACAGCACGCGCCGCCCGGTGTTGGCGCGCACCCACGTCCAGGGCCGCGTCTACAACTTCCTC
GAGCGTCCCACCGGCTGGAAATGCTTCGTTTACCACTTCGCCGTCTTCCTCATCGTCCTGGTCTGCCTCATCTTCAGCGTGCTGTCCACC
ATCGAGCAGTATGCCGCCCTGGCCACGGGGACTCTCTTCTGGATGGAGATCGTGCTGGTGGTGTTCTTCGGGACGGAGTACGTGGTCCGC
CTCTGGTCCGCCGGCTGCCGCAGCAAGTACGTGGGCCTCTGGGGGCGGCTGCGCTTTGCCCGGAAGCCCATTTCCATCATCGACCTCATC
GTGGTCGTGGCCTCCATGGTGGTCCTCTGCGTGGGCTCCAAGGGGCAGGTGTTTGCCACGTCGGCCATCAGGGGCATCCGCTTCCTGCAG
ATCCTGAGGATGCTACACGTCGACCGCCAGGGAGGCACCTGGAGGCTCCTGGGCTCCGTGGTCTTCATCCACCGCCAGGAGCTGATAACC
ACCCTGTACATCGGCTTCCTGGGCCTCATCTTCTCCTCGTACTTTGTGTACCTGGCTGAGAAGGACGCGGTGAACGAGTCAGGCCGCGTG
GAGTTCGGCAGCTACGCAGATGCGCTGTGGTGGGGGGTGGTCACAGTCACCACCATCGGCTATGGGGACAAGGTGCCCCAGACGTGGGTC
GGGAAGACCATCGCCTCCTGCTTCTCTGTCTTTGCCATCTCCTTCTTTGCGCTCCCAGCGGGGATTCTTGGCTCGGGGTTTGCCCTGAAG
GTGCAGCAGAAGCAGAGGCAGAAGCACTTCAACCGGCAGATCCCGGCGGCAGCCTCACTCATTCAGACCGCATGGAGGTGCTATGCTGCC
GAGAACCCCGACTCCTCCACCTGGAAGATCTACATCCGGAAGGCCCCCCGGAGCCACACTCTGCTGTCACCCAGCCCCAAACCCAAGAAG
TCTGTGGTGGTAAAGAAAAAAAAGTTCAAGCTGGACAAAGACAATGGGGTGACTCCTGGAGAGAAGATGCTCACAGTCCCCCATATCACG
TGCGACCCCCCAGAAGAGCGGCGGCTGGACCACTTCTCTGTCGACGGCTATGACAGTTCTGTAAGGAAGAGCCCAACACTGCTGGAAGTG
AGCATGCCCCATTTCATGAGAACCAACAGCTTCGCCGAGGACCTGGACCTGGAAGGGGAGACTCTGCTGACACCCATCACCCACATCTCA
CAGCTGCGGGAACACCATCGGGCCACCATTAAGGTCATTCGACGCATGCAGTACTTTGTGGCCAAGAAGAAATTCCAGCAAGCGCGGAAG
CCTTACGATGTGCGGGACGTCATTGAGCAGTACTCGCAGGGCCACCTCAACCTCATGGTGCGCATCAAGGAGCTGCAGAGGAGGCTGGAC
CAGTCCATTGGGAAGCCCTCACTGTTCATCTCCGTCTCAGAAAAGAGCAAGGATCGCGGCAGCAACACGATCGGCGCCCGCCTGAACCGA
GTAGAAGACAAGATCCGAAATGTGGCAGCAAATCTCTGTGTGGACAGCAAGCATGGAGCCACCGGAACAGAGCTGAGGCTGGACATCTGT
GTCAAGGATGGTTCTGAAAGAACATGGTCTCATGAACAGCTTTTTACCTTTGGATGGAGAGAAGATATTCGACCCGGTGAGCCACTGCAT
ACCCGGAAATTCTGCTTTGATGCGATCTCACACAACAGCCCCGTTACACTCTATGACTGTCATGGCATGAAGGGGAACCAGCTCTGGGGA
TACCGGAAGGACAGAACATTATTCCATCCTGTGAGCAACAGCTGCATGGATTGCAACCCCGCAGAGAAGAAGATTTTCATGGCCAGATGT

