FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 18287

FusionGeneSummary for KCNK5_RUNX2

check button Fusion gene summary
Fusion gene informationFusion gene name: KCNK5_RUNX2
Fusion gene ID: 18287
HgeneTgene
Gene symbol

KCNK5

RUNX2

Gene ID

8645

860

Gene namepotassium two pore domain channel subfamily K member 5runt related transcription factor 2
SynonymsK2p5.1|KCNK5b|TASK-2|TASK2AML3|CBF-alpha-1|CBFA1|CCD|CCD1|CLCD|OSF-2|OSF2|PEA2aA|PEBP2aA
Cytomap

6p21.2

6p21.1

Type of geneprotein-codingprotein-coding
Descriptionpotassium channel subfamily K member 5K2P5.1 potassium channelTWIK-related acid-sensitive K(+) channel 2TWIK-related acid-sensitive K+ channel 2acid-sensitive potassium channel protein TASK-2potassium channel, subfamily K, member 1 (TASK-2)potassiumrunt-related transcription factor 2PEA2-alpha APEBP2-alpha ASL3-3 enhancer factor 1 alpha A subunitSL3/AKV core-binding factor alpha A subunitacute myeloid leukemia 3 proteincore-binding factor, runt domain, alpha subunit 1oncogene AML-3osteoblast
Modification date2018052320180523
UniProtAcc

O95279

Q13950

Ensembl transtripts involved in fusion geneENST00000359534, ENST00000541979, 
ENST00000465038, ENST00000352853, 
ENST00000371438, ENST00000371436, 
ENST00000576263, ENST00000371432, 
ENST00000359524, ENST00000483243, 
Fusion gene scores* DoF score3 X 2 X 3=183 X 3 X 3=27
# samples 33
** MAII scorelog2(3/18*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(3/27*10)=0.15200309344505
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: KCNK5 [Title/Abstract] AND RUNX2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Tumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneRUNX2

GO:0045892

negative regulation of transcription, DNA-templated

11965546

TgeneRUNX2

GO:0045893

positive regulation of transcription, DNA-templated

11965546


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVKIRPTCGA-B9-A69E-01AKCNK5chr6

39161945

-RUNX2chr6

45479983

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000359534ENST00000541979KCNK5chr6

39161945

-RUNX2chr6

45479983

+
In-frameENST00000359534ENST00000465038KCNK5chr6

39161945

-RUNX2chr6

45479983

+
In-frameENST00000359534ENST00000352853KCNK5chr6

39161945

-RUNX2chr6

45479983

+
In-frameENST00000359534ENST00000371438KCNK5chr6

39161945

-RUNX2chr6

45479983

+
In-frameENST00000359534ENST00000371436KCNK5chr6

39161945

-RUNX2chr6

45479983

+
In-frameENST00000359534ENST00000576263KCNK5chr6

39161945

-RUNX2chr6

45479983

+
In-frameENST00000359534ENST00000371432KCNK5chr6

39161945

-RUNX2chr6

45479983

+
In-frameENST00000359534ENST00000359524KCNK5chr6

39161945

-RUNX2chr6

45479983

+
5CDS-intronENST00000359534ENST00000483243KCNK5chr6

39161945

-RUNX2chr6

45479983

+

Top

FusionProtFeatures for KCNK5_RUNX2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
KCNK5

O95279

RUNX2

Q13950

pH-dependent, voltage insensitive, outwardly rectifyingpotassium channel. Outward rectification is lost at high externalK(+) concentrations. Transcription factor involved in osteoblasticdifferentiation and skeletal morphogenesis (PubMed:28505335,PubMed:28738062, PubMed:28703881). Essential for the maturation ofosteoblasts and both intramembranous and endochondralossification. CBF binds to the core site, 5'-PYGPYGGT-3', of anumber of enhancers and promoters, including murine leukemiavirus, polyomavirus enhancer, T-cell receptor enhancers,osteocalcin, osteopontin, bone sialoprotein, alpha 1(I) collagen,LCK, IL-3 and GM-CSF promoters. In osteoblasts, supportstranscription activation: synergizes with SPEN/MINT to enhanceFGFR2-mediated activation of the osteocalcin FGF-responsiveelement (OCFRE) (By similarity). Inhibits KAT6B-dependenttranscriptional activation. {ECO:0000250,ECO:0000269|PubMed:11965546, ECO:0000269|PubMed:28505335,ECO:0000269|PubMed:28703881, ECO:0000269|PubMed:28738062}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneKCNK5chr6:39161945chr6:45479983ENST00000359534-4585_112211500IntramembranePore-forming%3B Name%3DPore-forming 1
HgeneKCNK5chr6:39161945chr6:45479983ENST00000359534-45134_157211500Topological domainCytoplasmic
HgeneKCNK5chr6:39161945chr6:45479983ENST00000359534-451_7211500Topological domainCytoplasmic
HgeneKCNK5chr6:39161945chr6:45479983ENST00000359534-45113_133211500TransmembraneHelical
HgeneKCNK5chr6:39161945chr6:45479983ENST00000359534-45158_180211500TransmembraneHelical
HgeneKCNK5chr6:39161945chr6:45479983ENST00000359534-458_26211500TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneKCNK5chr6:39161945chr6:45479983ENST00000359534-45190_215211500IntramembranePore-forming%3B Name%3DPore-forming 2
HgeneKCNK5chr6:39161945chr6:45479983ENST00000359534-45251_325211500Topological domainCytoplasmic
HgeneKCNK5chr6:39161945chr6:45479983ENST00000359534-45230_250211500TransmembraneHelical
TgeneRUNX2chr6:39161945chr6:45479983ENST00000359524+37237_521272508Compositional biasNote=Pro/Ser/Thr-rich
TgeneRUNX2chr6:39161945chr6:45479983ENST00000359524+3749_71272508Compositional biasNote=Poly-Gln
TgeneRUNX2chr6:39161945chr6:45479983ENST00000359524+3773_89272508Compositional biasNote=Poly-Ala
TgeneRUNX2chr6:39161945chr6:45479983ENST00000371436+47237_521286500Compositional biasNote=Pro/Ser/Thr-rich
TgeneRUNX2chr6:39161945chr6:45479983ENST00000371436+4749_71286500Compositional biasNote=Poly-Gln
TgeneRUNX2chr6:39161945chr6:45479983ENST00000371436+4773_89286500Compositional biasNote=Poly-Ala
TgeneRUNX2chr6:39161945chr6:45479983ENST00000371438+48237_521286522Compositional biasNote=Pro/Ser/Thr-rich
TgeneRUNX2chr6:39161945chr6:45479983ENST00000371438+4849_71286522Compositional biasNote=Poly-Gln
TgeneRUNX2chr6:39161945chr6:45479983ENST00000371438+4873_89286522Compositional biasNote=Poly-Ala
TgeneRUNX2chr6:39161945chr6:45479983ENST00000465038+59237_521286522Compositional biasNote=Pro/Ser/Thr-rich
TgeneRUNX2chr6:39161945chr6:45479983ENST00000465038+5949_71286522Compositional biasNote=Poly-Gln
TgeneRUNX2chr6:39161945chr6:45479983ENST00000465038+5973_89286522Compositional biasNote=Poly-Ala
TgeneRUNX2chr6:39161945chr6:45479983ENST00000359524+37101_229272508DomainRunt
TgeneRUNX2chr6:39161945chr6:45479983ENST00000371436+47101_229286500DomainRunt
TgeneRUNX2chr6:39161945chr6:45479983ENST00000371438+48101_229286522DomainRunt
TgeneRUNX2chr6:39161945chr6:45479983ENST00000465038+59101_229286522DomainRunt


Top

FusionGeneSequence for KCNK5_RUNX2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_KCNK5_ENST00000359534_chr6_39161945_-_RUNX2_ENST00000541979_chr6_45479983_+_425aa
MVDRGPLLTSAIIFYLAIGAAIFEVLEEPHWKEAKKNYYTQKLHLLKEFPCLGQEGLDKILEVVSDAAGQGVAITGNQTFNNWNWPNAMI
FAATVITTIGTGNVAPKTPAGRLFCVFTGLFGVPLCLTWISALGKFFGGRAKRLGQFLTKRGVSLRKAQITCTVIFIVWGVLVHLVIPPF
VFMVTEGWNYIEGLYYSFITISTIGFGDFVADPRQAQSSPPWSTDQSYPSYLSQMTSPSIHSTTPLSSTRGTGLPAITDVPRRISGASEL
GPFSDPRQFPSISSLTESRFSNPRMHTPATFTYTPPVTSGMSLGMSATTHYHTYLPPPYPGSSQSQSGPFQTSSTPTLYTGTSSGSTQFP

>In-frame_KCNK5_ENST00000359534_chr6_39161945_-_RUNX2_ENST00000465038_chr6_45479983_+_447aa
MVDRGPLLTSAIIFYLAIGAAIFEVLEEPHWKEAKKNYYTQKLHLLKEFPCLGQEGLDKILEVVSDAAGQGVAITGNQTFNNWNWPNAMI
FAATVITTIGTGNVAPKTPAGRLFCVFTGLFGVPLCLTWISALGKFFGGRAKRLGQFLTKRGVSLRKAQITCTVIFIVWGVLVHLVIPPF
VFMVTEGWNYIEGLYYSFITISTIGFGDFVADPRQAQSSPPWSTDQSYPSYLSQMTSPSIHSTTPLSSTRGTGLPAITDVPRRISDDDTA
TSDFCLWPSTLSKKSQAGASELGPFSDPRQFPSISSLTESRFSNPRMHTPATFTYTPPVTSGMSLGMSATTHYHTYLPPPYPGSSQSQSG

>In-frame_KCNK5_ENST00000359534_chr6_39161945_-_RUNX2_ENST00000352853_chr6_45479983_+_447aa
MVDRGPLLTSAIIFYLAIGAAIFEVLEEPHWKEAKKNYYTQKLHLLKEFPCLGQEGLDKILEVVSDAAGQGVAITGNQTFNNWNWPNAMI
FAATVITTIGTGNVAPKTPAGRLFCVFTGLFGVPLCLTWISALGKFFGGRAKRLGQFLTKRGVSLRKAQITCTVIFIVWGVLVHLVIPPF
VFMVTEGWNYIEGLYYSFITISTIGFGDFVADPRQAQSSPPWSTDQSYPSYLSQMTSPSIHSTTPLSSTRGTGLPAITDVPRRISDDDTA
TSDFCLWPSTLSKKSQAGASELGPFSDPRQFPSISSLTESRFSNPRMHTPATFTYTPPVTSGMSLGMSATTHYHTYLPPPYPGSSQSQSG

>In-frame_KCNK5_ENST00000359534_chr6_39161945_-_RUNX2_ENST00000371438_chr6_45479983_+_447aa
MVDRGPLLTSAIIFYLAIGAAIFEVLEEPHWKEAKKNYYTQKLHLLKEFPCLGQEGLDKILEVVSDAAGQGVAITGNQTFNNWNWPNAMI
FAATVITTIGTGNVAPKTPAGRLFCVFTGLFGVPLCLTWISALGKFFGGRAKRLGQFLTKRGVSLRKAQITCTVIFIVWGVLVHLVIPPF
VFMVTEGWNYIEGLYYSFITISTIGFGDFVADPRQAQSSPPWSTDQSYPSYLSQMTSPSIHSTTPLSSTRGTGLPAITDVPRRISDDDTA
TSDFCLWPSTLSKKSQAGASELGPFSDPRQFPSISSLTESRFSNPRMHTPATFTYTPPVTSGMSLGMSATTHYHTYLPPPYPGSSQSQSG

>In-frame_KCNK5_ENST00000359534_chr6_39161945_-_RUNX2_ENST00000371436_chr6_45479983_+_425aa
MVDRGPLLTSAIIFYLAIGAAIFEVLEEPHWKEAKKNYYTQKLHLLKEFPCLGQEGLDKILEVVSDAAGQGVAITGNQTFNNWNWPNAMI
FAATVITTIGTGNVAPKTPAGRLFCVFTGLFGVPLCLTWISALGKFFGGRAKRLGQFLTKRGVSLRKAQITCTVIFIVWGVLVHLVIPPF
VFMVTEGWNYIEGLYYSFITISTIGFGDFVADPRQAQSSPPWSTDQSYPSYLSQMTSPSIHSTTPLSSTRGTGLPAITDVPRRISGASEL
GPFSDPRQFPSISSLTESRFSNPRMHTPATFTYTPPVTSGMSLGMSATTHYHTYLPPPYPGSSQSQSGPFQTSSTPTLYTGTSSGSTQFP

