FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 1818

FusionGeneSummary for ANKRD26_MCM10

check button Fusion gene summary
Fusion gene informationFusion gene name: ANKRD26_MCM10
Fusion gene ID: 1818
HgeneTgene
Gene symbol

ANKRD26

MCM10

Gene ID

22852

55388

Gene nameankyrin repeat domain 26minichromosome maintenance 10 replication initiation factor
SynonymsTHC2|bA145E8.1CNA43|DNA43|PRO2249
Cytomap

10p12.1

10p13

Type of geneprotein-codingprotein-coding
Descriptionankyrin repeat domain-containing protein 26GNS/ANKRD26/NCKAP1L fusionprotein MCM10 homologMCM10 minichromosome maintenance deficient 10homolog of yeast MCM10hsMCM10minichromosome maintenance complex component 10
Modification date2018051920180523
UniProtAcc

Q9UPS8

Q7L590

Ensembl transtripts involved in fusion geneENST00000376070, ENST00000376087, 
ENST00000436985, ENST00000466890, 
ENST00000378714, ENST00000484800, 
ENST00000378694, 
Fusion gene scores* DoF score2 X 2 X 2=82 X 2 X 2=8
# samples 22
** MAII scorelog2(2/8*10)=1.32192809488736log2(2/8*10)=1.32192809488736
Context

PubMed: ANKRD26 [Title/Abstract] AND MCM10 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBLCATCGA-XF-A8HD-01AANKRD26chr10

27389014

-MCM10chr10

13251091

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
intron-3CDSENST00000376070ENST00000378714ANKRD26chr10

27389014

-MCM10chr10

13251091

+
intron-3CDSENST00000376070ENST00000484800ANKRD26chr10

27389014

-MCM10chr10

13251091

+
intron-3CDSENST00000376070ENST00000378694ANKRD26chr10

27389014

-MCM10chr10

13251091

+
Frame-shitENST00000376087ENST00000378714ANKRD26chr10

27389014

-MCM10chr10

13251091

+
Frame-shitENST00000376087ENST00000484800ANKRD26chr10

27389014

-MCM10chr10

13251091

+
In-frameENST00000376087ENST00000378694ANKRD26chr10

27389014

-MCM10chr10

13251091

+
Frame-shitENST00000436985ENST00000378714ANKRD26chr10

27389014

-MCM10chr10

13251091

+
Frame-shitENST00000436985ENST00000484800ANKRD26chr10

27389014

-MCM10chr10

13251091

+
In-frameENST00000436985ENST00000378694ANKRD26chr10

27389014

-MCM10chr10

13251091

+
intron-3CDSENST00000466890ENST00000378714ANKRD26chr10

27389014

-MCM10chr10

13251091

+
intron-3CDSENST00000466890ENST00000484800ANKRD26chr10

27389014

-MCM10chr10

13251091

+
intron-3CDSENST00000466890ENST00000378694ANKRD26chr10

27389014

-MCM10chr10

13251091

+

Top

FusionProtFeatures for ANKRD26_MCM10


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ANKRD26

Q9UPS8

MCM10

Q7L590

Acts as a regulator of adipogenesis. Involved in theregulation of the feeding behavior.{ECO:0000250|UniProtKB:Q811D2}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for ANKRD26_MCM10


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ANKRD26_ENST00000376087_chr10_27389014_-_MCM10_ENST00000378694_chr10_13251091_+_104aa
MKKIFSKKGESPLGSFARRQRSSAGGGGEPGEGAYSQPGYHVRDRDLGKIHKAASAGNVAKVQQILLLRKNGLNDRDKMNSNCGLYKWER

>In-frame_ANKRD26_ENST00000436985_chr10_27389014_-_MCM10_ENST00000378694_chr10_13251091_+_104aa
MKKIFSKKGESPLGSFARRQRSSAGGGGEPGEGAYSQPGYHVRDRDLGKIHKAASAGNVAKVQQILLLRKNGLNDRDKMNSNCGLYKWER