>In-frame_KCNQ1_ENST00000335475_chr11_2799267_+_GALNTL6_ENST00000506823_chr4_173930329_+_3581nt
CTCTTCCCTTCCTCCCCTGCAGCTTCCATGGCCTGGGGCTGTGAGAGGCCCGGGAAGGCACTGTCTTTGCGCCTGCACATGTGTGTGTCT
GGAGTGTAGGATGGCACTGGTGCCGGGCCTGGATTTACTCAGCCCAGATCACGGCTGCTTTTGTTTACGTGGCCCCTGCTCTCACCCACA
ACTCCAGGTTTCTGGCTCTCGGGAATTTGAGGCCTGTGGCTGCTGTGGACCCTGGGAAAGAGCCTGTGCTTCCTGAGCCAGTGCGGGGCC
TGGCATGGACTTCCTCATCGTCCTGGTCTGCCTCATCTTCAGCGTGCTGTCCACCATCGAGCAGTATGCCGCCCTGGCCACGGGGACTCT
CTTCTGGATGGAGATCGTGCTGGTGGTGTTCTTCGGGACGGAGTACGTGGTCCGCCTCTGGTCCGCCGGCTGCCGCAGCAAGTACGTGGG
CCTCTGGGGGCGGCTGCGCTTTGCCCGGAAGCCCATTTCCATCATCGACCTCATCGTGGTCGTGGCCTCCATGGTGGTCCTCTGCGTGGG
CTCCAAGGGGCAGGTGTTTGCCACGTCGGCCATCAGGGGCATCCGCTTCCTGCAGATCCTGAGGATGCTACACGTCGACCGCCAGGGAGG
CACCTGGAGGCTCCTGGGCTCCGTGGTCTTCATCCACCGCCAGGAGCTGATAACCACCCTGTACATCGGCTTCCTGGGCCTCATCTTCTC
CTCGTACTTTGTGTACCTGGCTGAGAAGGACGCGGTGAACGAGTCAGGCCGCGTGGAGTTCGGCAGCTACGCAGATGCGCTGTGGTGGGG
GGTGGTCACAGTCACCACCATCGGCTATGGGGACAAGGTGCCCCAGACGTGGGTCGGGAAGACCATCGCCTCCTGCTTCTCTGTCTTTGC
CATCTCCTTCTTTGCGCTCCCAGCGGGGATTCTTGGCTCGGGGTTTGCCCTGAAGGTGCAGCAGAAGCAGAGGCAGAAGCACTTCAACCG
GCAGATCCCGGCGGCAGCCTCACTCATTCAGACCGCATGGAGGTGCTATGCTGCCGAGAACCCCGACTCCTCCACCTGGAAGATCTACAT
CCGGAAGGCCCCCCGGAGCCACACTCTGCTGTCACCCAGCCCCAAACCCAAGAAGTCTGTGGTGGTAAAGAAAAAAAAGTTCAAGCTGGA
CAAAGACAATGGGGTGACTCCTGGAGAGAAGATGCTCACAGTCCCCCATATCACGTGCGACCCCCCAGAAGAGCGGCGGCTGGACCACTT
CTCTGTCGACGGCTATGACAGTTCTGTAAGGAAGAGCCCAACACTGCTGGAAGTGAGCATGCCCCATTTCATGAGAACCAACAGCTTCGC
CGAGGACCTGGACCTGGAAGGGGAGACTCTGCTGACACCCATCACCCACATCTCACAGCTGCGGGAACACCATCGGGCCACCATTAAGGT
CATTCGACGCATGCAGTACTTTGTGGCCAAGAAGAAATTCCAGCAAGCGCGGAAGCCTTACGATGTGCGGGACGTCATTGAGCAGTACTC
GCAGGGCCACCTCAACCTCATGGTGCGCATCAAGGAGCTGCAGAGGAGGCTGGACCAGTCCATTGGGAAGCCCTCACTGTTCATCTCCGT
CTCAGAAAAGAGCAAGGATCGCGGCAGCAACACGATCGGCGCCCGCCTGAACCGAGTAGAAGACAAGATCCGAAATGTGGCAGCAAATCT