>In-frame_KCNK5_ENST00000359534_chr6_39161945_-_RUNX2_ENST00000576263_chr6_45479983_+_468aa
MVDRGPLLTSAIIFYLAIGAAIFEVLEEPHWKEAKKNYYTQKLHLLKEFPCLGQEGLDKILEVVSDAAGQGVAITGNQTFNNWNWPNAMI
FAATVITTIGTGNVAPKTPAGRLFCVFTGLFGVPLCLTWISALGKFFGGRAKRLGQFLTKRGVSLRKAQITCTVIFIVWGVLVHLVIPPF
VFMVTEGWNYIEGLYYSFITISTIGFGDFVADPRQAQSSPPWSTDQSYPSYLSQMTSPSIHSTTPLSSTRGTGLPAITDVPRRISDSEPS
TLDSQSSTTLFLSSEEPGPSTAALPSPSSSSCEPQAFSPGPPALPPLLPPLPAASAPPGPGASRRTGRYSVVASSPEAAPRLVDWLPGCP
STISPSTRGDDKERPPPVLAPAEGPERSRAPRPSTAGREEGTVDAGTSPPPRARPAAAASLEAHVGDILVELRTMNGHLDSIARALTKLA

>In-frame_KCNK5_ENST00000359534_chr6_39161945_-_RUNX2_ENST00000371432_chr6_45479983_+_425aa
MVDRGPLLTSAIIFYLAIGAAIFEVLEEPHWKEAKKNYYTQKLHLLKEFPCLGQEGLDKILEVVSDAAGQGVAITGNQTFNNWNWPNAMI
FAATVITTIGTGNVAPKTPAGRLFCVFTGLFGVPLCLTWISALGKFFGGRAKRLGQFLTKRGVSLRKAQITCTVIFIVWGVLVHLVIPPF
VFMVTEGWNYIEGLYYSFITISTIGFGDFVADPRQAQSSPPWSTDQSYPSYLSQMTSPSIHSTTPLSSTRGTGLPAITDVPRRISGASEL
GPFSDPRQFPSISSLTESRFSNPRMHTPATFTYTPPVTSGMSLGMSATTHYHTYLPPPYPGSSQSQSGPFQTSSTPTLYTGTSSGSTQFP

>In-frame_KCNK5_ENST00000359534_chr6_39161945_-_RUNX2_ENST00000359524_chr6_45479983_+_447aa
MVDRGPLLTSAIIFYLAIGAAIFEVLEEPHWKEAKKNYYTQKLHLLKEFPCLGQEGLDKILEVVSDAAGQGVAITGNQTFNNWNWPNAMI
FAATVITTIGTGNVAPKTPAGRLFCVFTGLFGVPLCLTWISALGKFFGGRAKRLGQFLTKRGVSLRKAQITCTVIFIVWGVLVHLVIPPF
VFMVTEGWNYIEGLYYSFITISTIGFGDFVADPRQAQSSPPWSTDQSYPSYLSQMTSPSIHSTTPLSSTRGTGLPAITDVPRRISDDDTA
TSDFCLWPSTLSKKSQAGASELGPFSDPRQFPSISSLTESRFSNPRMHTPATFTYTPPVTSGMSLGMSATTHYHTYLPPPYPGSSQSQSG


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_KCNK5_ENST00000359534_chr6_39161945_-_RUNX2_ENST00000541979_chr6_45479983_+_1275nt
ATGGTGGACCGGGGCCCTCTGCTCACCTCGGCCATCATCTTCTACCTGGCCATCGGGGCGGCGATCTTCGAAGTGCTGGAGGAGCCACAC
TGGAAGGAGGCCAAGAAAAACTACTACACACAGAAGCTGCATCTGCTCAAGGAGTTCCCGTGCCTGGGTCAGGAGGGCCTGGACAAGATC
CTAGAGGTGGTATCTGATGCTGCAGGACAGGGTGTGGCCATCACAGGGAACCAGACCTTCAACAACTGGAACTGGCCCAATGCAATGATT
TTTGCAGCGACCGTCATTACCACCATTGGATATGGCAATGTGGCTCCCAAGACCCCCGCCGGTCGCCTCTTCTGTGTTTTCTATGGTCTC
TTCGGGGTGCCGCTCTGCCTGACGTGGATCAGTGCCCTGGGCAAGTTCTTCGGGGGACGTGCCAAGAGACTAGGGCAGTTCCTTACCAAG
AGAGGTGTGAGTCTGCGGAAGGCGCAGATCACGTGCACAGTCATCTTCATCGTGTGGGGCGTCCTAGTCCACCTGGTGATCCCACCCTTC
GTATTCATGGTGACTGAGGGGTGGAACTACATCGAGGGCCTCTACTACTCCTTCATCACCATCTCCACCATCGGCTTCGGTGACTTTGTG
GCCGACCCCAGGCAGGCACAGTCTTCCCCGCCGTGGTCCTATGACCAGTCTTACCCCTCCTACCTGAGCCAGATGACGTCCCCGTCCATC
CACTCTACCACCCCGCTGTCTTCCACACGGGGCACTGGGCTTCCTGCCATCACCGATGTGCCTAGGCGCATTTCAGGTGCTTCAGAACTG
GGCCCTTTTTCAGACCCCAGGCAGTTCCCAAGCATTTCATCCCTCACTGAGAGCCGCTTCTCCAACCCACGAATGCACTATCCAGCCACC
TTTACTTACACCCCGCCAGTCACCTCAGGCATGTCCCTCGGTATGTCCGCCACCACTCACTACCACACCTACCTGCCACCACCCTACCCC
GGCTCTTCCCAAAGCCAGAGTGGACCCTTCCAGACCAGCAGCACTCCATATCTCTACTATGGCACTTCGTCAGGATCCTATCAGTTTCCC
ATGGTGCCGGGGGGAGACCGGTCTCCTTCCAGAATGCTTCCGCCATGCACCACCACCTCGAATGGCAGCACGCTATTAAATCCAAATTTG
CCTAACCAGAATGATGGTGTTGACGCTGATGGAAGCCACAGCAGTTCCCCAACTGTTTTGAATTCTAGTGGCAGAATGGATGAATCTGTT

>In-frame_KCNK5_ENST00000359534_chr6_39161945_-_RUNX2_ENST00000465038_chr6_45479983_+_1341nt
ATGGTGGACCGGGGCCCTCTGCTCACCTCGGCCATCATCTTCTACCTGGCCATCGGGGCGGCGATCTTCGAAGTGCTGGAGGAGCCACAC
TGGAAGGAGGCCAAGAAAAACTACTACACACAGAAGCTGCATCTGCTCAAGGAGTTCCCGTGCCTGGGTCAGGAGGGCCTGGACAAGATC
CTAGAGGTGGTATCTGATGCTGCAGGACAGGGTGTGGCCATCACAGGGAACCAGACCTTCAACAACTGGAACTGGCCCAATGCAATGATT
TTTGCAGCGACCGTCATTACCACCATTGGATATGGCAATGTGGCTCCCAAGACCCCCGCCGGTCGCCTCTTCTGTGTTTTCTATGGTCTC
TTCGGGGTGCCGCTCTGCCTGACGTGGATCAGTGCCCTGGGCAAGTTCTTCGGGGGACGTGCCAAGAGACTAGGGCAGTTCCTTACCAAG
AGAGGTGTGAGTCTGCGGAAGGCGCAGATCACGTGCACAGTCATCTTCATCGTGTGGGGCGTCCTAGTCCACCTGGTGATCCCACCCTTC
GTATTCATGGTGACTGAGGGGTGGAACTACATCGAGGGCCTCTACTACTCCTTCATCACCATCTCCACCATCGGCTTCGGTGACTTTGTG
GCCGACCCCAGGCAGGCACAGTCTTCCCCGCCGTGGTCCTATGACCAGTCTTACCCCTCCTACCTGAGCCAGATGACGTCCCCGTCCATC
CACTCTACCACCCCGCTGTCTTCCACACGGGGCACTGGGCTTCCTGCCATCACCGATGTGCCTAGGCGCATTTCAGATGATGACACTGCC
ACCTCTGACTTCTGCCTCTGGCCTTCCACTCTCAGTAAGAAGAGCCAGGCAGGTGCTTCAGAACTGGGCCCTTTTTCAGACCCCAGGCAG
TTCCCAAGCATTTCATCCCTCACTGAGAGCCGCTTCTCCAACCCACGAATGCACTATCCAGCCACCTTTACTTACACCCCGCCAGTCACC
TCAGGCATGTCCCTCGGTATGTCCGCCACCACTCACTACCACACCTACCTGCCACCACCCTACCCCGGCTCTTCCCAAAGCCAGAGTGGA
CCCTTCCAGACCAGCAGCACTCCATATCTCTACTATGGCACTTCGTCAGGATCCTATCAGTTTCCCATGGTGCCGGGGGGAGACCGGTCT
CCTTCCAGAATGCTTCCGCCATGCACCACCACCTCGAATGGCAGCACGCTATTAAATCCAAATTTGCCTAACCAGAATGATGGTGTTGAC

>In-frame_KCNK5_ENST00000359534_chr6_39161945_-_RUNX2_ENST00000352853_chr6_45479983_+_1341nt
ATGGTGGACCGGGGCCCTCTGCTCACCTCGGCCATCATCTTCTACCTGGCCATCGGGGCGGCGATCTTCGAAGTGCTGGAGGAGCCACAC
TGGAAGGAGGCCAAGAAAAACTACTACACACAGAAGCTGCATCTGCTCAAGGAGTTCCCGTGCCTGGGTCAGGAGGGCCTGGACAAGATC
CTAGAGGTGGTATCTGATGCTGCAGGACAGGGTGTGGCCATCACAGGGAACCAGACCTTCAACAACTGGAACTGGCCCAATGCAATGATT
TTTGCAGCGACCGTCATTACCACCATTGGATATGGCAATGTGGCTCCCAAGACCCCCGCCGGTCGCCTCTTCTGTGTTTTCTATGGTCTC
TTCGGGGTGCCGCTCTGCCTGACGTGGATCAGTGCCCTGGGCAAGTTCTTCGGGGGACGTGCCAAGAGACTAGGGCAGTTCCTTACCAAG
AGAGGTGTGAGTCTGCGGAAGGCGCAGATCACGTGCACAGTCATCTTCATCGTGTGGGGCGTCCTAGTCCACCTGGTGATCCCACCCTTC
GTATTCATGGTGACTGAGGGGTGGAACTACATCGAGGGCCTCTACTACTCCTTCATCACCATCTCCACCATCGGCTTCGGTGACTTTGTG
GCCGACCCCAGGCAGGCACAGTCTTCCCCGCCGTGGTCCTATGACCAGTCTTACCCCTCCTACCTGAGCCAGATGACGTCCCCGTCCATC
CACTCTACCACCCCGCTGTCTTCCACACGGGGCACTGGGCTTCCTGCCATCACCGATGTGCCTAGGCGCATTTCAGATGATGACACTGCC
ACCTCTGACTTCTGCCTCTGGCCTTCCACTCTCAGTAAGAAGAGCCAGGCAGGTGCTTCAGAACTGGGCCCTTTTTCAGACCCCAGGCAG
TTCCCAAGCATTTCATCCCTCACTGAGAGCCGCTTCTCCAACCCACGAATGCACTATCCAGCCACCTTTACTTACACCCCGCCAGTCACC
TCAGGCATGTCCCTCGGTATGTCCGCCACCACTCACTACCACACCTACCTGCCACCACCCTACCCCGGCTCTTCCCAAAGCCAGAGTGGA
CCCTTCCAGACCAGCAGCACTCCATATCTCTACTATGGCACTTCGTCAGGATCCTATCAGTTTCCCATGGTGCCGGGGGGAGACCGGTCT
CCTTCCAGAATGCTTCCGCCATGCACCACCACCTCGAATGGCAGCACGCTATTAAATCCAAATTTGCCTAACCAGAATGATGGTGTTGAC

