FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 18320

FusionGeneSummary for KCNN3_YEATS4

check button Fusion gene summary
Fusion gene informationFusion gene name: KCNN3_YEATS4
Fusion gene ID: 18320
HgeneTgene
Gene symbol

KCNN3

YEATS4

Gene ID

3782

8089

Gene namepotassium calcium-activated channel subfamily N member 3YEATS domain containing 4
SynonymsKCa2.3|SK3|SKCA3|hSK34930573H17Rik|B230215M10Rik|GAS41|NUBI-1|YAF9
Cytomap

1q21.3

12q15

Type of geneprotein-codingprotein-coding
Descriptionsmall conductance calcium-activated potassium channel protein 3SKCa 3potassium channel, calcium activated intermediate/small conductance subfamily N alpha, member 3potassium intermediate/small conductance calcium-activated channel, subfamily N, member YEATS domain-containing protein 4NuMA binding protein 1glioma-amplified sequence 41nuBI1
Modification date2018052320180519
UniProtAcc

Q9UGI6

O95619

Ensembl transtripts involved in fusion geneENST00000271915, ENST00000361147, 
ENST00000358505, ENST00000515643, 
ENST00000247843, ENST00000548020, 
Fusion gene scores* DoF score4 X 3 X 4=488 X 3 X 4=96
# samples 47
** MAII scorelog2(4/48*10)=-0.263034405833794
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(7/96*10)=-0.45567948377619
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: KCNN3 [Title/Abstract] AND YEATS4 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneYEATS4

GO:0043967

histone H4 acetylation

14966270

TgeneYEATS4

GO:0043968

histone H2A acetylation

14966270


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSARCTCGA-FX-A2QS-01AKCNN3chr1

154705479

-YEATS4chr12

69756568

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000271915ENST00000247843KCNN3chr1

154705479

-YEATS4chr12

69756568

+
In-frameENST00000271915ENST00000548020KCNN3chr1

154705479

-YEATS4chr12

69756568

+
In-frameENST00000361147ENST00000247843KCNN3chr1

154705479

-YEATS4chr12

69756568

+
In-frameENST00000361147ENST00000548020KCNN3chr1

154705479

-YEATS4chr12

69756568

+
Frame-shitENST00000358505ENST00000247843KCNN3chr1

154705479

-YEATS4chr12

69756568

+
Frame-shitENST00000358505ENST00000548020KCNN3chr1

154705479

-YEATS4chr12

69756568

+
intron-3CDSENST00000515643ENST00000247843KCNN3chr1

154705479

-YEATS4chr12

69756568

+
intron-3CDSENST00000515643ENST00000548020KCNN3chr1

154705479

-YEATS4chr12

69756568

+

Top

FusionProtFeatures for KCNN3_YEATS4


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
KCNN3

Q9UGI6

YEATS4

O95619

Forms a voltage-independent potassium channel activatedby intracellular calcium. Activation is followed by membranehyperpolarization. Thought to regulate neuronal excitability bycontributing to the slow component of synapticafterhyperpolarization. The channel is blocked by apamin. Component of the NuA4 histone acetyltransferase (HAT)complex which is involved in transcriptional activation of selectgenes principally by acetylation of nucleosomal histones H4 andH2A. This modification may both alter nucleosome - DNAinteractions and promote interaction of the modified histones withother proteins which positively regulate transcription. Thiscomplex may be required for the activation of transcriptionalprograms associated with oncogene and proto-oncogene mediatedgrowth induction, tumor suppressor mediated growth arrest andreplicative senescence, apoptosis, and DNA repair. NuA4 may alsoplay a direct role in DNA repair when recruited to sites of DNAdamage. {ECO:0000269|PubMed:14966270}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneKCNN3chr1:154705479chr12:69756568ENST00000358505-4830_99217419Compositional biasNote=Gln-rich
HgeneKCNN3chr1:154705479chr12:69756568ENST00000358505-4842_64217419Compositional biasNote=Pro-rich
HgeneKCNN3chr1:154705479chr12:69756568ENST00000361147-4830_99225427Compositional biasNote=Gln-rich
HgeneKCNN3chr1:154705479chr12:69756568ENST00000361147-4842_64225427Compositional biasNote=Pro-rich
TgeneYEATS4chr1:154705479chr12:69756568ENST00000247843+07178_22617228Coiled coilOntology_term=ECO:0000255
TgeneYEATS4chr1:154705479chr12:69756568ENST00000247843+0722_12617228DomainYEATS

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneKCNN3chr1:154705479chr12:69756568ENST00000358505-48688_692217419Compositional biasNote=Poly-Gln
HgeneKCNN3chr1:154705479chr12:69756568ENST00000358505-48732_735217419Compositional biasNote=Poly-Ser
HgeneKCNN3chr1:154705479chr12:69756568ENST00000361147-48688_692225427Compositional biasNote=Poly-Gln
HgeneKCNN3chr1:154705479chr12:69756568ENST00000361147-48732_735225427Compositional biasNote=Poly-Ser
HgeneKCNN3chr1:154705479chr12:69756568ENST00000358505-48499_519217419IntramembranePore-forming%3B Name%3DSegment H5
HgeneKCNN3chr1:154705479chr12:69756568ENST00000361147-48499_519225427IntramembranePore-forming%3B Name%3DSegment H5
HgeneKCNN3chr1:154705479chr12:69756568ENST00000358505-48566_642217419RegionCalmodulin-binding
HgeneKCNN3chr1:154705479chr12:69756568ENST00000361147-48566_642225427RegionCalmodulin-binding
HgeneKCNN3chr1:154705479chr12:69756568ENST00000358505-48293_313217419TransmembraneHelical%3B Name%3DSegment S1
HgeneKCNN3chr1:154705479chr12:69756568ENST00000358505-48320_340217419TransmembraneHelical%3B Name%3DSegment S2
HgeneKCNN3chr1:154705479chr12:69756568ENST00000358505-48371_391217419TransmembraneHelical%3B Name%3DSegment S3
HgeneKCNN3chr1:154705479chr12:69756568ENST00000358505-48410_430217419TransmembraneHelical%3B Name%3DSegment S4
HgeneKCNN3chr1:154705479chr12:69756568ENST00000358505-48459_479217419TransmembraneHelical%3B Name%3DSegment S5
HgeneKCNN3chr1:154705479chr12:69756568ENST00000358505-48528_548217419TransmembraneHelical%3B Name%3DSegment S6
HgeneKCNN3chr1:154705479chr12:69756568ENST00000361147-48293_313225427TransmembraneHelical%3B Name%3DSegment S1
HgeneKCNN3chr1:154705479chr12:69756568ENST00000361147-48320_340225427TransmembraneHelical%3B Name%3DSegment S2
HgeneKCNN3chr1:154705479chr12:69756568ENST00000361147-48371_391225427TransmembraneHelical%3B Name%3DSegment S3
HgeneKCNN3chr1:154705479chr12:69756568ENST00000361147-48410_430225427TransmembraneHelical%3B Name%3DSegment S4
HgeneKCNN3chr1:154705479chr12:69756568ENST00000361147-48459_479225427TransmembraneHelical%3B Name%3DSegment S5
HgeneKCNN3chr1:154705479chr12:69756568ENST00000361147-48528_548225427TransmembraneHelical%3B Name%3DSegment S6


Top

FusionGeneSequence for KCNN3_YEATS4


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_KCNN3_ENST00000271915_chr1_154705479_-_YEATS4_ENST00000247843_chr12_69756568_+_741aa
MDTSGHFHDSGVGDLDEDPKCPCPSSGDEQQQQQQQQQQQQPPPPAPPAAPQQPLGPSLQPQPPQLQQQQQQQQQQQQQQPPHPLSQLAQ
LQSQPVHPGLLHSSPTAFRAPPSSNSTAILHPSSRQGSQLNLNDHLLGHSPSSTATSGPGGGSRHRQASPLVHRRDSNPFTEIAMSSCKY
SGGVMKPLSRLSASRRNLIEAETEGQPLQLFSPSNPPEIVISSREDNHAHQTLLHHPNATHNHQHAGTTASSTTFPKANKRKNQNIGYKL
GHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSWGLYSKDSMFSLALKCLISLSTIILLGLIIAYHTREVQLFVIDNGADDWRIAMTY
ERILYISLEMLVCAIHPIPGEYKFFWTARLAFSYTPSRAEADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFV
MKTLMTICPGTVLLVFSISLWIIAAWTVRVCERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGVTIVKPIVY
GNVARYFGKKREEDGHTHQWTVYVKPYRNEDMSAYVKKIQFKLHESYGNPLRVVTKPPYEITETGWGEFEIIIKIFFIDPNERPVTLYHL
LKLFQSDTNAMLGKKTVVSEFYDEMIFQDPTAMMQQLLTTSRQLTLGAYKHETEFAELEVKTREKLEAAKKKTSFEIAELKERLKASRET

>In-frame_KCNN3_ENST00000271915_chr1_154705479_-_YEATS4_ENST00000548020_chr12_69756568_+_687aa
MDTSGHFHDSGVGDLDEDPKCPCPSSGDEQQQQQQQQQQQQPPPPAPPAAPQQPLGPSLQPQPPQLQQQQQQQQQQQQQQPPHPLSQLAQ
LQSQPVHPGLLHSSPTAFRAPPSSNSTAILHPSSRQGSQLNLNDHLLGHSPSSTATSGPGGGSRHRQASPLVHRRDSNPFTEIAMSSCKY
SGGVMKPLSRLSASRRNLIEAETEGQPLQLFSPSNPPEIVISSREDNHAHQTLLHHPNATHNHQHAGTTASSTTFPKANKRKNQNIGYKL
GHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSWGLYSKDSMFSLALKCLISLSTIILLGLIIAYHTREVQLFVIDNGADDWRIAMTY
ERILYISLEMLVCAIHPIPGEYKFFWTARLAFSYTPSRAEADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFV
MKTLMTICPGTVLLVFSISLWIIAAWTVRVCERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGVTIVKPIVY
GNVARYFGKKREEDGHTHQWTVYVKPYRNEVTLYHLLKLFQSDTNAMLGKKTVVSEFYDEMIFQDPTAMMQQLLTTSRQLTLGAYKHETE

>In-frame_KCNN3_ENST00000361147_chr1_154705479_-_YEATS4_ENST00000247843_chr12_69756568_+_436aa
MERPIKDSMFSLALKCLISLSTIILLGLIIAYHTREVQLFVIDNGADDWRIAMTYERILYISLEMLVCAIHPIPGEYKFFWTARLAFSYT
PSRAEADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRVCERYH
DQQDVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGVTIVKPIVYGNVARYFGKKREEDGHTHQWTVYVKPYRNEDMSAY
VKKIQFKLHESYGNPLRVVTKPPYEITETGWGEFEIIIKIFFIDPNERPVTLYHLLKLFQSDTNAMLGKKTVVSEFYDEMIFQDPTAMMQ

>In-frame_KCNN3_ENST00000361147_chr1_154705479_-_YEATS4_ENST00000548020_chr12_69756568_+_382aa
MERPIKDSMFSLALKCLISLSTIILLGLIIAYHTREVQLFVIDNGADDWRIAMTYERILYISLEMLVCAIHPIPGEYKFFWTARLAFSYT
PSRAEADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRVCERYH
DQQDVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGVTIVKPIVYGNVARYFGKKREEDGHTHQWTVYVKPYRNEVTLYH
LLKLFQSDTNAMLGKKTVVSEFYDEMIFQDPTAMMQQLLTTSRQLTLGAYKHETEFAELEVKTREKLEAAKKKTSFEIAELKERLKASRE