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ANKRD26_ENST00000376087_chr10_27389014_-_MCM10_ENST00000378694_chr10_13251091_+_312nt
ATGAAGAAGATTTTTAGTAAGAAGGGCGAGTCGCCCTTGGGCTCCTTCGCGCGGCGGCAGAGGAGCAGCGCGGGAGGCGGGGGCGAGCCG
GGGGAGGGCGCCTACTCGCAGCCCGGCTACCACGTCCGAGACCGAGATCTCGGCAAGATCCACAAAGCTGCCAGCGCGGGTAATGTGGCG
AAAGTGCAGCAGATCCTTTTGCTCAGGAAGAATGGCTTGAACGATAGAGACAAGATGAACAGTAACTGTGGCCTCTACAAATGGGAACGG

>In-frame_ANKRD26_ENST00000436985_chr10_27389014_-_MCM10_ENST00000378694_chr10_13251091_+_312nt
ATGAAGAAGATTTTTAGTAAGAAGGGCGAGTCGCCCTTGGGCTCCTTCGCGCGGCGGCAGAGGAGCAGCGCGGGAGGCGGGGGCGAGCCG
GGGGAGGGCGCCTACTCGCAGCCCGGCTACCACGTCCGAGACCGAGATCTCGGCAAGATCCACAAAGCTGCCAGCGCGGGTAATGTGGCG
AAAGTGCAGCAGATCCTTTTGCTCAGGAAGAATGGCTTGAACGATAGAGACAAGATGAACAGTAACTGTGGCCTCTACAAATGGGAACGG


* Fusion transcript sequences (Full-length transcript).
>In-frame_ANKRD26_ENST00000376087_chr10_27389014_-_MCM10_ENST00000378694_chr10_13251091_+_2422nt
GTCTAGCGGGATCGCTTGCTTGGTAACCCGGAGGGAGAGATTGGAAACCGCGGAGTTTCCTTTGGGAGGCTGCGGCCAGCCGGGGCTGAC
TTGTTATGTTGGGCTCCGGAGGCCGTTAAGAGCCGAGAGAGACATGAGGTGTCTCTGAAGCCCGGTCGCCTGGGCCATGAAGAAGATTTT
TAGTAAGAAGGGCGAGTCGCCCTTGGGCTCCTTCGCGCGGCGGCAGAGGAGCAGCGCGGGAGGCGGGGGCGAGCCGGGGGAGGGCGCCTA
CTCGCAGCCCGGCTACCACGTCCGAGACCGAGATCTCGGCAAGATCCACAAAGCTGCCAGCGCGGGTAATGTGGCGAAAGTGCAGCAGAT
CCTTTTGCTCAGGAAGAATGGCTTGAACGATAGAGACAAGATGAACAGTAACTGTGGCCTCTACAAATGGGAACGGGACGGAATGCTAAA
GGTATGCCATTTGCGTACTAATTTTTGACTCCTTTTAGTGACCCATGCTAATAATGTGGAACCATCTCCTATTAAAATATTTTCATTTTT
CTAGGAAAAGACTGGTCCAAAGATAGGAGGAGAAACTCTGTTACCAAGAGGAGAAGAACATGCTAAATTTCTGAACAGCCTTAAATAACC
CGAACTTCAGACATTTTCCCACAGACTTCCTGGCCTCCTGTGACTCTGGAAAGCAAAGGATTGGCTGTGTATTGTCCATTGATTCCTGAT