>In-frame_KCNK5_ENST00000359534_chr6_39161945_-_RUNX2_ENST00000371438_chr6_45479983_+_1341nt
ATGGTGGACCGGGGCCCTCTGCTCACCTCGGCCATCATCTTCTACCTGGCCATCGGGGCGGCGATCTTCGAAGTGCTGGAGGAGCCACAC
TGGAAGGAGGCCAAGAAAAACTACTACACACAGAAGCTGCATCTGCTCAAGGAGTTCCCGTGCCTGGGTCAGGAGGGCCTGGACAAGATC
CTAGAGGTGGTATCTGATGCTGCAGGACAGGGTGTGGCCATCACAGGGAACCAGACCTTCAACAACTGGAACTGGCCCAATGCAATGATT
TTTGCAGCGACCGTCATTACCACCATTGGATATGGCAATGTGGCTCCCAAGACCCCCGCCGGTCGCCTCTTCTGTGTTTTCTATGGTCTC
TTCGGGGTGCCGCTCTGCCTGACGTGGATCAGTGCCCTGGGCAAGTTCTTCGGGGGACGTGCCAAGAGACTAGGGCAGTTCCTTACCAAG
AGAGGTGTGAGTCTGCGGAAGGCGCAGATCACGTGCACAGTCATCTTCATCGTGTGGGGCGTCCTAGTCCACCTGGTGATCCCACCCTTC
GTATTCATGGTGACTGAGGGGTGGAACTACATCGAGGGCCTCTACTACTCCTTCATCACCATCTCCACCATCGGCTTCGGTGACTTTGTG
GCCGACCCCAGGCAGGCACAGTCTTCCCCGCCGTGGTCCTATGACCAGTCTTACCCCTCCTACCTGAGCCAGATGACGTCCCCGTCCATC
CACTCTACCACCCCGCTGTCTTCCACACGGGGCACTGGGCTTCCTGCCATCACCGATGTGCCTAGGCGCATTTCAGATGATGACACTGCC
ACCTCTGACTTCTGCCTCTGGCCTTCCACTCTCAGTAAGAAGAGCCAGGCAGGTGCTTCAGAACTGGGCCCTTTTTCAGACCCCAGGCAG
TTCCCAAGCATTTCATCCCTCACTGAGAGCCGCTTCTCCAACCCACGAATGCACTATCCAGCCACCTTTACTTACACCCCGCCAGTCACC
TCAGGCATGTCCCTCGGTATGTCCGCCACCACTCACTACCACACCTACCTGCCACCACCCTACCCCGGCTCTTCCCAAAGCCAGAGTGGA
CCCTTCCAGACCAGCAGCACTCCATATCTCTACTATGGCACTTCGTCAGGATCCTATCAGTTTCCCATGGTGCCGGGGGGAGACCGGTCT
CCTTCCAGAATGCTTCCGCCATGCACCACCACCTCGAATGGCAGCACGCTATTAAATCCAAATTTGCCTAACCAGAATGATGGTGTTGAC

>In-frame_KCNK5_ENST00000359534_chr6_39161945_-_RUNX2_ENST00000371436_chr6_45479983_+_1275nt
ATGGTGGACCGGGGCCCTCTGCTCACCTCGGCCATCATCTTCTACCTGGCCATCGGGGCGGCGATCTTCGAAGTGCTGGAGGAGCCACAC
TGGAAGGAGGCCAAGAAAAACTACTACACACAGAAGCTGCATCTGCTCAAGGAGTTCCCGTGCCTGGGTCAGGAGGGCCTGGACAAGATC
CTAGAGGTGGTATCTGATGCTGCAGGACAGGGTGTGGCCATCACAGGGAACCAGACCTTCAACAACTGGAACTGGCCCAATGCAATGATT
TTTGCAGCGACCGTCATTACCACCATTGGATATGGCAATGTGGCTCCCAAGACCCCCGCCGGTCGCCTCTTCTGTGTTTTCTATGGTCTC
TTCGGGGTGCCGCTCTGCCTGACGTGGATCAGTGCCCTGGGCAAGTTCTTCGGGGGACGTGCCAAGAGACTAGGGCAGTTCCTTACCAAG
AGAGGTGTGAGTCTGCGGAAGGCGCAGATCACGTGCACAGTCATCTTCATCGTGTGGGGCGTCCTAGTCCACCTGGTGATCCCACCCTTC
GTATTCATGGTGACTGAGGGGTGGAACTACATCGAGGGCCTCTACTACTCCTTCATCACCATCTCCACCATCGGCTTCGGTGACTTTGTG
GCCGACCCCAGGCAGGCACAGTCTTCCCCGCCGTGGTCCTATGACCAGTCTTACCCCTCCTACCTGAGCCAGATGACGTCCCCGTCCATC
CACTCTACCACCCCGCTGTCTTCCACACGGGGCACTGGGCTTCCTGCCATCACCGATGTGCCTAGGCGCATTTCAGGTGCTTCAGAACTG
GGCCCTTTTTCAGACCCCAGGCAGTTCCCAAGCATTTCATCCCTCACTGAGAGCCGCTTCTCCAACCCACGAATGCACTATCCAGCCACC
TTTACTTACACCCCGCCAGTCACCTCAGGCATGTCCCTCGGTATGTCCGCCACCACTCACTACCACACCTACCTGCCACCACCCTACCCC
GGCTCTTCCCAAAGCCAGAGTGGACCCTTCCAGACCAGCAGCACTCCATATCTCTACTATGGCACTTCGTCAGGATCCTATCAGTTTCCC
ATGGTGCCGGGGGGAGACCGGTCTCCTTCCAGAATGCTTCCGCCATGCACCACCACCTCGAATGGCAGCACGCTATTAAATCCAAATTTG
CCTAACCAGAATGATGGTGTTGACGCTGATGGAAGCCACAGCAGTTCCCCAACTGTTTTGAATTCTAGTGGCAGAATGGATGAATCTGTT

>In-frame_KCNK5_ENST00000359534_chr6_39161945_-_RUNX2_ENST00000576263_chr6_45479983_+_1404nt
ATGGTGGACCGGGGCCCTCTGCTCACCTCGGCCATCATCTTCTACCTGGCCATCGGGGCGGCGATCTTCGAAGTGCTGGAGGAGCCACAC
TGGAAGGAGGCCAAGAAAAACTACTACACACAGAAGCTGCATCTGCTCAAGGAGTTCCCGTGCCTGGGTCAGGAGGGCCTGGACAAGATC
CTAGAGGTGGTATCTGATGCTGCAGGACAGGGTGTGGCCATCACAGGGAACCAGACCTTCAACAACTGGAACTGGCCCAATGCAATGATT
TTTGCAGCGACCGTCATTACCACCATTGGATATGGCAATGTGGCTCCCAAGACCCCCGCCGGTCGCCTCTTCTGTGTTTTCTATGGTCTC
TTCGGGGTGCCGCTCTGCCTGACGTGGATCAGTGCCCTGGGCAAGTTCTTCGGGGGACGTGCCAAGAGACTAGGGCAGTTCCTTACCAAG
AGAGGTGTGAGTCTGCGGAAGGCGCAGATCACGTGCACAGTCATCTTCATCGTGTGGGGCGTCCTAGTCCACCTGGTGATCCCACCCTTC
GTATTCATGGTGACTGAGGGGTGGAACTACATCGAGGGCCTCTACTACTCCTTCATCACCATCTCCACCATCGGCTTCGGTGACTTTGTG
GCCGACCCCAGGCAGGCACAGTCTTCCCCGCCGTGGTCCTATGACCAGTCTTACCCCTCCTACCTGAGCCAGATGACGTCCCCGTCCATC
CACTCTACCACCCCGCTGTCTTCCACACGGGGCACTGGGCTTCCTGCCATCACCGATGTGCCTAGGCGCATTTCAGATTCAGAGCCCAGT
ACCTTGGACTCCCAGTCTTCGACCACCTTGTTCCTCTCCTCGGAGGAGCCAGGCCCCTCCACCGCCGCCCTGCCATCTCCCTCCTCCTCT
TCCTGCGAGCCTCAGGCCTTTTCCCCAGGTCCGCCAGCGCTGCCTCCGCTGTTGCCTCCGCTCCCCGCAGCCTCGGCGCCCCCAGGCCCC
GGCGCCTCCCGGCGCACAGGCCGCTACTCAGTCGTCGCCTCCTCCCCGGAGGCCGCCCCGCGTCTGGTCGACTGGCTCCCCGGTTGCCCT
TCGACCATCTCTCCCAGCACACGCGGGGATGACAAGGAGCGGCCGCCGCCCGTCCTGGCACCGGCCGAGGGCCCGGAAAGGAGCCGCGCC
CCGCGCCCCAGCACTGCGGGCAGGGAGGAGGGCACCGTGGACGCGGGTACATCCCCGCCGCCCCGAGCCCGGCCCGCCGCTGCGGCGAGC
TTGGAGGCCCACGTCGGGGACATCCTGGTGGAGCTGCGGACCATGAACGGCCACCTGGACAGCATAGCGCGGGCCCTCACCAAACTGGCT

>In-frame_KCNK5_ENST00000359534_chr6_39161945_-_RUNX2_ENST00000371432_chr6_45479983_+_1275nt
ATGGTGGACCGGGGCCCTCTGCTCACCTCGGCCATCATCTTCTACCTGGCCATCGGGGCGGCGATCTTCGAAGTGCTGGAGGAGCCACAC
TGGAAGGAGGCCAAGAAAAACTACTACACACAGAAGCTGCATCTGCTCAAGGAGTTCCCGTGCCTGGGTCAGGAGGGCCTGGACAAGATC
CTAGAGGTGGTATCTGATGCTGCAGGACAGGGTGTGGCCATCACAGGGAACCAGACCTTCAACAACTGGAACTGGCCCAATGCAATGATT
TTTGCAGCGACCGTCATTACCACCATTGGATATGGCAATGTGGCTCCCAAGACCCCCGCCGGTCGCCTCTTCTGTGTTTTCTATGGTCTC
TTCGGGGTGCCGCTCTGCCTGACGTGGATCAGTGCCCTGGGCAAGTTCTTCGGGGGACGTGCCAAGAGACTAGGGCAGTTCCTTACCAAG
AGAGGTGTGAGTCTGCGGAAGGCGCAGATCACGTGCACAGTCATCTTCATCGTGTGGGGCGTCCTAGTCCACCTGGTGATCCCACCCTTC
GTATTCATGGTGACTGAGGGGTGGAACTACATCGAGGGCCTCTACTACTCCTTCATCACCATCTCCACCATCGGCTTCGGTGACTTTGTG
GCCGACCCCAGGCAGGCACAGTCTTCCCCGCCGTGGTCCTATGACCAGTCTTACCCCTCCTACCTGAGCCAGATGACGTCCCCGTCCATC
CACTCTACCACCCCGCTGTCTTCCACACGGGGCACTGGGCTTCCTGCCATCACCGATGTGCCTAGGCGCATTTCAGGTGCTTCAGAACTG
GGCCCTTTTTCAGACCCCAGGCAGTTCCCAAGCATTTCATCCCTCACTGAGAGCCGCTTCTCCAACCCACGAATGCACTATCCAGCCACC
TTTACTTACACCCCGCCAGTCACCTCAGGCATGTCCCTCGGTATGTCCGCCACCACTCACTACCACACCTACCTGCCACCACCCTACCCC
GGCTCTTCCCAAAGCCAGAGTGGACCCTTCCAGACCAGCAGCACTCCATATCTCTACTATGGCACTTCGTCAGGATCCTATCAGTTTCCC
ATGGTGCCGGGGGGAGACCGGTCTCCTTCCAGAATGCTTCCGCCATGCACCACCACCTCGAATGGCAGCACGCTATTAAATCCAAATTTG
CCTAACCAGAATGATGGTGTTGACGCTGATGGAAGCCACAGCAGTTCCCCAACTGTTTTGAATTCTAGTGGCAGAATGGATGAATCTGTT