CTGTGTGGACAGCAAGCATGGAGCCACCGGAACAGAGCTGAGGCTGGACATCTGTGTCAAGGATGGTTCTGAAAGAACATGGTCTCATGA
ACAGCTTTTTACCTTTGGATGGAGAGAAGATATTCGACCCGGTGAGCCACTGCATACCCGGAAATTCTGCTTTGATGCGATCTCACACAA
CAGCCCCGTTACACTCTATGACTGTCATGGCATGAAGGGGAACCAGCTCTGGGGATACCGGAAGGACAGAACATTATTCCATCCTGTGAG
CAACAGCTGCATGGATTGCAACCCCGCAGAGAAGAAGATTTTCATGGCCAGATGTGACCCTCTCTCTGAGACTCAGCAGTGGATTTTTGA
ACACATTAATATGACTGTTTTAGAAAAATTTAACCACCATGCCAACTCCTAGAAAGAAGAAAGGAAGAAAGAGTGATTACCTACAGGTTA
TAAATTAAATTTTAGCCAGCATCTGGGTCGAAGGAGTCAGGAATAACATTTCCTCGATCCAGGAAGGCTGGTTTAAAAATTTGCAAATGC
CATGTCAAAGTAGGTTGTTTTGAAGAACTTCCTGCATCTGAAGAACTTGGCTGAGAATCTCACCAGCTGCTTCTGAGAACTCGAGACTAG
CAGTTCCCTTGCTGGCCAAGGGCAAAGATAATTTAGGGACTTTTCAAAACAACTGCTGAGCTAATAAATCCTAGCATTTCTCAGGTCAAA
TCCTGCAGTAGTGAGTAGCTATGAATGGATCCTATTAACTGGGTGGGAGGGGGGTGAAAATGGAGTGCATGACTGCTCTGACAACCTGAG
GATATCACAGGTTTAGAACTAGCCAAGCTTAAGGGGTGAGCTGTACTCTTTGGTGCCATTCTCTGACTAAGAATGGGTTCAGCAGGTTTA
ACCCTTAAAAGTGCTGCAGATGATTTCAGAGTGCTCACACTATTCTGTTTTTTTTATTTTTATTTTTAAATGAGGGTGCAATATCTAATG
TAAGACTTAAATTACATAATGAAATGGACATCCAGTGTTCCCATTCTTTCGTTTATATTTGCCATTTTTTTTTCAGAGCAAAGTTTCTTT
TTTATGAAAGTTCATGCTCCATGAATCCACTGAATTTCTAATTCAGTGCCCTTCTATGAATCCAGTTAAAAACAAAAGCAAAAGCAAAAA
TCTATGCTATCAAGTTACTCCAAAGAAAGATTTCACAGAAGCAGCAAAACCATATAAGATTTAGGAGAGGGACTTCCCTGGGAAATCTAT
TTTTACTTTTCTATTATTTTTAAAATCTTAAAAGTCTGATATTTGTCCAGTCATAATTTTTATTAAGCAAGGAAATGGAGTGAGTTTGAT
GTAATTTGTTTAGGAGATTCTTAAACCCAAATAAATCTACACTCCAAGTGATATGTGAAAATGGCTTAGTTCACTTCAATTCTGTTTAGT
CAGTGGTGGGAGCTTAGAAGTGGTTTTATTTGTTCGTTTGTTTGGGTTTTGCTTTTGTTTTTTATTTTTTTCTTGTTTTTTTTTTGTAGT
GTTGAATTAATGATGTTCTTTTATTTGGAAGCTCATAAAAGGAATTACCATTAATAAAGTGTTTCTGACACCATTTTCTGTTAATGGGAC
AATATTTCGGGGATGAAGAAAGGAATGCTCCGAAAACTAAATGGAACACTTAATCCTTAAAGCAATTTTTTACTGTTCAATAATATCACA
TTGGGGGAAGAAAACACAGGTATCAAGGTGGTTCTTGGGAAAAAAGAATCATGTTTATTATATATCTCTCAAGTTTTTTTGGTATAAAAA

>In-frame_KCNQ1_ENST00000335475_chr11_2799267_+_GALNTL6_ENST00000508122_chr4_173930329_+_2122nt
CTCTTCCCTTCCTCCCCTGCAGCTTCCATGGCCTGGGGCTGTGAGAGGCCCGGGAAGGCACTGTCTTTGCGCCTGCACATGTGTGTGTCT
GGAGTGTAGGATGGCACTGGTGCCGGGCCTGGATTTACTCAGCCCAGATCACGGCTGCTTTTGTTTACGTGGCCCCTGCTCTCACCCACA
ACTCCAGGTTTCTGGCTCTCGGGAATTTGAGGCCTGTGGCTGCTGTGGACCCTGGGAAAGAGCCTGTGCTTCCTGAGCCAGTGCGGGGCC
TGGCATGGACTTCCTCATCGTCCTGGTCTGCCTCATCTTCAGCGTGCTGTCCACCATCGAGCAGTATGCCGCCCTGGCCACGGGGACTCT
CTTCTGGATGGAGATCGTGCTGGTGGTGTTCTTCGGGACGGAGTACGTGGTCCGCCTCTGGTCCGCCGGCTGCCGCAGCAAGTACGTGGG
CCTCTGGGGGCGGCTGCGCTTTGCCCGGAAGCCCATTTCCATCATCGACCTCATCGTGGTCGTGGCCTCCATGGTGGTCCTCTGCGTGGG
CTCCAAGGGGCAGGTGTTTGCCACGTCGGCCATCAGGGGCATCCGCTTCCTGCAGATCCTGAGGATGCTACACGTCGACCGCCAGGGAGG
CACCTGGAGGCTCCTGGGCTCCGTGGTCTTCATCCACCGCCAGGAGCTGATAACCACCCTGTACATCGGCTTCCTGGGCCTCATCTTCTC
CTCGTACTTTGTGTACCTGGCTGAGAAGGACGCGGTGAACGAGTCAGGCCGCGTGGAGTTCGGCAGCTACGCAGATGCGCTGTGGTGGGG
GGTGGTCACAGTCACCACCATCGGCTATGGGGACAAGGTGCCCCAGACGTGGGTCGGGAAGACCATCGCCTCCTGCTTCTCTGTCTTTGC
CATCTCCTTCTTTGCGCTCCCAGCGGGGATTCTTGGCTCGGGGTTTGCCCTGAAGGTGCAGCAGAAGCAGAGGCAGAAGCACTTCAACCG
GCAGATCCCGGCGGCAGCCTCACTCATTCAGACCGCATGGAGGTGCTATGCTGCCGAGAACCCCGACTCCTCCACCTGGAAGATCTACAT
CCGGAAGGCCCCCCGGAGCCACACTCTGCTGTCACCCAGCCCCAAACCCAAGAAGTCTGTGGTGGTAAAGAAAAAAAAGTTCAAGCTGGA
CAAAGACAATGGGGTGACTCCTGGAGAGAAGATGCTCACAGTCCCCCATATCACGTGCGACCCCCCAGAAGAGCGGCGGCTGGACCACTT
CTCTGTCGACGGCTATGACAGTTCTGTAAGGAAGAGCCCAACACTGCTGGAAGTGAGCATGCCCCATTTCATGAGAACCAACAGCTTCGC
CGAGGACCTGGACCTGGAAGGGGAGACTCTGCTGACACCCATCACCCACATCTCACAGCTGCGGGAACACCATCGGGCCACCATTAAGGT
CATTCGACGCATGCAGTACTTTGTGGCCAAGAAGAAATTCCAGCAAGCGCGGAAGCCTTACGATGTGCGGGACGTCATTGAGCAGTACTC
GCAGGGCCACCTCAACCTCATGGTGCGCATCAAGGAGCTGCAGAGGAGGCTGGACCAGTCCATTGGGAAGCCCTCACTGTTCATCTCCGT
CTCAGAAAAGAGCAAGGATCGCGGCAGCAACACGATCGGCGCCCGCCTGAACCGAGTAGAAGACAAGATCCGAAATGTGGCAGCAAATCT
CTGTGTGGACAGCAAGCATGGAGCCACCGGAACAGAGCTGAGGCTGGACATCTGTGTCAAGGATGGTTCTGAAAGAACATGGTCTCATGA
ACAGCTTTTTACCTTTGGATGGAGAGAAGATATTCGACCCGGTGAGCCACTGCATACCCGGAAATTCTGCTTTGATGCGATCTCACACAA
CAGCCCCGTTACACTCTATGACTGTCATGGCATGAAGGGGAACCAGCTCTGGGGATACCGGAAGGACAGAACATTATTCCATCCTGTGAG
CAACAGCTGCATGGATTGCAACCCCGCAGAGAAGAAGATTTTCATGGCCAGATGTGACCCTCTCTCTGAGACTCAGCAGTGGATTTTTGA


Top

FusionGenePPI for KCNQ1_GALNTL6


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
KCNQ1TRAF6, AKAP9, PRKAR2A, PPP1CA, PRKACA, KCNE1, KCNE2, KCNQ2, HSPA4, NEDD4, USP2, AP2M1, NEDD4L, ATP4A, EGFR, BACE1GALNTL6


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
HgeneKCNQ1chr11:2799267chr4:173930329ENST00000155840+1516535_572598677KCNE1 C-terminus


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneKCNQ1chr11:2799267chr4:173930329ENST00000155840+1516588_616598677AKAP9
HgeneKCNQ1chr11:2799267chr4:173930329ENST00000335475+1516588_616471550AKAP9
HgeneKCNQ1chr11:2799267chr4:173930329ENST00000335475+1516535_572471550KCNE1 C-terminus


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for KCNQ1_GALNTL6


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
HgeneKCNQ1P51787DB00808IndapamidePotassium voltage-gated channel subfamily KQT member 1 {ECO:0000305}small moleculeapproved
HgeneKCNQ1P51787DB11633IsavuconazolePotassium voltage-gated channel subfamily KQT member 1 {ECO:0000305}small moleculeapproved|investigational
HgeneKCNQ1P51787DB01244BepridilPotassium voltage-gated channel subfamily KQT member 1 {ECO:0000305}small moleculeapproved|withdrawn

Top

RelatedDiseases for KCNQ1_GALNTL6


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneKCNQ1C0035828Romano-Ward Syndrome36CTD_human;ORPHANET;UNIPROT
HgeneKCNQ1C0022387Jervell-Lange Nielsen Syndrome9CTD_human;ORPHANET;UNIPROT
HgeneKCNQ1C0023976Long QT Syndrome7CTD_human
HgeneKCNQ1C0011860Diabetes Mellitus, Non-Insulin-Dependent3CTD_human
HgeneKCNQ1C0001418Adenocarcinoma1CTD_human
HgeneKCNQ1C0018781Noise-induced hearing loss1CTD_human
HgeneKCNQ1C0021841Intestinal Neoplasms1CTD_human
HgeneKCNQ1C1837014Atrial Fibrillation, Familial, 31CTD_human;UNIPROT
HgeneKCNQ1C1865019SHORT QT SYNDROME 2 (disorder)1CTD_human;UNIPROT