TGACGCCGTCAAAAACAAATGCTTGTTAAGCCCATAAGCTTTGCCTGCTTACTTTCTGCCATTGGGTTGGTTTGATACCACATTTAACAT
TGACATTTAAGTGGAAAACCAAGTTATCATTGTCTTTTCTAAGCTCAGTGTGGATGATTGCATTACTTCATTCACTGAAGTTTTTGCCCA
AAAATTGGAAGGTAAACAGAGAGCTATGTTTCTGTATCTTTTGGTTATAGAGTGTTCACTTCTTTATCATAACAAAATTCTAGTGTTTAT
ACGAACACCCAGAGGCAAAAGAATTTGGCTTAATTCTCACTCCAGGTAAGTAGCTTAACTTCTGGGCTTCAGTTTTCTCATCTGTAAAAT
CAGGAAGATTGGACTAAGTGATCCTGAAATGTATTTTTTAGCACTGGATTTCTACAAATAATAAAACTTTCCCATCTAGATAATGATGAT
CACATAGTCTTGATGTACGGACATTAAAAGCCAGATTTCTTCATTCAATTCTGTTATCTCTGTTTTACTCTTTGAAATTGATCAAGCCAC
TGAATCACTTTGCATTTCAGTTTATATATATAGAGAGAAAGAAGGTGTCTGCTCTTACATTATTGTGGAGCCCTGTGATAGAAATATGTA
AAATCTCATATTATTTTTTTTTTAATTTTTTTATTTTTTATGACAGGGTCTCACTATGTCACCCTGGCTGGAGTGCAGTAGTGCGATCGC
GGCACACTGCAGCCTTGGCTTCCCTGGGCTCAAGCAGTCCTCCCACCTCAGTCTCCCAAATAGCTAGGACTACAGGCGTGCGTGACCAAG
CCCAGCTAATTTTTGCATTTTTTGTAGAGATGGGGTTTTGCCATGTTGCTCAGGCTGGTCTCAAACTCCTGAGCACTAGCAATCCACCCA
CCTCTGTTTCCAAAAAAAAAAAAAAAATGAAAGGTCAACCCCTATGCAAATTACCACAGCAAAGGTTTCATTCAGGAGATTCTTCCATCT
GGGCAACCTGGTTTTCCAAATATCATTTGACCTAAGTGAATGTTGATACTAGCTAAAGATTGGGTAAATTGGTTGAATTATTGTATTGAA
GCTTGAGCTGTAGCTAAAAGTAATTTAGGTTTCCCCTAAGATGTTATTATGTTAGGGACATAACACTTTTGGGAGGTTGTTGTGGGAGAT
GGTTGATTTAGGTTTTCAAAAGCTAGAAATAAAATTTACATGCCTTAGATTTCATAAAATTCTGCTCTAATTGGGTGGAAGGTGCTGTAT
CTAACTTGTGTTCCTCCTAAGGTTATGTCCTAATAACTATTCTTTTAGGAGTATACTTCTACTTTATAGAAGGTTGCTTTTCTTTTTAAT
TTTTTCTAACAAAGAAAAGAATAAAGTATTTATTAATAAGAACCAGAAAGCACTTGAAACTGATGTTTTTAATGGCTCATTTAGGGTAGA
TTTATTTATCTCATTAACTTAAAACAGCTATGTGTATGAAATAGGTCACAACAGAACTTGAACACCAGGTTGGTGTCTGAGCAATCCCTT
TCTTATGGGAAAAACAATGTTCTTGTTTGAACAGAGGGTATCATTGCAGTCAGTATTCACGTGTATATTGTTATATAAGTTGTATAATAT