>In-frame_KCNK5_ENST00000359534_chr6_39161945_-_RUNX2_ENST00000359524_chr6_45479983_+_1341nt
ATGGTGGACCGGGGCCCTCTGCTCACCTCGGCCATCATCTTCTACCTGGCCATCGGGGCGGCGATCTTCGAAGTGCTGGAGGAGCCACAC
TGGAAGGAGGCCAAGAAAAACTACTACACACAGAAGCTGCATCTGCTCAAGGAGTTCCCGTGCCTGGGTCAGGAGGGCCTGGACAAGATC
CTAGAGGTGGTATCTGATGCTGCAGGACAGGGTGTGGCCATCACAGGGAACCAGACCTTCAACAACTGGAACTGGCCCAATGCAATGATT
TTTGCAGCGACCGTCATTACCACCATTGGATATGGCAATGTGGCTCCCAAGACCCCCGCCGGTCGCCTCTTCTGTGTTTTCTATGGTCTC
TTCGGGGTGCCGCTCTGCCTGACGTGGATCAGTGCCCTGGGCAAGTTCTTCGGGGGACGTGCCAAGAGACTAGGGCAGTTCCTTACCAAG
AGAGGTGTGAGTCTGCGGAAGGCGCAGATCACGTGCACAGTCATCTTCATCGTGTGGGGCGTCCTAGTCCACCTGGTGATCCCACCCTTC
GTATTCATGGTGACTGAGGGGTGGAACTACATCGAGGGCCTCTACTACTCCTTCATCACCATCTCCACCATCGGCTTCGGTGACTTTGTG
GCCGACCCCAGGCAGGCACAGTCTTCCCCGCCGTGGTCCTATGACCAGTCTTACCCCTCCTACCTGAGCCAGATGACGTCCCCGTCCATC
CACTCTACCACCCCGCTGTCTTCCACACGGGGCACTGGGCTTCCTGCCATCACCGATGTGCCTAGGCGCATTTCAGATGATGACACTGCC
ACCTCTGACTTCTGCCTCTGGCCTTCCACTCTCAGTAAGAAGAGCCAGGCAGGTGCTTCAGAACTGGGCCCTTTTTCAGACCCCAGGCAG
TTCCCAAGCATTTCATCCCTCACTGAGAGCCGCTTCTCCAACCCACGAATGCACTATCCAGCCACCTTTACTTACACCCCGCCAGTCACC
TCAGGCATGTCCCTCGGTATGTCCGCCACCACTCACTACCACACCTACCTGCCACCACCCTACCCCGGCTCTTCCCAAAGCCAGAGTGGA
CCCTTCCAGACCAGCAGCACTCCATATCTCTACTATGGCACTTCGTCAGGATCCTATCAGTTTCCCATGGTGCCGGGGGGAGACCGGTCT
CCTTCCAGAATGCTTCCGCCATGCACCACCACCTCGAATGGCAGCACGCTATTAAATCCAAATTTGCCTAACCAGAATGATGGTGTTGAC


* Fusion transcript sequences (Full-length transcript).
>In-frame_KCNK5_ENST00000359534_chr6_39161945_-_RUNX2_ENST00000541979_chr6_45479983_+_1614nt
AGCGACGCGTGGAGAAGCGGCCCACGTGTCTGCCCAGAGTCAAGTCCTGTGTTCTTCCCGCTCCTTACGCATCCGCGGTCCAGGGCGCCC
TTTCAGCCCCGCTGGTGTTCGCCCACCCCGGGCCGCGTGAGTGGGGCCCCACGCAGCTCCCCGCACTCCGTGGGCCAACTTGGCCAAGCA
ACTCTGTCCGGGGAGCGGTGCTTGCGGGGGGTGAGTACCGGGCACTGCGCATGCGGAGCTCCAAATTCAAACAGCTGTTTTCAGAGGCTG
GAGGGCGGGCGGACTGGTAGCAGCTGGGGCTAGGAGAGGCTTTCTCTAGGAGGCGGCCGCTCGGGAGCCATGGTGGACCGGGGCCCTCTG
CTCACCTCGGCCATCATCTTCTACCTGGCCATCGGGGCGGCGATCTTCGAAGTGCTGGAGGAGCCACACTGGAAGGAGGCCAAGAAAAAC
TACTACACACAGAAGCTGCATCTGCTCAAGGAGTTCCCGTGCCTGGGTCAGGAGGGCCTGGACAAGATCCTAGAGGTGGTATCTGATGCT
GCAGGACAGGGTGTGGCCATCACAGGGAACCAGACCTTCAACAACTGGAACTGGCCCAATGCAATGATTTTTGCAGCGACCGTCATTACC
ACCATTGGATATGGCAATGTGGCTCCCAAGACCCCCGCCGGTCGCCTCTTCTGTGTTTTCTATGGTCTCTTCGGGGTGCCGCTCTGCCTG
ACGTGGATCAGTGCCCTGGGCAAGTTCTTCGGGGGACGTGCCAAGAGACTAGGGCAGTTCCTTACCAAGAGAGGTGTGAGTCTGCGGAAG
GCGCAGATCACGTGCACAGTCATCTTCATCGTGTGGGGCGTCCTAGTCCACCTGGTGATCCCACCCTTCGTATTCATGGTGACTGAGGGG
TGGAACTACATCGAGGGCCTCTACTACTCCTTCATCACCATCTCCACCATCGGCTTCGGTGACTTTGTGGCCGACCCCAGGCAGGCACAG
TCTTCCCCGCCGTGGTCCTATGACCAGTCTTACCCCTCCTACCTGAGCCAGATGACGTCCCCGTCCATCCACTCTACCACCCCGCTGTCT
TCCACACGGGGCACTGGGCTTCCTGCCATCACCGATGTGCCTAGGCGCATTTCAGGTGCTTCAGAACTGGGCCCTTTTTCAGACCCCAGG
CAGTTCCCAAGCATTTCATCCCTCACTGAGAGCCGCTTCTCCAACCCACGAATGCACTATCCAGCCACCTTTACTTACACCCCGCCAGTC
ACCTCAGGCATGTCCCTCGGTATGTCCGCCACCACTCACTACCACACCTACCTGCCACCACCCTACCCCGGCTCTTCCCAAAGCCAGAGT
GGACCCTTCCAGACCAGCAGCACTCCATATCTCTACTATGGCACTTCGTCAGGATCCTATCAGTTTCCCATGGTGCCGGGGGGAGACCGG
TCTCCTTCCAGAATGCTTCCGCCATGCACCACCACCTCGAATGGCAGCACGCTATTAAATCCAAATTTGCCTAACCAGAATGATGGTGTT

>In-frame_KCNK5_ENST00000359534_chr6_39161945_-_RUNX2_ENST00000465038_chr6_45479983_+_1680nt
AGCGACGCGTGGAGAAGCGGCCCACGTGTCTGCCCAGAGTCAAGTCCTGTGTTCTTCCCGCTCCTTACGCATCCGCGGTCCAGGGCGCCC
TTTCAGCCCCGCTGGTGTTCGCCCACCCCGGGCCGCGTGAGTGGGGCCCCACGCAGCTCCCCGCACTCCGTGGGCCAACTTGGCCAAGCA
ACTCTGTCCGGGGAGCGGTGCTTGCGGGGGGTGAGTACCGGGCACTGCGCATGCGGAGCTCCAAATTCAAACAGCTGTTTTCAGAGGCTG
GAGGGCGGGCGGACTGGTAGCAGCTGGGGCTAGGAGAGGCTTTCTCTAGGAGGCGGCCGCTCGGGAGCCATGGTGGACCGGGGCCCTCTG
CTCACCTCGGCCATCATCTTCTACCTGGCCATCGGGGCGGCGATCTTCGAAGTGCTGGAGGAGCCACACTGGAAGGAGGCCAAGAAAAAC
TACTACACACAGAAGCTGCATCTGCTCAAGGAGTTCCCGTGCCTGGGTCAGGAGGGCCTGGACAAGATCCTAGAGGTGGTATCTGATGCT
GCAGGACAGGGTGTGGCCATCACAGGGAACCAGACCTTCAACAACTGGAACTGGCCCAATGCAATGATTTTTGCAGCGACCGTCATTACC
ACCATTGGATATGGCAATGTGGCTCCCAAGACCCCCGCCGGTCGCCTCTTCTGTGTTTTCTATGGTCTCTTCGGGGTGCCGCTCTGCCTG
ACGTGGATCAGTGCCCTGGGCAAGTTCTTCGGGGGACGTGCCAAGAGACTAGGGCAGTTCCTTACCAAGAGAGGTGTGAGTCTGCGGAAG
GCGCAGATCACGTGCACAGTCATCTTCATCGTGTGGGGCGTCCTAGTCCACCTGGTGATCCCACCCTTCGTATTCATGGTGACTGAGGGG
TGGAACTACATCGAGGGCCTCTACTACTCCTTCATCACCATCTCCACCATCGGCTTCGGTGACTTTGTGGCCGACCCCAGGCAGGCACAG
TCTTCCCCGCCGTGGTCCTATGACCAGTCTTACCCCTCCTACCTGAGCCAGATGACGTCCCCGTCCATCCACTCTACCACCCCGCTGTCT
TCCACACGGGGCACTGGGCTTCCTGCCATCACCGATGTGCCTAGGCGCATTTCAGATGATGACACTGCCACCTCTGACTTCTGCCTCTGG
CCTTCCACTCTCAGTAAGAAGAGCCAGGCAGGTGCTTCAGAACTGGGCCCTTTTTCAGACCCCAGGCAGTTCCCAAGCATTTCATCCCTC
ACTGAGAGCCGCTTCTCCAACCCACGAATGCACTATCCAGCCACCTTTACTTACACCCCGCCAGTCACCTCAGGCATGTCCCTCGGTATG
TCCGCCACCACTCACTACCACACCTACCTGCCACCACCCTACCCCGGCTCTTCCCAAAGCCAGAGTGGACCCTTCCAGACCAGCAGCACT
CCATATCTCTACTATGGCACTTCGTCAGGATCCTATCAGTTTCCCATGGTGCCGGGGGGAGACCGGTCTCCTTCCAGAATGCTTCCGCCA
TGCACCACCACCTCGAATGGCAGCACGCTATTAAATCCAAATTTGCCTAACCAGAATGATGGTGTTGACGCTGATGGAAGCCACAGCAGT

>In-frame_KCNK5_ENST00000359534_chr6_39161945_-_RUNX2_ENST00000352853_chr6_45479983_+_1680nt
AGCGACGCGTGGAGAAGCGGCCCACGTGTCTGCCCAGAGTCAAGTCCTGTGTTCTTCCCGCTCCTTACGCATCCGCGGTCCAGGGCGCCC
TTTCAGCCCCGCTGGTGTTCGCCCACCCCGGGCCGCGTGAGTGGGGCCCCACGCAGCTCCCCGCACTCCGTGGGCCAACTTGGCCAAGCA
ACTCTGTCCGGGGAGCGGTGCTTGCGGGGGGTGAGTACCGGGCACTGCGCATGCGGAGCTCCAAATTCAAACAGCTGTTTTCAGAGGCTG
GAGGGCGGGCGGACTGGTAGCAGCTGGGGCTAGGAGAGGCTTTCTCTAGGAGGCGGCCGCTCGGGAGCCATGGTGGACCGGGGCCCTCTG
CTCACCTCGGCCATCATCTTCTACCTGGCCATCGGGGCGGCGATCTTCGAAGTGCTGGAGGAGCCACACTGGAAGGAGGCCAAGAAAAAC
TACTACACACAGAAGCTGCATCTGCTCAAGGAGTTCCCGTGCCTGGGTCAGGAGGGCCTGGACAAGATCCTAGAGGTGGTATCTGATGCT
GCAGGACAGGGTGTGGCCATCACAGGGAACCAGACCTTCAACAACTGGAACTGGCCCAATGCAATGATTTTTGCAGCGACCGTCATTACC
ACCATTGGATATGGCAATGTGGCTCCCAAGACCCCCGCCGGTCGCCTCTTCTGTGTTTTCTATGGTCTCTTCGGGGTGCCGCTCTGCCTG
ACGTGGATCAGTGCCCTGGGCAAGTTCTTCGGGGGACGTGCCAAGAGACTAGGGCAGTTCCTTACCAAGAGAGGTGTGAGTCTGCGGAAG
GCGCAGATCACGTGCACAGTCATCTTCATCGTGTGGGGCGTCCTAGTCCACCTGGTGATCCCACCCTTCGTATTCATGGTGACTGAGGGG
TGGAACTACATCGAGGGCCTCTACTACTCCTTCATCACCATCTCCACCATCGGCTTCGGTGACTTTGTGGCCGACCCCAGGCAGGCACAG
TCTTCCCCGCCGTGGTCCTATGACCAGTCTTACCCCTCCTACCTGAGCCAGATGACGTCCCCGTCCATCCACTCTACCACCCCGCTGTCT
TCCACACGGGGCACTGGGCTTCCTGCCATCACCGATGTGCCTAGGCGCATTTCAGATGATGACACTGCCACCTCTGACTTCTGCCTCTGG
CCTTCCACTCTCAGTAAGAAGAGCCAGGCAGGTGCTTCAGAACTGGGCCCTTTTTCAGACCCCAGGCAGTTCCCAAGCATTTCATCCCTC
ACTGAGAGCCGCTTCTCCAACCCACGAATGCACTATCCAGCCACCTTTACTTACACCCCGCCAGTCACCTCAGGCATGTCCCTCGGTATG
TCCGCCACCACTCACTACCACACCTACCTGCCACCACCCTACCCCGGCTCTTCCCAAAGCCAGAGTGGACCCTTCCAGACCAGCAGCACT
CCATATCTCTACTATGGCACTTCGTCAGGATCCTATCAGTTTCCCATGGTGCCGGGGGGAGACCGGTCTCCTTCCAGAATGCTTCCGCCA
TGCACCACCACCTCGAATGGCAGCACGCTATTAAATCCAAATTTGCCTAACCAGAATGATGGTGTTGACGCTGATGGAAGCCACAGCAGT

>In-frame_KCNK5_ENST00000359534_chr6_39161945_-_RUNX2_ENST00000371438_chr6_45479983_+_5454nt
AGCGACGCGTGGAGAAGCGGCCCACGTGTCTGCCCAGAGTCAAGTCCTGTGTTCTTCCCGCTCCTTACGCATCCGCGGTCCAGGGCGCCC
TTTCAGCCCCGCTGGTGTTCGCCCACCCCGGGCCGCGTGAGTGGGGCCCCACGCAGCTCCCCGCACTCCGTGGGCCAACTTGGCCAAGCA
ACTCTGTCCGGGGAGCGGTGCTTGCGGGGGGTGAGTACCGGGCACTGCGCATGCGGAGCTCCAAATTCAAACAGCTGTTTTCAGAGGCTG
GAGGGCGGGCGGACTGGTAGCAGCTGGGGCTAGGAGAGGCTTTCTCTAGGAGGCGGCCGCTCGGGAGCCATGGTGGACCGGGGCCCTCTG
CTCACCTCGGCCATCATCTTCTACCTGGCCATCGGGGCGGCGATCTTCGAAGTGCTGGAGGAGCCACACTGGAAGGAGGCCAAGAAAAAC
TACTACACACAGAAGCTGCATCTGCTCAAGGAGTTCCCGTGCCTGGGTCAGGAGGGCCTGGACAAGATCCTAGAGGTGGTATCTGATGCT
GCAGGACAGGGTGTGGCCATCACAGGGAACCAGACCTTCAACAACTGGAACTGGCCCAATGCAATGATTTTTGCAGCGACCGTCATTACC
ACCATTGGATATGGCAATGTGGCTCCCAAGACCCCCGCCGGTCGCCTCTTCTGTGTTTTCTATGGTCTCTTCGGGGTGCCGCTCTGCCTG
ACGTGGATCAGTGCCCTGGGCAAGTTCTTCGGGGGACGTGCCAAGAGACTAGGGCAGTTCCTTACCAAGAGAGGTGTGAGTCTGCGGAAG
GCGCAGATCACGTGCACAGTCATCTTCATCGTGTGGGGCGTCCTAGTCCACCTGGTGATCCCACCCTTCGTATTCATGGTGACTGAGGGG
TGGAACTACATCGAGGGCCTCTACTACTCCTTCATCACCATCTCCACCATCGGCTTCGGTGACTTTGTGGCCGACCCCAGGCAGGCACAG
TCTTCCCCGCCGTGGTCCTATGACCAGTCTTACCCCTCCTACCTGAGCCAGATGACGTCCCCGTCCATCCACTCTACCACCCCGCTGTCT
TCCACACGGGGCACTGGGCTTCCTGCCATCACCGATGTGCCTAGGCGCATTTCAGATGATGACACTGCCACCTCTGACTTCTGCCTCTGG
CCTTCCACTCTCAGTAAGAAGAGCCAGGCAGGTGCTTCAGAACTGGGCCCTTTTTCAGACCCCAGGCAGTTCCCAAGCATTTCATCCCTC
ACTGAGAGCCGCTTCTCCAACCCACGAATGCACTATCCAGCCACCTTTACTTACACCCCGCCAGTCACCTCAGGCATGTCCCTCGGTATG
TCCGCCACCACTCACTACCACACCTACCTGCCACCACCCTACCCCGGCTCTTCCCAAAGCCAGAGTGGACCCTTCCAGACCAGCAGCACT
CCATATCTCTACTATGGCACTTCGTCAGGATCCTATCAGTTTCCCATGGTGCCGGGGGGAGACCGGTCTCCTTCCAGAATGCTTCCGCCA
TGCACCACCACCTCGAATGGCAGCACGCTATTAAATCCAAATTTGCCTAACCAGAATGATGGTGTTGACGCTGATGGAAGCCACAGCAGT
TCCCCAACTGTTTTGAATTCTAGTGGCAGAATGGATGAATCTGTTTGGCGACCATATTGAAATTCCTCAGCAGTGGCCCAGTGGTATCTG
GGGGCCACATCCCACACGTATCAATATATACATATATAGAGAGAGTGCATATATATGTATATCGATTAGCTATCTACAAAGTGCCTATTT
TTTAGAAGATTTTTCATTCACTCACTCAGTCATGATCTTGCAGCCATAAGAGGGTAGATATTGAGAAGCAGAAGGCTCAAGAGAGACAAT
TGCAATCGAGCTTCAGATTGTTTACTATTTAAGATGTACTTTTACAAAGGAACAAAGAAGGGAAAAGGTATTTTTGTTTTTGTTGTTTGG
TCTGTTATCATCAATAACCTGTTCATATGCCAATTCAGAGAGGTGGACTCCAGGTTCAGGAGGGAGAAGAGCAAAGCCGCTTCCTCTCTG
TGCTTTGAAACTTCACACCCTCACGGTGGCAGCTGTGTATGGACCAGTGCCCTCCGCAGACAGCTCACAAAACCAGTTGAGGTGCACTAA
AGGGACATGAGGTAGAATGGATGCTTCCATCACAGTACCATCATTCAGAATAACTCTTCCAATTTCTGCTTTCAGACATGCTGCAGGTCC
TCATCTGAACTGTTGGGTTCGTTTTTTTTTTTTTTTTTCCTGCTCCAAGAAAGTGACTTCAAAAATAACTGATCAGGATAGATTATTTTA
TTTTACTTTTTAACACTCCTTCTCCCCTTTTCCCACTGAACCAAAAAGAAATCCCATCCCTAAAACCTGCCTTCTCCTTTTATGCAAAAC
TGAAAATGGCAATACATTATTATAGCCATAATGGTATAGATAGTGATTGCGTTTGGCTATGTGTTGTTTTCTTTTTTTTTAAATTATGAA
TATGTGTAAAATCTGAGGTAACTTGCTAACGTGAATGGTCATATAACTTTAAAGATATATTTATAATTATTTAATGACATTTGGACCCTT
GAAACATTTCTTAGTGTATTGATATGTTGACTTCGGTCTCTAAAAGTGCTCTTTATTAAATAACAAATTTCTTCAGTGGTCTAGAGCCAT
ATCTGAAATATTGCTAAGCAATTTCAGTTCATCCAGGCACAATGTGATTTTAAAAAATACTTCCATCTCCAAATATTTTAGATATAGATT
GTTTTTGTGATGTATGAAGGAAATGTTATGTTTAGTTCTTTCAGATCTTTGAATGCCTCTAACACAGCTTTGCCTTCTAAAGCGGTAATT
AGGGATTTAAAAAACAACCTTTAGCCCTTTATCAGCATGAAATGCTGGAGTGATGTGGTTTTCTAATTTCTTTGGGGTAATTATGACTCT
TGTCATATTAAAAAGACAAGCACAAGTAAATCATTGAACTACAGAAAAATGTTCTGTGGTTTCATAGTTAAGCAAAACTCTAAATCGCCA
GGCTTCATAGCAAAGACATAGTCAGCTAAAAGCCGCACATGTGGATAGAGGGTTCAATTATGAGACACCTAGTACAGGAGAGCAAAATTG
CACCAGAGATTCTTAACCAACCAGCCTTACCAAACAACACAACAGGGGAACCCCAATCTGCCTTACCCAAGGCCCCACTGGCAGCTTTCC
ACAGAATTTGCATTTAGAGGAGCAGAATGACATCACTGTCCTTTGGGAGTAGGTCCTCTGAAAAGGCAGCAGGTTCCAGCAGGTAGCTGA
GCTGAGAGGACATATGGCCCACGGGGACCTACAGACAGCCTTTGACATTTGTATTTCTTACAATGGAGGGCCAAGGAGGGCAAGGGGCTG
TGGAGTTTGGTGTCTACTAGTGTGTATGAATTTGAGCTAGAGTCCTTCTGTGGCATGCACTTTGACCACTCCTGGCAGTCACATGGCAGA
TTTCCAAGTGCAAATCCTTAATCCAAACAAGGATCATCTAATGACACCACCAGGCCAATCCCTGCTCTCCTCCCCGAAAAGTCAGGGTCC
CTTCATTGGAATCCTCCACCCACCCAAGCAGAATTTAGCAGAGATTTGCCTTCAAACCCTAACGGCCCCCTTGTTCTCTGGTCCTTCTCA
AACCCACCTTTGTAGGCCACCCAGCATTGCAGGACAGCGTGTGGGGCAGCTGGACCTGTGCTTCCTGCCTGGGAGTCTCCCTTGGAATTC
ATCCTGACTCCTTCTAATAAAAATGGATGGGAAAGCAAAACACTTTGCCTTCTAAAGGCCGTATACCAAGTATGCTTAGATAAATAAGCC
ACTTTTCTATTACTTAAGTAAGAAGGAAGTAGTAATTGATACTATTTATTGTTTGTGTGTGGTAGCTTGAAGCACACCACTGTCCATTTA
TTTGTAAGTGTAAAATATGTGTGTTTGTTTCAGCAGCACTTAAAAAAGCCAGTGTCTGGTTACACATTTCAATTTTAATTAATTGACATA
AAAATGCTACCGCCAGTGCCAGCTGCATCCTATTTAATTAAAAAGGTACTATATTTGTACATTATTTTTTAATGTTAAAAGGGCTTTTTT
AAGTTTACAGTACACATACCGAGTGACTTTAGGGATGCTTTTGTGTTGAAATGTTACTATAGTGGCTGCAGGCAGCAACCCAGAAACACT
TTAGAAGCTTTTTTTCCTTGGGAAAAATTCAAGCACTTCTTCCCTCCACCCTCACTCCAACCACCCCAATGGGGGTAATTCACATTTCTT
AGAACAAATTCTGCCCTTTTTTGGTCTAGGGATTAAAATTTTGTTTTTCTTTCTTTCTTTTTTTTTTTTTTTCACTGAACCCTTAATTTG
CACTGGGTCATGTGTTTGATTTGTGATTTCAAGACCAAAGCAAAGTCTTACTACTACTGTGGAACCATGTACTAGTTCCTGGGAATTAAA
ATAGCGTGGTTCTCTTTGTAGCACAAACATTGCTGGAATTTGCAGTCTTTTCAATGCAGCCACATTTTTATCCATTTCAGTTGTCTCACA
AATTTTAACCCATATCAGAGTTCCAGAACAGGTACCACAGCTTTGGTTTTAGATTAGTGGAATAACATTCAGCCCAGAACTGAGAAACTC
AACAGATTAACTATCGTTTGCTCTTTAGACGGTCTCACTGCCTCTCACTTGCCAGAGCCCTTTCAAAATGAGCAGAGAAGTCCACACCAT
TAGGGACCATCTGTGATAAATTCAGAAGGGAGGAGATGTGTGTACAGCTTTAAGGATTCCCTCAATTCCGAGGAAAGGGACTGGCCCAGA
ATCCAGGTTAATACATGGAAACACGAAGCATTAGCAAAAGTAATAATTATACCTATGGTATTTGAAAGAACAATAATAAAAGACACTTCT
TCCAAACCTTGAATTTGTTGTTTTTAGAAAACGAATGCATTTAAAAATATTTTCTATGTGAGAATTTTTTAGATGTGTGTTTACTTCATG
TTTACAAATAACTGTTTGCTTTTTAATGCAGTACTTTGAAATATATCAGCCAAAACCATAACTTACAATAATTTCTTAGGTATTCTGAAT
AAAATTCCATTTCTTTTGGATATGCTTTACCATTCTTAGGTTTCTGTGGAACAAAAATATTTGTAGCATTTTGTGTAAATACAAGCTTTC
ATTTTTATTTTTTCCAATTGCTATTGCCCAAGAATTGCTTTCCATGCACATATTGTAAAAATTCCGCTTTGTGCCACAGGTCATGATTGT
GGATGAGTTTACTCTTAACTTCAAAGGGACTATTTGTATTGTATGTTGCAACTGTAAATTGAATTATTTGGCATTTTTCTCATGATTGTA

>In-frame_KCNK5_ENST00000359534_chr6_39161945_-_RUNX2_ENST00000371436_chr6_45479983_+_1702nt
AGCGACGCGTGGAGAAGCGGCCCACGTGTCTGCCCAGAGTCAAGTCCTGTGTTCTTCCCGCTCCTTACGCATCCGCGGTCCAGGGCGCCC
TTTCAGCCCCGCTGGTGTTCGCCCACCCCGGGCCGCGTGAGTGGGGCCCCACGCAGCTCCCCGCACTCCGTGGGCCAACTTGGCCAAGCA
ACTCTGTCCGGGGAGCGGTGCTTGCGGGGGGTGAGTACCGGGCACTGCGCATGCGGAGCTCCAAATTCAAACAGCTGTTTTCAGAGGCTG
GAGGGCGGGCGGACTGGTAGCAGCTGGGGCTAGGAGAGGCTTTCTCTAGGAGGCGGCCGCTCGGGAGCCATGGTGGACCGGGGCCCTCTG
CTCACCTCGGCCATCATCTTCTACCTGGCCATCGGGGCGGCGATCTTCGAAGTGCTGGAGGAGCCACACTGGAAGGAGGCCAAGAAAAAC
TACTACACACAGAAGCTGCATCTGCTCAAGGAGTTCCCGTGCCTGGGTCAGGAGGGCCTGGACAAGATCCTAGAGGTGGTATCTGATGCT
GCAGGACAGGGTGTGGCCATCACAGGGAACCAGACCTTCAACAACTGGAACTGGCCCAATGCAATGATTTTTGCAGCGACCGTCATTACC
ACCATTGGATATGGCAATGTGGCTCCCAAGACCCCCGCCGGTCGCCTCTTCTGTGTTTTCTATGGTCTCTTCGGGGTGCCGCTCTGCCTG
ACGTGGATCAGTGCCCTGGGCAAGTTCTTCGGGGGACGTGCCAAGAGACTAGGGCAGTTCCTTACCAAGAGAGGTGTGAGTCTGCGGAAG
GCGCAGATCACGTGCACAGTCATCTTCATCGTGTGGGGCGTCCTAGTCCACCTGGTGATCCCACCCTTCGTATTCATGGTGACTGAGGGG
TGGAACTACATCGAGGGCCTCTACTACTCCTTCATCACCATCTCCACCATCGGCTTCGGTGACTTTGTGGCCGACCCCAGGCAGGCACAG
TCTTCCCCGCCGTGGTCCTATGACCAGTCTTACCCCTCCTACCTGAGCCAGATGACGTCCCCGTCCATCCACTCTACCACCCCGCTGTCT
TCCACACGGGGCACTGGGCTTCCTGCCATCACCGATGTGCCTAGGCGCATTTCAGGTGCTTCAGAACTGGGCCCTTTTTCAGACCCCAGG
CAGTTCCCAAGCATTTCATCCCTCACTGAGAGCCGCTTCTCCAACCCACGAATGCACTATCCAGCCACCTTTACTTACACCCCGCCAGTC
ACCTCAGGCATGTCCCTCGGTATGTCCGCCACCACTCACTACCACACCTACCTGCCACCACCCTACCCCGGCTCTTCCCAAAGCCAGAGT
GGACCCTTCCAGACCAGCAGCACTCCATATCTCTACTATGGCACTTCGTCAGGATCCTATCAGTTTCCCATGGTGCCGGGGGGAGACCGG
TCTCCTTCCAGAATGCTTCCGCCATGCACCACCACCTCGAATGGCAGCACGCTATTAAATCCAAATTTGCCTAACCAGAATGATGGTGTT
GACGCTGATGGAAGCCACAGCAGTTCCCCAACTGTTTTGAATTCTAGTGGCAGAATGGATGAATCTGTTTGGCGACCATATTGAAATTCC

>In-frame_KCNK5_ENST00000359534_chr6_39161945_-_RUNX2_ENST00000576263_chr6_45479983_+_2370nt
AGCGACGCGTGGAGAAGCGGCCCACGTGTCTGCCCAGAGTCAAGTCCTGTGTTCTTCCCGCTCCTTACGCATCCGCGGTCCAGGGCGCCC
TTTCAGCCCCGCTGGTGTTCGCCCACCCCGGGCCGCGTGAGTGGGGCCCCACGCAGCTCCCCGCACTCCGTGGGCCAACTTGGCCAAGCA
ACTCTGTCCGGGGAGCGGTGCTTGCGGGGGGTGAGTACCGGGCACTGCGCATGCGGAGCTCCAAATTCAAACAGCTGTTTTCAGAGGCTG
GAGGGCGGGCGGACTGGTAGCAGCTGGGGCTAGGAGAGGCTTTCTCTAGGAGGCGGCCGCTCGGGAGCCATGGTGGACCGGGGCCCTCTG
CTCACCTCGGCCATCATCTTCTACCTGGCCATCGGGGCGGCGATCTTCGAAGTGCTGGAGGAGCCACACTGGAAGGAGGCCAAGAAAAAC
TACTACACACAGAAGCTGCATCTGCTCAAGGAGTTCCCGTGCCTGGGTCAGGAGGGCCTGGACAAGATCCTAGAGGTGGTATCTGATGCT
GCAGGACAGGGTGTGGCCATCACAGGGAACCAGACCTTCAACAACTGGAACTGGCCCAATGCAATGATTTTTGCAGCGACCGTCATTACC
ACCATTGGATATGGCAATGTGGCTCCCAAGACCCCCGCCGGTCGCCTCTTCTGTGTTTTCTATGGTCTCTTCGGGGTGCCGCTCTGCCTG
ACGTGGATCAGTGCCCTGGGCAAGTTCTTCGGGGGACGTGCCAAGAGACTAGGGCAGTTCCTTACCAAGAGAGGTGTGAGTCTGCGGAAG
GCGCAGATCACGTGCACAGTCATCTTCATCGTGTGGGGCGTCCTAGTCCACCTGGTGATCCCACCCTTCGTATTCATGGTGACTGAGGGG
TGGAACTACATCGAGGGCCTCTACTACTCCTTCATCACCATCTCCACCATCGGCTTCGGTGACTTTGTGGCCGACCCCAGGCAGGCACAG
TCTTCCCCGCCGTGGTCCTATGACCAGTCTTACCCCTCCTACCTGAGCCAGATGACGTCCCCGTCCATCCACTCTACCACCCCGCTGTCT
TCCACACGGGGCACTGGGCTTCCTGCCATCACCGATGTGCCTAGGCGCATTTCAGATTCAGAGCCCAGTACCTTGGACTCCCAGTCTTCG
ACCACCTTGTTCCTCTCCTCGGAGGAGCCAGGCCCCTCCACCGCCGCCCTGCCATCTCCCTCCTCCTCTTCCTGCGAGCCTCAGGCCTTT
TCCCCAGGTCCGCCAGCGCTGCCTCCGCTGTTGCCTCCGCTCCCCGCAGCCTCGGCGCCCCCAGGCCCCGGCGCCTCCCGGCGCACAGGC
CGCTACTCAGTCGTCGCCTCCTCCCCGGAGGCCGCCCCGCGTCTGGTCGACTGGCTCCCCGGTTGCCCTTCGACCATCTCTCCCAGCACA
CGCGGGGATGACAAGGAGCGGCCGCCGCCCGTCCTGGCACCGGCCGAGGGCCCGGAAAGGAGCCGCGCCCCGCGCCCCAGCACTGCGGGC
AGGGAGGAGGGCACCGTGGACGCGGGTACATCCCCGCCGCCCCGAGCCCGGCCCGCCGCTGCGGCGAGCTTGGAGGCCCACGTCGGGGAC
ATCCTGGTGGAGCTGCGGACCATGAACGGCCACCTGGACAGCATAGCGCGGGCCCTCACCAAACTGGCTTCGTCCCTGGGGCCCCAGCCT
GAGCCCCTGCCAGATGTTTCGGATGCCAACTAATGGAGCTCGGCGAGGCTGGGCCGCCCCGGGGCCGAGGGATCGCTTGCACCAGGCATC
CCTGCCTGTCCCTCCCCAGCAGCGAAGCGCGCCCAGCGGAGGAGCGGTTGCTCTGCGCAGCTGCCTAGCGGAAAGCACGGCCCTAGCGTT
TCAGCGTGAAACAGACCCGGTTGCGCCTCACACCCTCCTCCTCCGCTCTCTCACGGCGGCCCCTGCCCCGGCTTCCTGGCCCTTCACATG
CCCTTCTCTTGTCTTGAGCGTCTAGCAGAAAAAGTGCCTGGAAACGGCGGTGGCACCCTGCGAAGGATGCTTAGAGAAACACTCTTTCAC
ATCCCATTCCTGCGACTTCCGCGTGGCGTGGAGGGAGAGGAGCTCAAAGCAAGTCGCCAAAGCAGCAGCGAGGCCAGCTCCAGCGTTGGT
GGGGCATCCATCTCTGGTGACGTTCACAAGTTTGTTTGTTTTTAAAATCGTTTTTGGAAAAATATTTTTTTTTCCTCATAAGCACATTTC
AAGAAGTTTGGAAAATAGAGAAATGAAACAAAATCTGGTGTATTTGTGGAAAAGGGGGGTATTTAAGTCTTTCTTATGAGTAAGAAAGTA

>In-frame_KCNK5_ENST00000359534_chr6_39161945_-_RUNX2_ENST00000371432_chr6_45479983_+_5390nt
AGCGACGCGTGGAGAAGCGGCCCACGTGTCTGCCCAGAGTCAAGTCCTGTGTTCTTCCCGCTCCTTACGCATCCGCGGTCCAGGGCGCCC
TTTCAGCCCCGCTGGTGTTCGCCCACCCCGGGCCGCGTGAGTGGGGCCCCACGCAGCTCCCCGCACTCCGTGGGCCAACTTGGCCAAGCA
ACTCTGTCCGGGGAGCGGTGCTTGCGGGGGGTGAGTACCGGGCACTGCGCATGCGGAGCTCCAAATTCAAACAGCTGTTTTCAGAGGCTG
GAGGGCGGGCGGACTGGTAGCAGCTGGGGCTAGGAGAGGCTTTCTCTAGGAGGCGGCCGCTCGGGAGCCATGGTGGACCGGGGCCCTCTG
CTCACCTCGGCCATCATCTTCTACCTGGCCATCGGGGCGGCGATCTTCGAAGTGCTGGAGGAGCCACACTGGAAGGAGGCCAAGAAAAAC
TACTACACACAGAAGCTGCATCTGCTCAAGGAGTTCCCGTGCCTGGGTCAGGAGGGCCTGGACAAGATCCTAGAGGTGGTATCTGATGCT
GCAGGACAGGGTGTGGCCATCACAGGGAACCAGACCTTCAACAACTGGAACTGGCCCAATGCAATGATTTTTGCAGCGACCGTCATTACC
ACCATTGGATATGGCAATGTGGCTCCCAAGACCCCCGCCGGTCGCCTCTTCTGTGTTTTCTATGGTCTCTTCGGGGTGCCGCTCTGCCTG
ACGTGGATCAGTGCCCTGGGCAAGTTCTTCGGGGGACGTGCCAAGAGACTAGGGCAGTTCCTTACCAAGAGAGGTGTGAGTCTGCGGAAG
GCGCAGATCACGTGCACAGTCATCTTCATCGTGTGGGGCGTCCTAGTCCACCTGGTGATCCCACCCTTCGTATTCATGGTGACTGAGGGG
TGGAACTACATCGAGGGCCTCTACTACTCCTTCATCACCATCTCCACCATCGGCTTCGGTGACTTTGTGGCCGACCCCAGGCAGGCACAG
TCTTCCCCGCCGTGGTCCTATGACCAGTCTTACCCCTCCTACCTGAGCCAGATGACGTCCCCGTCCATCCACTCTACCACCCCGCTGTCT
TCCACACGGGGCACTGGGCTTCCTGCCATCACCGATGTGCCTAGGCGCATTTCAGGTGCTTCAGAACTGGGCCCTTTTTCAGACCCCAGG
CAGTTCCCAAGCATTTCATCCCTCACTGAGAGCCGCTTCTCCAACCCACGAATGCACTATCCAGCCACCTTTACTTACACCCCGCCAGTC
ACCTCAGGCATGTCCCTCGGTATGTCCGCCACCACTCACTACCACACCTACCTGCCACCACCCTACCCCGGCTCTTCCCAAAGCCAGAGT
GGACCCTTCCAGACCAGCAGCACTCCATATCTCTACTATGGCACTTCGTCAGGATCCTATCAGTTTCCCATGGTGCCGGGGGGAGACCGG
TCTCCTTCCAGAATGCTTCCGCCATGCACCACCACCTCGAATGGCAGCACGCTATTAAATCCAAATTTGCCTAACCAGAATGATGGTGTT
GACGCTGATGGAAGCCACAGCAGTTCCCCAACTGTTTTGAATTCTAGTGGCAGAATGGATGAATCTGTTTGGCGACCATATTGAAATTCC
TCAGCAGTGGCCCAGTGGTATCTGGGGGCCACATCCCACACGTATCAATATATACATATATAGAGAGAGTGCATATATATGTATATCGAT
TAGCTATCTACAAAGTGCCTATTTTTTAGAAGATTTTTCATTCACTCACTCAGTCATGATCTTGCAGCCATAAGAGGGTAGATATTGAGA
AGCAGAAGGCTCAAGAGAGACAATTGCAATCGAGCTTCAGATTGTTTACTATTTAAGATGTACTTTTACAAAGGAACAAAGAAGGGAAAA
GGTATTTTTGTTTTTGTTGTTTGGTCTGTTATCATCAATAACCTGTTCATATGCCAATTCAGAGAGGTGGACTCCAGGTTCAGGAGGGAG
AAGAGCAAAGCCGCTTCCTCTCTGTGCTTTGAAACTTCACACCCTCACGGTGGCAGCTGTGTATGGACCAGTGCCCTCCGCAGACAGCTC
ACAAAACCAGTTGAGGTGCACTAAAGGGACATGAGGTAGAATGGATGCTTCCATCACAGTACCATCATTCAGAATAACTCTTCCAATTTC
TGCTTTCAGACATGCTGCAGGTCCTCATCTGAACTGTTGGGTTCGTTTTTTTTTTTTTTTTTCCTGCTCCAAGAAAGTGACTTCAAAAAT
AACTGATCAGGATAGATTATTTTATTTTACTTTTTAACACTCCTTCTCCCCTTTTCCCACTGAACCAAAAAGAAATCCCATCCCTAAAAC
CTGCCTTCTCCTTTTATGCAAAACTGAAAATGGCAATACATTATTATAGCCATAATGGTATAGATAGTGATTGCGTTTGGCTATGTGTTG
TTTTCTTTTTTTTTAAATTATGAATATGTGTAAAATCTGAGGTAACTTGCTAACGTGAATGGTCATATAACTTTAAAGATATATTTATAA
TTATTTAATGACATTTGGACCCTTGAAACATTTCTTAGTGTATTGATATGTTGACTTCGGTCTCTAAAAGTGCTCTTTATTAAATAACAA
ATTTCTTCAGTGGTCTAGAGCCATATCTGAAATATTGCTAAGCAATTTCAGTTCATCCAGGCACAATGTGATTTTAAAAAATACTTCCAT
CTCCAAATATTTTAGATATAGATTGTTTTTGTGATGTATGAAGGAAATGTTATGTTTAGTTCTTTCAGATCTTTGAATGCCTCTAACACA
GCTTTGCCTTCTAAAGCGGTAATTAGGGATTTAAAAAACAACCTTTAGCCCTTTATCAGCATGAAATGCTGGAGTGATGTGGTTTTCTAA
TTTCTTTGGGGTAATTATGACTCTTGTCATATTAAAAAGACAAGCACAAGTAAATCATTGAACTACAGAAAAATGTTCTGTGGTTTCATA
GTTAAGCAAAACTCTAAATCGCCAGGCTTCATAGCAAAGACATAGTCAGCTAAAAGCCGCACATGTGGATAGAGGGTTCAATTATGAGAC
ACCTAGTACAGGAGAGCAAAATTGCACCAGAGATTCTTAACCAACCAGCCTTACCAAACAACACAACAGGGGAACCCCAATCTGCCTTAC
CCAAGGCCCCACTGGCAGCTTTCCACAGAATTTGCATTTAGAGGAGCAGAATGACATCACTGTCCTTTGGGAGTAGGTCCTCTGAAAAGG
CAGCAGGTTCCAGCAGGTAGCTGAGCTGAGAGGACATATGGCCCACGGGGACCTACAGACAGCCTTTGACATTTGTATTTCTTACAATGG
AGGGCCAAGGAGGGCAAGGGGCTGTGGAGTTTGGTGTCTACTAGTGTGTATGAATTTGAGCTAGAGTCCTTCTGTGGCATGCACTTTGAC
CACTCCTGGCAGTCACATGGCAGATTTCCAAGTGCAAATCCTTAATCCAAACAAGGATCATCTAATGACACCACCAGGCCAATCCCTGCT
CTCCTCCCCGAAAAGTCAGGGTCCCTTCATTGGAATCCTCCACCCACCCAAGCAGAATTTAGCAGAGATTTGCCTTCAAACCCTAACGGC
CCCCTTGTTCTCTGGTCCTTCTCAAACCCACCTTTGTAGGCCACCCAGCATTGCAGGACAGCGTGTGGGGCAGCTGGACCTGTGCTTCCT
GCCTGGGAGTCTCCCTTGGAATTCATCCTGACTCCTTCTAATAAAAATGGATGGGAAAGCAAAACACTTTGCCTTCTAAAGGCCGTATAC
CAAGTATGCTTAGATAAATAAGCCACTTTTCTATTACTTAAGTAAGAAGGAAGTAGTAATTGATACTATTTATTGTTTGTGTGTGGTAGC
TTGAAGCACACCACTGTCCATTTATTTGTAAGTGTAAAATATGTGTGTTTGTTTCAGCAGCACTTAAAAAAGCCAGTGTCTGGTTACACA
TTTCAATTTTAATTAATTGACATAAAAATGCTACCGCCAGTGCCAGCTGCATCCTATTTAATTAAAAAGGTACTATATTTGTACATTATT
TTTTAATGTTAAAAGGGCTTTTTTAAGTTTACAGTACACATACCGAGTGACTTTAGGGATGCTTTTGTGTTGAAATGTTACTATAGTGGC
TGCAGGCAGCAACCCAGAAACACTTTAGAAGCTTTTTTTCCTTGGGAAAAATTCAAGCACTTCTTCCCTCCACCCTCACTCCAACCACCC
CAATGGGGGTAATTCACATTTCTTAGAACAAATTCTGCCCTTTTTTGGTCTAGGGATTAAAATTTTGTTTTTCTTTCTTTCTTTTTTTTT
TTTTTTCACTGAACCCTTAATTTGCACTGGGTCATGTGTTTGATTTGTGATTTCAAGACCAAAGCAAAGTCTTACTACTACTGTGGAACC
ATGTACTAGTTCCTGGGAATTAAAATAGCGTGGTTCTCTTTGTAGCACAAACATTGCTGGAATTTGCAGTCTTTTCAATGCAGCCACATT
TTTATCCATTTCAGTTGTCTCACAAATTTTAACCCATATCAGAGTTCCAGAACAGGTACCACAGCTTTGGTTTTAGATTAGTGGAATAAC
ATTCAGCCCAGAACTGAGAAACTCAACAGATTAACTATCGTTTGCTCTTTAGACGGTCTCACTGCCTCTCACTTGCCAGAGCCCTTTCAA
AATGAGCAGAGAAGTCCACACCATTAGGGACCATCTGTGATAAATTCAGAAGGGAGGAGATGTGTGTACAGCTTTAAGGATTCCCTCAAT
TCCGAGGAAAGGGACTGGCCCAGAATCCAGGTTAATACATGGAAACACGAAGCATTAGCAAAAGTAATAATTATACCTATGGTATTTGAA
AGAACAATAATAAAAGACACTTCTTCCAAACCTTGAATTTGTTGTTTTTAGAAAACGAATGCATTTAAAAATATTTTCTATGTGAGAATT
TTTTAGATGTGTGTTTACTTCATGTTTACAAATAACTGTTTGCTTTTTAATGCAGTACTTTGAAATATATCAGCCAAAACCATAACTTAC
AATAATTTCTTAGGTATTCTGAATAAAATTCCATTTCTTTTGGATATGCTTTACCATTCTTAGGTTTCTGTGGAACAAAAATATTTGTAG
CATTTTGTGTAAATACAAGCTTTCATTTTTATTTTTTCCAATTGCTATTGCCCAAGAATTGCTTTCCATGCACATATTGTAAAAATTCCG
CTTTGTGCCACAGGTCATGATTGTGGATGAGTTTACTCTTAACTTCAAAGGGACTATTTGTATTGTATGTTGCAACTGTAAATTGAATTA

>In-frame_KCNK5_ENST00000359534_chr6_39161945_-_RUNX2_ENST00000359524_chr6_45479983_+_5454nt
AGCGACGCGTGGAGAAGCGGCCCACGTGTCTGCCCAGAGTCAAGTCCTGTGTTCTTCCCGCTCCTTACGCATCCGCGGTCCAGGGCGCCC
TTTCAGCCCCGCTGGTGTTCGCCCACCCCGGGCCGCGTGAGTGGGGCCCCACGCAGCTCCCCGCACTCCGTGGGCCAACTTGGCCAAGCA
ACTCTGTCCGGGGAGCGGTGCTTGCGGGGGGTGAGTACCGGGCACTGCGCATGCGGAGCTCCAAATTCAAACAGCTGTTTTCAGAGGCTG
GAGGGCGGGCGGACTGGTAGCAGCTGGGGCTAGGAGAGGCTTTCTCTAGGAGGCGGCCGCTCGGGAGCCATGGTGGACCGGGGCCCTCTG
CTCACCTCGGCCATCATCTTCTACCTGGCCATCGGGGCGGCGATCTTCGAAGTGCTGGAGGAGCCACACTGGAAGGAGGCCAAGAAAAAC
TACTACACACAGAAGCTGCATCTGCTCAAGGAGTTCCCGTGCCTGGGTCAGGAGGGCCTGGACAAGATCCTAGAGGTGGTATCTGATGCT
GCAGGACAGGGTGTGGCCATCACAGGGAACCAGACCTTCAACAACTGGAACTGGCCCAATGCAATGATTTTTGCAGCGACCGTCATTACC
ACCATTGGATATGGCAATGTGGCTCCCAAGACCCCCGCCGGTCGCCTCTTCTGTGTTTTCTATGGTCTCTTCGGGGTGCCGCTCTGCCTG
ACGTGGATCAGTGCCCTGGGCAAGTTCTTCGGGGGACGTGCCAAGAGACTAGGGCAGTTCCTTACCAAGAGAGGTGTGAGTCTGCGGAAG
GCGCAGATCACGTGCACAGTCATCTTCATCGTGTGGGGCGTCCTAGTCCACCTGGTGATCCCACCCTTCGTATTCATGGTGACTGAGGGG
TGGAACTACATCGAGGGCCTCTACTACTCCTTCATCACCATCTCCACCATCGGCTTCGGTGACTTTGTGGCCGACCCCAGGCAGGCACAG
TCTTCCCCGCCGTGGTCCTATGACCAGTCTTACCCCTCCTACCTGAGCCAGATGACGTCCCCGTCCATCCACTCTACCACCCCGCTGTCT
TCCACACGGGGCACTGGGCTTCCTGCCATCACCGATGTGCCTAGGCGCATTTCAGATGATGACACTGCCACCTCTGACTTCTGCCTCTGG
CCTTCCACTCTCAGTAAGAAGAGCCAGGCAGGTGCTTCAGAACTGGGCCCTTTTTCAGACCCCAGGCAGTTCCCAAGCATTTCATCCCTC
ACTGAGAGCCGCTTCTCCAACCCACGAATGCACTATCCAGCCACCTTTACTTACACCCCGCCAGTCACCTCAGGCATGTCCCTCGGTATG
TCCGCCACCACTCACTACCACACCTACCTGCCACCACCCTACCCCGGCTCTTCCCAAAGCCAGAGTGGACCCTTCCAGACCAGCAGCACT
CCATATCTCTACTATGGCACTTCGTCAGGATCCTATCAGTTTCCCATGGTGCCGGGGGGAGACCGGTCTCCTTCCAGAATGCTTCCGCCA
TGCACCACCACCTCGAATGGCAGCACGCTATTAAATCCAAATTTGCCTAACCAGAATGATGGTGTTGACGCTGATGGAAGCCACAGCAGT
TCCCCAACTGTTTTGAATTCTAGTGGCAGAATGGATGAATCTGTTTGGCGACCATATTGAAATTCCTCAGCAGTGGCCCAGTGGTATCTG
GGGGCCACATCCCACACGTATCAATATATACATATATAGAGAGAGTGCATATATATGTATATCGATTAGCTATCTACAAAGTGCCTATTT
TTTAGAAGATTTTTCATTCACTCACTCAGTCATGATCTTGCAGCCATAAGAGGGTAGATATTGAGAAGCAGAAGGCTCAAGAGAGACAAT
TGCAATCGAGCTTCAGATTGTTTACTATTTAAGATGTACTTTTACAAAGGAACAAAGAAGGGAAAAGGTATTTTTGTTTTTGTTGTTTGG
TCTGTTATCATCAATAACCTGTTCATATGCCAATTCAGAGAGGTGGACTCCAGGTTCAGGAGGGAGAAGAGCAAAGCCGCTTCCTCTCTG
TGCTTTGAAACTTCACACCCTCACGGTGGCAGCTGTGTATGGACCAGTGCCCTCCGCAGACAGCTCACAAAACCAGTTGAGGTGCACTAA
AGGGACATGAGGTAGAATGGATGCTTCCATCACAGTACCATCATTCAGAATAACTCTTCCAATTTCTGCTTTCAGACATGCTGCAGGTCC
TCATCTGAACTGTTGGGTTCGTTTTTTTTTTTTTTTTTCCTGCTCCAAGAAAGTGACTTCAAAAATAACTGATCAGGATAGATTATTTTA
TTTTACTTTTTAACACTCCTTCTCCCCTTTTCCCACTGAACCAAAAAGAAATCCCATCCCTAAAACCTGCCTTCTCCTTTTATGCAAAAC
TGAAAATGGCAATACATTATTATAGCCATAATGGTATAGATAGTGATTGCGTTTGGCTATGTGTTGTTTTCTTTTTTTTTAAATTATGAA
TATGTGTAAAATCTGAGGTAACTTGCTAACGTGAATGGTCATATAACTTTAAAGATATATTTATAATTATTTAATGACATTTGGACCCTT
GAAACATTTCTTAGTGTATTGATATGTTGACTTCGGTCTCTAAAAGTGCTCTTTATTAAATAACAAATTTCTTCAGTGGTCTAGAGCCAT
ATCTGAAATATTGCTAAGCAATTTCAGTTCATCCAGGCACAATGTGATTTTAAAAAATACTTCCATCTCCAAATATTTTAGATATAGATT
GTTTTTGTGATGTATGAAGGAAATGTTATGTTTAGTTCTTTCAGATCTTTGAATGCCTCTAACACAGCTTTGCCTTCTAAAGCGGTAATT
AGGGATTTAAAAAACAACCTTTAGCCCTTTATCAGCATGAAATGCTGGAGTGATGTGGTTTTCTAATTTCTTTGGGGTAATTATGACTCT
TGTCATATTAAAAAGACAAGCACAAGTAAATCATTGAACTACAGAAAAATGTTCTGTGGTTTCATAGTTAAGCAAAACTCTAAATCGCCA
GGCTTCATAGCAAAGACATAGTCAGCTAAAAGCCGCACATGTGGATAGAGGGTTCAATTATGAGACACCTAGTACAGGAGAGCAAAATTG
CACCAGAGATTCTTAACCAACCAGCCTTACCAAACAACACAACAGGGGAACCCCAATCTGCCTTACCCAAGGCCCCACTGGCAGCTTTCC
ACAGAATTTGCATTTAGAGGAGCAGAATGACATCACTGTCCTTTGGGAGTAGGTCCTCTGAAAAGGCAGCAGGTTCCAGCAGGTAGCTGA
GCTGAGAGGACATATGGCCCACGGGGACCTACAGACAGCCTTTGACATTTGTATTTCTTACAATGGAGGGCCAAGGAGGGCAAGGGGCTG
TGGAGTTTGGTGTCTACTAGTGTGTATGAATTTGAGCTAGAGTCCTTCTGTGGCATGCACTTTGACCACTCCTGGCAGTCACATGGCAGA
TTTCCAAGTGCAAATCCTTAATCCAAACAAGGATCATCTAATGACACCACCAGGCCAATCCCTGCTCTCCTCCCCGAAAAGTCAGGGTCC
CTTCATTGGAATCCTCCACCCACCCAAGCAGAATTTAGCAGAGATTTGCCTTCAAACCCTAACGGCCCCCTTGTTCTCTGGTCCTTCTCA
AACCCACCTTTGTAGGCCACCCAGCATTGCAGGACAGCGTGTGGGGCAGCTGGACCTGTGCTTCCTGCCTGGGAGTCTCCCTTGGAATTC
ATCCTGACTCCTTCTAATAAAAATGGATGGGAAAGCAAAACACTTTGCCTTCTAAAGGCCGTATACCAAGTATGCTTAGATAAATAAGCC
ACTTTTCTATTACTTAAGTAAGAAGGAAGTAGTAATTGATACTATTTATTGTTTGTGTGTGGTAGCTTGAAGCACACCACTGTCCATTTA
TTTGTAAGTGTAAAATATGTGTGTTTGTTTCAGCAGCACTTAAAAAAGCCAGTGTCTGGTTACACATTTCAATTTTAATTAATTGACATA
AAAATGCTACCGCCAGTGCCAGCTGCATCCTATTTAATTAAAAAGGTACTATATTTGTACATTATTTTTTAATGTTAAAAGGGCTTTTTT
AAGTTTACAGTACACATACCGAGTGACTTTAGGGATGCTTTTGTGTTGAAATGTTACTATAGTGGCTGCAGGCAGCAACCCAGAAACACT
TTAGAAGCTTTTTTTCCTTGGGAAAAATTCAAGCACTTCTTCCCTCCACCCTCACTCCAACCACCCCAATGGGGGTAATTCACATTTCTT
AGAACAAATTCTGCCCTTTTTTGGTCTAGGGATTAAAATTTTGTTTTTCTTTCTTTCTTTTTTTTTTTTTTTCACTGAACCCTTAATTTG
CACTGGGTCATGTGTTTGATTTGTGATTTCAAGACCAAAGCAAAGTCTTACTACTACTGTGGAACCATGTACTAGTTCCTGGGAATTAAA
ATAGCGTGGTTCTCTTTGTAGCACAAACATTGCTGGAATTTGCAGTCTTTTCAATGCAGCCACATTTTTATCCATTTCAGTTGTCTCACA
AATTTTAACCCATATCAGAGTTCCAGAACAGGTACCACAGCTTTGGTTTTAGATTAGTGGAATAACATTCAGCCCAGAACTGAGAAACTC
AACAGATTAACTATCGTTTGCTCTTTAGACGGTCTCACTGCCTCTCACTTGCCAGAGCCCTTTCAAAATGAGCAGAGAAGTCCACACCAT
TAGGGACCATCTGTGATAAATTCAGAAGGGAGGAGATGTGTGTACAGCTTTAAGGATTCCCTCAATTCCGAGGAAAGGGACTGGCCCAGA
ATCCAGGTTAATACATGGAAACACGAAGCATTAGCAAAAGTAATAATTATACCTATGGTATTTGAAAGAACAATAATAAAAGACACTTCT
TCCAAACCTTGAATTTGTTGTTTTTAGAAAACGAATGCATTTAAAAATATTTTCTATGTGAGAATTTTTTAGATGTGTGTTTACTTCATG
TTTACAAATAACTGTTTGCTTTTTAATGCAGTACTTTGAAATATATCAGCCAAAACCATAACTTACAATAATTTCTTAGGTATTCTGAAT
AAAATTCCATTTCTTTTGGATATGCTTTACCATTCTTAGGTTTCTGTGGAACAAAAATATTTGTAGCATTTTGTGTAAATACAAGCTTTC
ATTTTTATTTTTTCCAATTGCTATTGCCCAAGAATTGCTTTCCATGCACATATTGTAAAAATTCCGCTTTGTGCCACAGGTCATGATTGT
GGATGAGTTTACTCTTAACTTCAAAGGGACTATTTGTATTGTATGTTGCAACTGTAAATTGAATTATTTGGCATTTTTCTCATGATTGTA


Top

FusionGenePPI for KCNK5_RUNX2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
KCNK5APP, FRAT1RUNX2HDAC3, KAT6B, HDAC6, ALYREF, SMAD1, SMAD3, YAP1, JUN, FOS, ETS1, SMAD2, SMAD5, MSX2, STUB1, TLE1, HDAC4, HDAC5, KAT2B, HDAC1, EP300, BMPR1A, HES1, XRCC6, XRCC5, CREBBP, HDAC7, NR0B2, SOX9, RBM14, STAT3, SUV39H1, UBTF, FHL2, HIVEP3, WWP1, SMURF2, SMURF1, HIF1A, PML, RB1, TP53, CBFB, STAT5A, FBXW7, SKP2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
TgeneRUNX2chr6:39161945chr6:45479983ENST00000359524+37336_439272508KAT6A
TgeneRUNX2chr6:39161945chr6:45479983ENST00000371436+47336_439286500KAT6A
TgeneRUNX2chr6:39161945chr6:45479983ENST00000371438+48336_439286522KAT6A
TgeneRUNX2chr6:39161945chr6:45479983ENST00000465038+59336_439286522KAT6A
TgeneRUNX2chr6:39161945chr6:45479983ENST00000359524+37374_468272508KAT6B
TgeneRUNX2chr6:39161945chr6:45479983ENST00000371436+47374_468286500KAT6B
TgeneRUNX2chr6:39161945chr6:45479983ENST00000371438+48374_468286522KAT6B
TgeneRUNX2chr6:39161945chr6:45479983ENST00000465038+59374_468286522KAT6B


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for KCNK5_RUNX2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for KCNK5_RUNX2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneKCNK5C0038220Status Epilepticus1CTD_human
TgeneRUNX2C0008928Cleidocranial Dysplasia12CTD_human;ORPHANET;UNIPROT
TgeneRUNX2C0029463Osteosarcoma2CTD_human
TgeneRUNX2C0003872Arthritis, Psoriatic1CTD_human
TgeneRUNX2C0003873Rheumatoid Arthritis1CTD_human
TgeneRUNX2C0029408Degenerative polyarthritis1CTD_human
TgeneRUNX2C0040427Tooth Abnormalities1CTD_human
TgeneRUNX2C0041948Uremia1CTD_human
TgeneRUNX2C0243057Stomatognathic System Abnormalities1CTD_human
TgeneRUNX2C0376634Craniofacial Abnormalities1CTD_human
TgeneRUNX2C0949690Spondylarthritis1CTD_human