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_KCNN3_ENST00000271915_chr1_154705479_-_YEATS4_ENST00000247843_chr12_69756568_+_2223nt
ATGGACACTTCTGGGCACTTCCATGACTCGGGGGTGGGGGACTTGGATGAAGACCCCAAGTGCCCCTGTCCATCCTCTGGGGATGAGCAG
CAGCAGCAGCAGCAGCAGCAACAGCAGCAGCAGCCACCACCGCCAGCGCCACCAGCAGCCCCCCAGCAGCCCCTGGGACCCTCGCTGCAG
CCTCAGCCTCCGCAGCTTCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCCACCGCATCCCCTGTCTCAGCTCGCCCAA
CTCCAGAGCCAGCCCGTCCACCCTGGCCTGCTGCACTCCTCTCCCACCGCTTTCAGGGCCCCCCCTTCGTCCAACTCCACCGCCATCCTC
CACCCTTCCTCCAGGCAAGGCAGCCAGCTCAATCTCAATGACCACTTGCTTGGCCACTCTCCAAGTTCCACAGCTACAAGTGGGCCTGGC
GGAGGCAGCCGGCACCGACAGGCCAGCCCCCTGGTGCACCGGCGGGACAGCAACCCCTTCACGGAGATCGCCATGAGCTCCTGCAAGTAT
AGCGGTGGGGTCATGAAGCCCCTCAGCCGCCTCAGCGCCTCCCGGAGGAACCTCATCGAGGCCGAGACTGAGGGCCAACCCCTCCAGCTT
TTCAGCCCTAGCAACCCCCCGGAGATCGTCATCTCCTCCCGGGAGGACAACCATGCCCACCAGACCCTGCTCCATCACCCTAATGCCACC
CACAACCACCAGCATGCCGGCACCACCGCCAGCAGCACCACCTTCCCCAAAGCCAACAAGCGGAAAAACCAAAACATTGGCTATAAGCTG
GGACACAGGAGGGCCCTGTTTGAAAAGAGAAAGCGACTGAGTGACTATGCTCTGATTTTTGGGATGTTTGGAATTGTTGTTATGGTGATA
GAGACCGAGCTCTCTTGGGGTTTGTACTCAAAGGACTCCATGTTTTCGTTGGCCCTGAAATGCCTTATCAGTCTGTCCACCATCATCCTT
TTGGGCTTGATCATCGCCTACCACACACGTGAAGTCCAGCTCTTCGTGATCGACAATGGCGCGGATGACTGGCGGATAGCCATGACCTAC
GAGCGCATCCTGTACATCAGCCTGGAGATGCTGGTGTGCGCCATCCACCCCATTCCTGGCGAGTACAAGTTCTTCTGGACGGCACGCCTG
GCCTTCTCCTACACACCCTCCCGGGCGGAGGCCGATGTGGACATCATCCTGTCTATCCCCATGTTCCTGCGCCTGTACCTGATCGCCCGA
GTCATGCTGCTGCACAGCAAGCTCTTCACCGATGCCTCGTCCCGCAGCATCGGGGCCCTCAACAAGATCAACTTCAACACCCGCTTTGTC
ATGAAGACGCTCATGACCATCTGCCCTGGCACTGTGCTGCTCGTGTTCAGCATCTCTCTGTGGATCATTGCTGCCTGGACCGTCCGTGTC
TGTGAAAGGTACCATGACCAGCAGGACGTAACTAGTAACTTTCTGGGTGCCATGTGGCTCATCTCCATCACATTCCTTTCCATTGGTTAT
GGGGACATGGTGCCCCACACATACTGTGGGAAAGGTGTCTGTCTCCTCACTGGCATCATGGGTGTTACTATCGTTAAACCAATAGTTTAC
GGTAATGTTGCTCGGTATTTTGGAAAGAAAAGAGAAGAAGATGGGCACACTCATCAGTGGACAGTATATGTGAAACCATATAGAAATGAG
GATATGTCAGCATATGTGAAGAAAATCCAGTTTAAATTACATGAAAGCTATGGCAATCCTTTAAGAGTTGTTACTAAACCTCCATATGAA
ATTACTGAAACAGGATGGGGTGAATTCGAAATAATCATCAAAATATTTTTCATTGACCCTAATGAAAGACCTGTAACCCTGTATCATTTG
CTAAAGCTGTTTCAATCAGACACCAATGCAATGCTGGGGAAAAAGACAGTGGTTTCAGAGTTCTATGATGAAATGATATTTCAAGACCCA
ACAGCAATGATGCAACAATTATTGACAACATCTCGTCAGCTAACATTAGGAGCCTATAAGCATGAAACAGAATTTGCAGAGCTTGAAGTG
AAAACCAGAGAAAAATTAGAAGCTGCTAAGAAAAAAACAAGCTTTGAGATTGCAGAGCTTAAGGAGAGATTAAAAGCAAGTCGTGAAACT

>In-frame_KCNN3_ENST00000271915_chr1_154705479_-_YEATS4_ENST00000548020_chr12_69756568_+_2061nt
ATGGACACTTCTGGGCACTTCCATGACTCGGGGGTGGGGGACTTGGATGAAGACCCCAAGTGCCCCTGTCCATCCTCTGGGGATGAGCAG
CAGCAGCAGCAGCAGCAGCAACAGCAGCAGCAGCCACCACCGCCAGCGCCACCAGCAGCCCCCCAGCAGCCCCTGGGACCCTCGCTGCAG
CCTCAGCCTCCGCAGCTTCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCCACCGCATCCCCTGTCTCAGCTCGCCCAA
CTCCAGAGCCAGCCCGTCCACCCTGGCCTGCTGCACTCCTCTCCCACCGCTTTCAGGGCCCCCCCTTCGTCCAACTCCACCGCCATCCTC
CACCCTTCCTCCAGGCAAGGCAGCCAGCTCAATCTCAATGACCACTTGCTTGGCCACTCTCCAAGTTCCACAGCTACAAGTGGGCCTGGC
GGAGGCAGCCGGCACCGACAGGCCAGCCCCCTGGTGCACCGGCGGGACAGCAACCCCTTCACGGAGATCGCCATGAGCTCCTGCAAGTAT
AGCGGTGGGGTCATGAAGCCCCTCAGCCGCCTCAGCGCCTCCCGGAGGAACCTCATCGAGGCCGAGACTGAGGGCCAACCCCTCCAGCTT
TTCAGCCCTAGCAACCCCCCGGAGATCGTCATCTCCTCCCGGGAGGACAACCATGCCCACCAGACCCTGCTCCATCACCCTAATGCCACC
CACAACCACCAGCATGCCGGCACCACCGCCAGCAGCACCACCTTCCCCAAAGCCAACAAGCGGAAAAACCAAAACATTGGCTATAAGCTG
GGACACAGGAGGGCCCTGTTTGAAAAGAGAAAGCGACTGAGTGACTATGCTCTGATTTTTGGGATGTTTGGAATTGTTGTTATGGTGATA
GAGACCGAGCTCTCTTGGGGTTTGTACTCAAAGGACTCCATGTTTTCGTTGGCCCTGAAATGCCTTATCAGTCTGTCCACCATCATCCTT
TTGGGCTTGATCATCGCCTACCACACACGTGAAGTCCAGCTCTTCGTGATCGACAATGGCGCGGATGACTGGCGGATAGCCATGACCTAC
GAGCGCATCCTGTACATCAGCCTGGAGATGCTGGTGTGCGCCATCCACCCCATTCCTGGCGAGTACAAGTTCTTCTGGACGGCACGCCTG
GCCTTCTCCTACACACCCTCCCGGGCGGAGGCCGATGTGGACATCATCCTGTCTATCCCCATGTTCCTGCGCCTGTACCTGATCGCCCGA
GTCATGCTGCTGCACAGCAAGCTCTTCACCGATGCCTCGTCCCGCAGCATCGGGGCCCTCAACAAGATCAACTTCAACACCCGCTTTGTC
ATGAAGACGCTCATGACCATCTGCCCTGGCACTGTGCTGCTCGTGTTCAGCATCTCTCTGTGGATCATTGCTGCCTGGACCGTCCGTGTC
TGTGAAAGGTACCATGACCAGCAGGACGTAACTAGTAACTTTCTGGGTGCCATGTGGCTCATCTCCATCACATTCCTTTCCATTGGTTAT
GGGGACATGGTGCCCCACACATACTGTGGGAAAGGTGTCTGTCTCCTCACTGGCATCATGGGTGTTACTATCGTTAAACCAATAGTTTAC
GGTAATGTTGCTCGGTATTTTGGAAAGAAAAGAGAAGAAGATGGGCACACTCATCAGTGGACAGTATATGTGAAACCATATAGAAATGAG
GTAACCCTGTATCATTTGCTAAAGCTGTTTCAATCAGACACCAATGCAATGCTGGGGAAAAAGACAGTGGTTTCAGAGTTCTATGATGAA
ATGATATTTCAAGACCCAACAGCAATGATGCAACAATTATTGACAACATCTCGTCAGCTAACATTAGGAGCCTATAAGCATGAAACAGAA
TTTGCAGAGCTTGAAGTGAAAACCAGAGAAAAATTAGAAGCTGCTAAGAAAAAAACAAGCTTTGAGATTGCAGAGCTTAAGGAGAGATTA

>In-frame_KCNN3_ENST00000361147_chr1_154705479_-_YEATS4_ENST00000247843_chr12_69756568_+_1308nt
ATGGAGAGACCTATAAAGGACTCCATGTTTTCGTTGGCCCTGAAATGCCTTATCAGTCTGTCCACCATCATCCTTTTGGGCTTGATCATC
GCCTACCACACACGTGAAGTCCAGCTCTTCGTGATCGACAATGGCGCGGATGACTGGCGGATAGCCATGACCTACGAGCGCATCCTGTAC
ATCAGCCTGGAGATGCTGGTGTGCGCCATCCACCCCATTCCTGGCGAGTACAAGTTCTTCTGGACGGCACGCCTGGCCTTCTCCTACACA
CCCTCCCGGGCGGAGGCCGATGTGGACATCATCCTGTCTATCCCCATGTTCCTGCGCCTGTACCTGATCGCCCGAGTCATGCTGCTGCAC
AGCAAGCTCTTCACCGATGCCTCGTCCCGCAGCATCGGGGCCCTCAACAAGATCAACTTCAACACCCGCTTTGTCATGAAGACGCTCATG
ACCATCTGCCCTGGCACTGTGCTGCTCGTGTTCAGCATCTCTCTGTGGATCATTGCTGCCTGGACCGTCCGTGTCTGTGAAAGGTACCAT
GACCAGCAGGACGTAACTAGTAACTTTCTGGGTGCCATGTGGCTCATCTCCATCACATTCCTTTCCATTGGTTATGGGGACATGGTGCCC
CACACATACTGTGGGAAAGGTGTCTGTCTCCTCACTGGCATCATGGGTGTTACTATCGTTAAACCAATAGTTTACGGTAATGTTGCTCGG
TATTTTGGAAAGAAAAGAGAAGAAGATGGGCACACTCATCAGTGGACAGTATATGTGAAACCATATAGAAATGAGGATATGTCAGCATAT
GTGAAGAAAATCCAGTTTAAATTACATGAAAGCTATGGCAATCCTTTAAGAGTTGTTACTAAACCTCCATATGAAATTACTGAAACAGGA
TGGGGTGAATTCGAAATAATCATCAAAATATTTTTCATTGACCCTAATGAAAGACCTGTAACCCTGTATCATTTGCTAAAGCTGTTTCAA
TCAGACACCAATGCAATGCTGGGGAAAAAGACAGTGGTTTCAGAGTTCTATGATGAAATGATATTTCAAGACCCAACAGCAATGATGCAA
CAATTATTGACAACATCTCGTCAGCTAACATTAGGAGCCTATAAGCATGAAACAGAATTTGCAGAGCTTGAAGTGAAAACCAGAGAAAAA
TTAGAAGCTGCTAAGAAAAAAACAAGCTTTGAGATTGCAGAGCTTAAGGAGAGATTAAAAGCAAGTCGTGAAACTATAAATTGTTTAAAA

>In-frame_KCNN3_ENST00000361147_chr1_154705479_-_YEATS4_ENST00000548020_chr12_69756568_+_1146nt
ATGGAGAGACCTATAAAGGACTCCATGTTTTCGTTGGCCCTGAAATGCCTTATCAGTCTGTCCACCATCATCCTTTTGGGCTTGATCATC
GCCTACCACACACGTGAAGTCCAGCTCTTCGTGATCGACAATGGCGCGGATGACTGGCGGATAGCCATGACCTACGAGCGCATCCTGTAC
ATCAGCCTGGAGATGCTGGTGTGCGCCATCCACCCCATTCCTGGCGAGTACAAGTTCTTCTGGACGGCACGCCTGGCCTTCTCCTACACA
CCCTCCCGGGCGGAGGCCGATGTGGACATCATCCTGTCTATCCCCATGTTCCTGCGCCTGTACCTGATCGCCCGAGTCATGCTGCTGCAC
AGCAAGCTCTTCACCGATGCCTCGTCCCGCAGCATCGGGGCCCTCAACAAGATCAACTTCAACACCCGCTTTGTCATGAAGACGCTCATG
ACCATCTGCCCTGGCACTGTGCTGCTCGTGTTCAGCATCTCTCTGTGGATCATTGCTGCCTGGACCGTCCGTGTCTGTGAAAGGTACCAT
GACCAGCAGGACGTAACTAGTAACTTTCTGGGTGCCATGTGGCTCATCTCCATCACATTCCTTTCCATTGGTTATGGGGACATGGTGCCC
CACACATACTGTGGGAAAGGTGTCTGTCTCCTCACTGGCATCATGGGTGTTACTATCGTTAAACCAATAGTTTACGGTAATGTTGCTCGG
TATTTTGGAAAGAAAAGAGAAGAAGATGGGCACACTCATCAGTGGACAGTATATGTGAAACCATATAGAAATGAGGTAACCCTGTATCAT
TTGCTAAAGCTGTTTCAATCAGACACCAATGCAATGCTGGGGAAAAAGACAGTGGTTTCAGAGTTCTATGATGAAATGATATTTCAAGAC
CCAACAGCAATGATGCAACAATTATTGACAACATCTCGTCAGCTAACATTAGGAGCCTATAAGCATGAAACAGAATTTGCAGAGCTTGAA
GTGAAAACCAGAGAAAAATTAGAAGCTGCTAAGAAAAAAACAAGCTTTGAGATTGCAGAGCTTAAGGAGAGATTAAAAGCAAGTCGTGAA


* Fusion transcript sequences (Full-length transcript).
>In-frame_KCNN3_ENST00000271915_chr1_154705479_-_YEATS4_ENST00000247843_chr12_69756568_+_3019nt
TTGAGCCAGCGAGGAGTGAAGCTGAGCCTGGCCTCACACGCTCCTAGAGGACCACCTCCTGAGAGAGTTCTTTCACCCCCTCTTCTTTCT
CCAAGCTCCCCTCCTGCTCTCCCTCCCTGCCCAATACAATGCATTCTTGAGTGGCAGCGTCTGGACTCCAGGCAGCCCCAGAGAACCGAA
GCAAGCCAAAGAGAGGACTGGAGCCAAGATACTGGTGGGGGAGATTGGATGCCTGGCTTTCTTTGAGGACATCTTTGGAGCGAGGGTGGC
TTTGGGGTGGGGGCTTGTGCTGCAGGGAATACAGCCAGGCCCCAAGATGGACACTTCTGGGCACTTCCATGACTCGGGGGTGGGGGACTT
GGATGAAGACCCCAAGTGCCCCTGTCCATCCTCTGGGGATGAGCAGCAGCAGCAGCAGCAGCAGCAACAGCAGCAGCAGCCACCACCGCC
AGCGCCACCAGCAGCCCCCCAGCAGCCCCTGGGACCCTCGCTGCAGCCTCAGCCTCCGCAGCTTCAGCAGCAGCAGCAGCAGCAGCAGCA
GCAGCAGCAGCAGCAGCCACCGCATCCCCTGTCTCAGCTCGCCCAACTCCAGAGCCAGCCCGTCCACCCTGGCCTGCTGCACTCCTCTCC
CACCGCTTTCAGGGCCCCCCCTTCGTCCAACTCCACCGCCATCCTCCACCCTTCCTCCAGGCAAGGCAGCCAGCTCAATCTCAATGACCA
CTTGCTTGGCCACTCTCCAAGTTCCACAGCTACAAGTGGGCCTGGCGGAGGCAGCCGGCACCGACAGGCCAGCCCCCTGGTGCACCGGCG
GGACAGCAACCCCTTCACGGAGATCGCCATGAGCTCCTGCAAGTATAGCGGTGGGGTCATGAAGCCCCTCAGCCGCCTCAGCGCCTCCCG
GAGGAACCTCATCGAGGCCGAGACTGAGGGCCAACCCCTCCAGCTTTTCAGCCCTAGCAACCCCCCGGAGATCGTCATCTCCTCCCGGGA
GGACAACCATGCCCACCAGACCCTGCTCCATCACCCTAATGCCACCCACAACCACCAGCATGCCGGCACCACCGCCAGCAGCACCACCTT
CCCCAAAGCCAACAAGCGGAAAAACCAAAACATTGGCTATAAGCTGGGACACAGGAGGGCCCTGTTTGAAAAGAGAAAGCGACTGAGTGA
CTATGCTCTGATTTTTGGGATGTTTGGAATTGTTGTTATGGTGATAGAGACCGAGCTCTCTTGGGGTTTGTACTCAAAGGACTCCATGTT
TTCGTTGGCCCTGAAATGCCTTATCAGTCTGTCCACCATCATCCTTTTGGGCTTGATCATCGCCTACCACACACGTGAAGTCCAGCTCTT
CGTGATCGACAATGGCGCGGATGACTGGCGGATAGCCATGACCTACGAGCGCATCCTGTACATCAGCCTGGAGATGCTGGTGTGCGCCAT
CCACCCCATTCCTGGCGAGTACAAGTTCTTCTGGACGGCACGCCTGGCCTTCTCCTACACACCCTCCCGGGCGGAGGCCGATGTGGACAT
CATCCTGTCTATCCCCATGTTCCTGCGCCTGTACCTGATCGCCCGAGTCATGCTGCTGCACAGCAAGCTCTTCACCGATGCCTCGTCCCG
CAGCATCGGGGCCCTCAACAAGATCAACTTCAACACCCGCTTTGTCATGAAGACGCTCATGACCATCTGCCCTGGCACTGTGCTGCTCGT
GTTCAGCATCTCTCTGTGGATCATTGCTGCCTGGACCGTCCGTGTCTGTGAAAGGTACCATGACCAGCAGGACGTAACTAGTAACTTTCT
GGGTGCCATGTGGCTCATCTCCATCACATTCCTTTCCATTGGTTATGGGGACATGGTGCCCCACACATACTGTGGGAAAGGTGTCTGTCT
CCTCACTGGCATCATGGGTGTTACTATCGTTAAACCAATAGTTTACGGTAATGTTGCTCGGTATTTTGGAAAGAAAAGAGAAGAAGATGG
GCACACTCATCAGTGGACAGTATATGTGAAACCATATAGAAATGAGGATATGTCAGCATATGTGAAGAAAATCCAGTTTAAATTACATGA
AAGCTATGGCAATCCTTTAAGAGTTGTTACTAAACCTCCATATGAAATTACTGAAACAGGATGGGGTGAATTCGAAATAATCATCAAAAT
ATTTTTCATTGACCCTAATGAAAGACCTGTAACCCTGTATCATTTGCTAAAGCTGTTTCAATCAGACACCAATGCAATGCTGGGGAAAAA
GACAGTGGTTTCAGAGTTCTATGATGAAATGATATTTCAAGACCCAACAGCAATGATGCAACAATTATTGACAACATCTCGTCAGCTAAC
ATTAGGAGCCTATAAGCATGAAACAGAATTTGCAGAGCTTGAAGTGAAAACCAGAGAAAAATTAGAAGCTGCTAAGAAAAAAACAAGCTT
TGAGATTGCAGAGCTTAAGGAGAGATTAAAAGCAAGTCGTGAAACTATAAATTGTTTAAAAAATGAAATCAGAAAACTTGAAGAAGATGA
CCAAGCAAAAGACATATAAACAGTTCTCATGAGAACTTGGTAGTAAGCTAAACTGAAAATAAGGTGGGCTTCACTGGAGAAATGGACTTA
CTGCAAATGCTGTGATGTTTCTTAGAGGAACTTCATATACAGCTGTTGACCATGAATTTCTTAGCAATAGGAATTTGTACTATTTAAGCA
ATCTTTAATGGAAAATATGTGTGTAAGAATGGATGCTATATAGGTATTTTACCAACCCATTTTAAGAAAATTCTATGATATTAAGCACAG
TTTTTAAAAATGTTTATTGTAGTATATGTATAGCTTATTACCCTTTTGACAGGCATCAAAATTTCATTATAAAGTATTACTTGTACAAAT
TTTGTACTTCTTTAGTGGCTAGAATTAGTGAAGAAACTTAATGTGTATATTTAATTTCTTCAAGTTCTTACCTGCCCCCATCCTTTTTTG

>In-frame_KCNN3_ENST00000271915_chr1_154705479_-_YEATS4_ENST00000548020_chr12_69756568_+_2692nt
TTGAGCCAGCGAGGAGTGAAGCTGAGCCTGGCCTCACACGCTCCTAGAGGACCACCTCCTGAGAGAGTTCTTTCACCCCCTCTTCTTTCT
CCAAGCTCCCCTCCTGCTCTCCCTCCCTGCCCAATACAATGCATTCTTGAGTGGCAGCGTCTGGACTCCAGGCAGCCCCAGAGAACCGAA
GCAAGCCAAAGAGAGGACTGGAGCCAAGATACTGGTGGGGGAGATTGGATGCCTGGCTTTCTTTGAGGACATCTTTGGAGCGAGGGTGGC
TTTGGGGTGGGGGCTTGTGCTGCAGGGAATACAGCCAGGCCCCAAGATGGACACTTCTGGGCACTTCCATGACTCGGGGGTGGGGGACTT
GGATGAAGACCCCAAGTGCCCCTGTCCATCCTCTGGGGATGAGCAGCAGCAGCAGCAGCAGCAGCAACAGCAGCAGCAGCCACCACCGCC
AGCGCCACCAGCAGCCCCCCAGCAGCCCCTGGGACCCTCGCTGCAGCCTCAGCCTCCGCAGCTTCAGCAGCAGCAGCAGCAGCAGCAGCA
GCAGCAGCAGCAGCAGCCACCGCATCCCCTGTCTCAGCTCGCCCAACTCCAGAGCCAGCCCGTCCACCCTGGCCTGCTGCACTCCTCTCC
CACCGCTTTCAGGGCCCCCCCTTCGTCCAACTCCACCGCCATCCTCCACCCTTCCTCCAGGCAAGGCAGCCAGCTCAATCTCAATGACCA
CTTGCTTGGCCACTCTCCAAGTTCCACAGCTACAAGTGGGCCTGGCGGAGGCAGCCGGCACCGACAGGCCAGCCCCCTGGTGCACCGGCG
GGACAGCAACCCCTTCACGGAGATCGCCATGAGCTCCTGCAAGTATAGCGGTGGGGTCATGAAGCCCCTCAGCCGCCTCAGCGCCTCCCG
GAGGAACCTCATCGAGGCCGAGACTGAGGGCCAACCCCTCCAGCTTTTCAGCCCTAGCAACCCCCCGGAGATCGTCATCTCCTCCCGGGA
GGACAACCATGCCCACCAGACCCTGCTCCATCACCCTAATGCCACCCACAACCACCAGCATGCCGGCACCACCGCCAGCAGCACCACCTT
CCCCAAAGCCAACAAGCGGAAAAACCAAAACATTGGCTATAAGCTGGGACACAGGAGGGCCCTGTTTGAAAAGAGAAAGCGACTGAGTGA
CTATGCTCTGATTTTTGGGATGTTTGGAATTGTTGTTATGGTGATAGAGACCGAGCTCTCTTGGGGTTTGTACTCAAAGGACTCCATGTT
TTCGTTGGCCCTGAAATGCCTTATCAGTCTGTCCACCATCATCCTTTTGGGCTTGATCATCGCCTACCACACACGTGAAGTCCAGCTCTT
CGTGATCGACAATGGCGCGGATGACTGGCGGATAGCCATGACCTACGAGCGCATCCTGTACATCAGCCTGGAGATGCTGGTGTGCGCCAT
CCACCCCATTCCTGGCGAGTACAAGTTCTTCTGGACGGCACGCCTGGCCTTCTCCTACACACCCTCCCGGGCGGAGGCCGATGTGGACAT
CATCCTGTCTATCCCCATGTTCCTGCGCCTGTACCTGATCGCCCGAGTCATGCTGCTGCACAGCAAGCTCTTCACCGATGCCTCGTCCCG
CAGCATCGGGGCCCTCAACAAGATCAACTTCAACACCCGCTTTGTCATGAAGACGCTCATGACCATCTGCCCTGGCACTGTGCTGCTCGT
GTTCAGCATCTCTCTGTGGATCATTGCTGCCTGGACCGTCCGTGTCTGTGAAAGGTACCATGACCAGCAGGACGTAACTAGTAACTTTCT
GGGTGCCATGTGGCTCATCTCCATCACATTCCTTTCCATTGGTTATGGGGACATGGTGCCCCACACATACTGTGGGAAAGGTGTCTGTCT
CCTCACTGGCATCATGGGTGTTACTATCGTTAAACCAATAGTTTACGGTAATGTTGCTCGGTATTTTGGAAAGAAAAGAGAAGAAGATGG
GCACACTCATCAGTGGACAGTATATGTGAAACCATATAGAAATGAGGTAACCCTGTATCATTTGCTAAAGCTGTTTCAATCAGACACCAA
TGCAATGCTGGGGAAAAAGACAGTGGTTTCAGAGTTCTATGATGAAATGATATTTCAAGACCCAACAGCAATGATGCAACAATTATTGAC
AACATCTCGTCAGCTAACATTAGGAGCCTATAAGCATGAAACAGAATTTGCAGAGCTTGAAGTGAAAACCAGAGAAAAATTAGAAGCTGC
TAAGAAAAAAACAAGCTTTGAGATTGCAGAGCTTAAGGAGAGATTAAAAGCAAGTCGTGAAACTATAAATTGTTTAAAAAATGAAATCAG
AAAACTTGAAGAAGATGACCAAGCAAAAGACATATAAACAGTTCTCATGAGAACTTGGTAGTAAGCTAAACTGAAAATAAGGTGGGCTTC
ACTGGAGAAATGGACTTACTGCAAATGCTGTGATGTTTCTTAGAGGAACTTCATATACAGCTGTTGACCATGAATTTCTTAGCAATAGGA
ATTTGTACTATTTAAGCAATCTTTAATGGAAAATATGTGTGTAAGAATGGATGCTATATAGGTATTTTACCAACCCATTTTAAGAAAATT

>In-frame_KCNN3_ENST00000361147_chr1_154705479_-_YEATS4_ENST00000247843_chr12_69756568_+_1919nt
CAGGAAAGTCAGCTTAAAGGACACTCCTTGCAGGGACTGAGCTGGCACCTACTCCTTAGAGCTTGCTGATACCAGGCCTGCCACGCGACA
TCTGCAAGGACAGTTGTTTGGTGTTTTGCTTCAGGTTATAGATGGAGAGACCTATAAAGGACTCCATGTTTTCGTTGGCCCTGAAATGCC
TTATCAGTCTGTCCACCATCATCCTTTTGGGCTTGATCATCGCCTACCACACACGTGAAGTCCAGCTCTTCGTGATCGACAATGGCGCGG
ATGACTGGCGGATAGCCATGACCTACGAGCGCATCCTGTACATCAGCCTGGAGATGCTGGTGTGCGCCATCCACCCCATTCCTGGCGAGT
ACAAGTTCTTCTGGACGGCACGCCTGGCCTTCTCCTACACACCCTCCCGGGCGGAGGCCGATGTGGACATCATCCTGTCTATCCCCATGT
TCCTGCGCCTGTACCTGATCGCCCGAGTCATGCTGCTGCACAGCAAGCTCTTCACCGATGCCTCGTCCCGCAGCATCGGGGCCCTCAACA
AGATCAACTTCAACACCCGCTTTGTCATGAAGACGCTCATGACCATCTGCCCTGGCACTGTGCTGCTCGTGTTCAGCATCTCTCTGTGGA
TCATTGCTGCCTGGACCGTCCGTGTCTGTGAAAGGTACCATGACCAGCAGGACGTAACTAGTAACTTTCTGGGTGCCATGTGGCTCATCT
CCATCACATTCCTTTCCATTGGTTATGGGGACATGGTGCCCCACACATACTGTGGGAAAGGTGTCTGTCTCCTCACTGGCATCATGGGTG
TTACTATCGTTAAACCAATAGTTTACGGTAATGTTGCTCGGTATTTTGGAAAGAAAAGAGAAGAAGATGGGCACACTCATCAGTGGACAG
TATATGTGAAACCATATAGAAATGAGGATATGTCAGCATATGTGAAGAAAATCCAGTTTAAATTACATGAAAGCTATGGCAATCCTTTAA
GAGTTGTTACTAAACCTCCATATGAAATTACTGAAACAGGATGGGGTGAATTCGAAATAATCATCAAAATATTTTTCATTGACCCTAATG
AAAGACCTGTAACCCTGTATCATTTGCTAAAGCTGTTTCAATCAGACACCAATGCAATGCTGGGGAAAAAGACAGTGGTTTCAGAGTTCT
ATGATGAAATGATATTTCAAGACCCAACAGCAATGATGCAACAATTATTGACAACATCTCGTCAGCTAACATTAGGAGCCTATAAGCATG
AAACAGAATTTGCAGAGCTTGAAGTGAAAACCAGAGAAAAATTAGAAGCTGCTAAGAAAAAAACAAGCTTTGAGATTGCAGAGCTTAAGG
AGAGATTAAAAGCAAGTCGTGAAACTATAAATTGTTTAAAAAATGAAATCAGAAAACTTGAAGAAGATGACCAAGCAAAAGACATATAAA
CAGTTCTCATGAGAACTTGGTAGTAAGCTAAACTGAAAATAAGGTGGGCTTCACTGGAGAAATGGACTTACTGCAAATGCTGTGATGTTT
CTTAGAGGAACTTCATATACAGCTGTTGACCATGAATTTCTTAGCAATAGGAATTTGTACTATTTAAGCAATCTTTAATGGAAAATATGT
GTGTAAGAATGGATGCTATATAGGTATTTTACCAACCCATTTTAAGAAAATTCTATGATATTAAGCACAGTTTTTAAAAATGTTTATTGT
AGTATATGTATAGCTTATTACCCTTTTGACAGGCATCAAAATTTCATTATAAAGTATTACTTGTACAAATTTTGTACTTCTTTAGTGGCT
AGAATTAGTGAAGAAACTTAATGTGTATATTTAATTTCTTCAAGTTCTTACCTGCCCCCATCCTTTTTTGTATATGATGTGTCCAGTAAG

>In-frame_KCNN3_ENST00000361147_chr1_154705479_-_YEATS4_ENST00000548020_chr12_69756568_+_1592nt
CAGGAAAGTCAGCTTAAAGGACACTCCTTGCAGGGACTGAGCTGGCACCTACTCCTTAGAGCTTGCTGATACCAGGCCTGCCACGCGACA
TCTGCAAGGACAGTTGTTTGGTGTTTTGCTTCAGGTTATAGATGGAGAGACCTATAAAGGACTCCATGTTTTCGTTGGCCCTGAAATGCC
TTATCAGTCTGTCCACCATCATCCTTTTGGGCTTGATCATCGCCTACCACACACGTGAAGTCCAGCTCTTCGTGATCGACAATGGCGCGG
ATGACTGGCGGATAGCCATGACCTACGAGCGCATCCTGTACATCAGCCTGGAGATGCTGGTGTGCGCCATCCACCCCATTCCTGGCGAGT
ACAAGTTCTTCTGGACGGCACGCCTGGCCTTCTCCTACACACCCTCCCGGGCGGAGGCCGATGTGGACATCATCCTGTCTATCCCCATGT
TCCTGCGCCTGTACCTGATCGCCCGAGTCATGCTGCTGCACAGCAAGCTCTTCACCGATGCCTCGTCCCGCAGCATCGGGGCCCTCAACA
AGATCAACTTCAACACCCGCTTTGTCATGAAGACGCTCATGACCATCTGCCCTGGCACTGTGCTGCTCGTGTTCAGCATCTCTCTGTGGA
TCATTGCTGCCTGGACCGTCCGTGTCTGTGAAAGGTACCATGACCAGCAGGACGTAACTAGTAACTTTCTGGGTGCCATGTGGCTCATCT
CCATCACATTCCTTTCCATTGGTTATGGGGACATGGTGCCCCACACATACTGTGGGAAAGGTGTCTGTCTCCTCACTGGCATCATGGGTG
TTACTATCGTTAAACCAATAGTTTACGGTAATGTTGCTCGGTATTTTGGAAAGAAAAGAGAAGAAGATGGGCACACTCATCAGTGGACAG
TATATGTGAAACCATATAGAAATGAGGTAACCCTGTATCATTTGCTAAAGCTGTTTCAATCAGACACCAATGCAATGCTGGGGAAAAAGA
CAGTGGTTTCAGAGTTCTATGATGAAATGATATTTCAAGACCCAACAGCAATGATGCAACAATTATTGACAACATCTCGTCAGCTAACAT
TAGGAGCCTATAAGCATGAAACAGAATTTGCAGAGCTTGAAGTGAAAACCAGAGAAAAATTAGAAGCTGCTAAGAAAAAAACAAGCTTTG
AGATTGCAGAGCTTAAGGAGAGATTAAAAGCAAGTCGTGAAACTATAAATTGTTTAAAAAATGAAATCAGAAAACTTGAAGAAGATGACC
AAGCAAAAGACATATAAACAGTTCTCATGAGAACTTGGTAGTAAGCTAAACTGAAAATAAGGTGGGCTTCACTGGAGAAATGGACTTACT
GCAAATGCTGTGATGTTTCTTAGAGGAACTTCATATACAGCTGTTGACCATGAATTTCTTAGCAATAGGAATTTGTACTATTTAAGCAAT
CTTTAATGGAAAATATGTGTGTAAGAATGGATGCTATATAGGTATTTTACCAACCCATTTTAAGAAAATTCTATGATATTAAGCACAGTT


Top

FusionGenePPI for KCNN3_YEATS4


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
KCNN3CALM1, APP, CAV1, DNM2, RAB5AYEATS4TACC1, TACC2, NUMA1, CEP162, PFDN1, MLLT10, SMARCB1, ING3, RUVBL2, RUVBL1, MRGBP, KAT5, DMAP1, H2AFZ, MYCN, KDM1A, FRMD4A, RNF8, MYC, VIM, UBTF, BRD3, TFAP2B, LYN, HECW2, PLAC1, FOXR1, FOXR2, MORF4L1, FOSL2, FOS, GRAMD3, HIST1H2BA, EP400, FUS, MEAF6, EPC1, EPC2, SRCAP, TRRAP, BRD8, VPS72, SUGP1, HDGFRP2, MYO18A, SNX16, ACTL6B, MBTD1, UPF3B, ACTR6, GABPA, WEE1, MORF4L2, JAZF1, ZNHIT1, C12orf43, FBXO34, AGGF1, LENG1, POLDIP3, ANP32A, HIST1H2BG, MED23, XPO1, ACTL6A, COX6B1, ECHS1, FANCD2, MTOR, JUP, KRT2, KRT5, MLLT6, NFKBIE, PPM1G, S100A6, ATXN2, STIL, PTTG1, SNUPN, ZNF292, POLE3, WHSC1L1, PRPF40A, ZNF687, TSPYL2, KLF16, DOT1L, MICALL1, GPRIN1, CDYL2, PTGR2, EME1, ESCO2, REEP3, KPRP, MAX, FOXO6, POU5F1, MTMR7, PPP2R2D, TPH1, MYCL, P4HA3, ACTBL2, PKN3, NCKAP5L, TFPT, CCHCR1, TUFT1, RABGAP1L, GOLGA5, CLOCK, PSMD9, VPS53, DZIP3, GRIPAP1, RCOR1, HMG20A, CCDC132, GIT2, CCDC93, OIP5, PHF21A, PTRF, PHLDB3, HAUS6, RPRD1A, ARNTL, RABGEF1, NUF2, THAP11, VPS51, TSSC1, RABEP1, STRN


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
TgeneYEATS4chr1:154705479chr12:69756568ENST00000247843+07163_22717228MLLT10
TgeneYEATS4chr1:154705479chr12:69756568ENST00000247843+07168_22717228TACC1


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for KCNN3_YEATS4


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
HgeneKCNN3Q9UGI6DB01110MiconazoleSmall conductance calcium-activated potassium channel protein 3small moleculeapproved|investigational|vet_approved

Top

RelatedDiseases for KCNN3_YEATS4


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneKCNN3C0005586Bipolar Disorder5PSYGENET
HgeneKCNN3C0036341Schizophrenia3PSYGENET
HgeneKCNN3C0004238Atrial Fibrillation1CTD_human
TgeneYEATS4C0023827liposarcoma1CTD_human