>In-frame_ANKRD26_ENST00000436985_chr10_27389014_-_MCM10_ENST00000378694_chr10_13251091_+_2321nt
GGCTCCGGAGGCCGTTAAGAGCCGAGAGAGACATGAGGTGTCTCTGAAGCCCGGTCGCCTGGGCCATGAAGAAGATTTTTAGTAAGAAGG
GCGAGTCGCCCTTGGGCTCCTTCGCGCGGCGGCAGAGGAGCAGCGCGGGAGGCGGGGGCGAGCCGGGGGAGGGCGCCTACTCGCAGCCCG
GCTACCACGTCCGAGACCGAGATCTCGGCAAGATCCACAAAGCTGCCAGCGCGGGTAATGTGGCGAAAGTGCAGCAGATCCTTTTGCTCA
GGAAGAATGGCTTGAACGATAGAGACAAGATGAACAGTAACTGTGGCCTCTACAAATGGGAACGGGACGGAATGCTAAAGGTATGCCATT
TGCGTACTAATTTTTGACTCCTTTTAGTGACCCATGCTAATAATGTGGAACCATCTCCTATTAAAATATTTTCATTTTTCTAGGAAAAGA
CTGGTCCAAAGATAGGAGGAGAAACTCTGTTACCAAGAGGAGAAGAACATGCTAAATTTCTGAACAGCCTTAAATAACCCGAACTTCAGA
CATTTTCCCACAGACTTCCTGGCCTCCTGTGACTCTGGAAAGCAAAGGATTGGCTGTGTATTGTCCATTGATTCCTGATTGACGCCGTCA
AAAACAAATGCTTGTTAAGCCCATAAGCTTTGCCTGCTTACTTTCTGCCATTGGGTTGGTTTGATACCACATTTAACATTGACATTTAAG
TGGAAAACCAAGTTATCATTGTCTTTTCTAAGCTCAGTGTGGATGATTGCATTACTTCATTCACTGAAGTTTTTGCCCAAAAATTGGAAG
GTAAACAGAGAGCTATGTTTCTGTATCTTTTGGTTATAGAGTGTTCACTTCTTTATCATAACAAAATTCTAGTGTTTATACGAACACCCA
GAGGCAAAAGAATTTGGCTTAATTCTCACTCCAGGTAAGTAGCTTAACTTCTGGGCTTCAGTTTTCTCATCTGTAAAATCAGGAAGATTG
GACTAAGTGATCCTGAAATGTATTTTTTAGCACTGGATTTCTACAAATAATAAAACTTTCCCATCTAGATAATGATGATCACATAGTCTT
GATGTACGGACATTAAAAGCCAGATTTCTTCATTCAATTCTGTTATCTCTGTTTTACTCTTTGAAATTGATCAAGCCACTGAATCACTTT
GCATTTCAGTTTATATATATAGAGAGAAAGAAGGTGTCTGCTCTTACATTATTGTGGAGCCCTGTGATAGAAATATGTAAAATCTCATAT
TATTTTTTTTTTAATTTTTTTATTTTTTATGACAGGGTCTCACTATGTCACCCTGGCTGGAGTGCAGTAGTGCGATCGCGGCACACTGCA
GCCTTGGCTTCCCTGGGCTCAAGCAGTCCTCCCACCTCAGTCTCCCAAATAGCTAGGACTACAGGCGTGCGTGACCAAGCCCAGCTAATT
TTTGCATTTTTTGTAGAGATGGGGTTTTGCCATGTTGCTCAGGCTGGTCTCAAACTCCTGAGCACTAGCAATCCACCCACCTCTGTTTCC
AAAAAAAAAAAAAAAATGAAAGGTCAACCCCTATGCAAATTACCACAGCAAAGGTTTCATTCAGGAGATTCTTCCATCTGGGCAACCTGG
TTTTCCAAATATCATTTGACCTAAGTGAATGTTGATACTAGCTAAAGATTGGGTAAATTGGTTGAATTATTGTATTGAAGCTTGAGCTGT
AGCTAAAAGTAATTTAGGTTTCCCCTAAGATGTTATTATGTTAGGGACATAACACTTTTGGGAGGTTGTTGTGGGAGATGGTTGATTTAG
GTTTTCAAAAGCTAGAAATAAAATTTACATGCCTTAGATTTCATAAAATTCTGCTCTAATTGGGTGGAAGGTGCTGTATCTAACTTGTGT
TCCTCCTAAGGTTATGTCCTAATAACTATTCTTTTAGGAGTATACTTCTACTTTATAGAAGGTTGCTTTTCTTTTTAATTTTTTCTAACA
AAGAAAAGAATAAAGTATTTATTAATAAGAACCAGAAAGCACTTGAAACTGATGTTTTTAATGGCTCATTTAGGGTAGATTTATTTATCT
CATTAACTTAAAACAGCTATGTGTATGAAATAGGTCACAACAGAACTTGAACACCAGGTTGGTGTCTGAGCAATCCCTTTCTTATGGGAA
AAACAATGTTCTTGTTTGAACAGAGGGTATCATTGCAGTCAGTATTCACGTGTATATTGTTATATAAGTTGTATAATATGCTTGTAAAGG


Top

FusionGenePPI for ANKRD26_MCM10


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ANKRD26BRCA1, CBX2, CBX4, AMOT, PRKAR1A, MED4, PCM1, CEP128, CEP89, CNTRL, CCDC40, NDEL1, RALBP1MCM10KRT15, CEP70, HOOK2, ZBTB43, CCDC85B, CALCOCO2, CEP72, DPPA2, TRIM37, NINL, MCM6, CCND3, ZBTB8A, MCM7, ORC2, RPAP1, IKBKG, DDB1, RBX1, CUL4A, VPRBP, APP, ORC4, CDC45, MCM2, CDC7, MCM3, CDC5L, CDC6, CCND1, CDK6, ORC3, CDKN2A, CDKN1A, GOLGA2, TEX264, TMEM171, MCMBP, MCM4, SIRT1, NTRK1, HIST1H2BG, PCM1, TNIP1, POLR2G, SUPT5H, OFD1, CCDC14, USP37, YWHAE, IKZF5, CAV3, KLHL40, TPH1, RELL2, CACNG5


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ANKRD26_MCM10


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for ANKRD26_MCM10


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource