FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 18065

FusionGeneSummary for JMJD1C_CTNNA3

check button Fusion gene summary
Fusion gene informationFusion gene name: JMJD1C_CTNNA3
Fusion gene ID: 18065
HgeneTgene
Gene symbol

JMJD1C

CTNNA3

Gene ID

221037

29119

Gene namejumonji domain containing 1Ccatenin alpha 3
SynonymsKDM3C|TRIP-8|TRIP8ARVD13|VR22
Cytomap

10q21.3

10q21.3

Type of geneprotein-codingprotein-coding
Descriptionprobable JmjC domain-containing histone demethylation protein 2CTR-interacting protein 8thyroid hormone receptor interactor 8thyroid receptor-interacting protein 8catenin alpha-3alpha-T-cateninalpha-catenin-like proteincatenin (cadherin-associated protein), alpha 3
Modification date2018052320180519
UniProtAcc

Q15652

Q9UI47

Ensembl transtripts involved in fusion geneENST00000399262, ENST00000402544, 
ENST00000399251, ENST00000542921, 
ENST00000489372, 
ENST00000433211, 
ENST00000373744, ENST00000545309, 
ENST00000373735, 
Fusion gene scores* DoF score13 X 8 X 6=62410 X 8 X 6=480
# samples 1310
** MAII scorelog2(13/624*10)=-2.26303440583379
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(10/480*10)=-2.26303440583379
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: JMJD1C [Title/Abstract] AND CTNNA3 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDOVTCGA-20-1684-01AJMJD1Cchr10

65140078

-CTNNA3chr10

68535282

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000399262ENST00000433211JMJD1Cchr10

65140078

-CTNNA3chr10

68535282

-
In-frameENST00000399262ENST00000373744JMJD1Cchr10

65140078

-CTNNA3chr10

68535282

-
5CDS-intronENST00000399262ENST00000545309JMJD1Cchr10

65140078

-CTNNA3chr10

68535282

-
5CDS-intronENST00000399262ENST00000373735JMJD1Cchr10

65140078

-CTNNA3chr10

68535282

-
intron-3CDSENST00000402544ENST00000433211JMJD1Cchr10

65140078

-CTNNA3chr10

68535282

-
intron-3CDSENST00000402544ENST00000373744JMJD1Cchr10

65140078

-CTNNA3chr10

68535282

-
intron-intronENST00000402544ENST00000545309JMJD1Cchr10

65140078

-CTNNA3chr10

68535282

-
intron-intronENST00000402544ENST00000373735JMJD1Cchr10

65140078

-CTNNA3chr10

68535282

-
5UTR-3CDSENST00000399251ENST00000433211JMJD1Cchr10

65140078

-CTNNA3chr10

68535282

-
5UTR-3CDSENST00000399251ENST00000373744JMJD1Cchr10

65140078

-CTNNA3chr10

68535282

-
5UTR-intronENST00000399251ENST00000545309JMJD1Cchr10

65140078

-CTNNA3chr10

68535282

-
5UTR-intronENST00000399251ENST00000373735JMJD1Cchr10

65140078

-CTNNA3chr10

68535282

-
intron-3CDSENST00000542921ENST00000433211JMJD1Cchr10

65140078

-CTNNA3chr10

68535282

-
intron-3CDSENST00000542921ENST00000373744JMJD1Cchr10

65140078

-CTNNA3chr10

68535282

-
intron-intronENST00000542921ENST00000545309JMJD1Cchr10

65140078

-CTNNA3chr10

68535282

-
intron-intronENST00000542921ENST00000373735JMJD1Cchr10

65140078

-CTNNA3chr10

68535282

-
intron-3CDSENST00000489372ENST00000433211JMJD1Cchr10

65140078

-CTNNA3chr10

68535282

-
intron-3CDSENST00000489372ENST00000373744JMJD1Cchr10

65140078

-CTNNA3chr10

68535282

-
intron-intronENST00000489372ENST00000545309JMJD1Cchr10

65140078

-CTNNA3chr10

68535282

-
intron-intronENST00000489372ENST00000373735JMJD1Cchr10

65140078

-CTNNA3chr10

68535282

-

Top

FusionProtFeatures for JMJD1C_CTNNA3


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
JMJD1C

Q15652

CTNNA3

Q9UI47

May be involved in formation of stretch-resistant cell-cell adhesion complexes. {ECO:0000303|PubMed:11590244}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneJMJD1Cchr10:65140078chr10:68535282ENST00000399251-2252274_2498-108477DomainJmjC
HgeneJMJD1Cchr10:65140078chr10:68535282ENST00000399262-2262274_24981112541DomainJmjC
HgeneJMJD1Cchr10:65140078chr10:68535282ENST00000542921-1252274_2498-2062359DomainJmjC
HgeneJMJD1Cchr10:65140078chr10:68535282ENST00000399251-2252066_2070-108477MotifNote=LXXLL motif
HgeneJMJD1Cchr10:65140078chr10:68535282ENST00000399262-2262066_20701112541MotifNote=LXXLL motif
HgeneJMJD1Cchr10:65140078chr10:68535282ENST00000542921-1252066_2070-2062359MotifNote=LXXLL motif
HgeneJMJD1Cchr10:65140078chr10:68535282ENST00000399251-2251846_1871-108477Zinc fingerC6-type
HgeneJMJD1Cchr10:65140078chr10:68535282ENST00000399262-2261846_18711112541Zinc fingerC6-type
HgeneJMJD1Cchr10:65140078chr10:68535282ENST00000542921-1251846_1871-2062359Zinc fingerC6-type
TgeneCTNNA3chr10:65140078chr10:68535282ENST00000373744-517325_379349896Coiled coilOntology_term=ECO:0000255
TgeneCTNNA3chr10:65140078chr10:68535282ENST00000373744-51774_111349896Coiled coilOntology_term=ECO:0000255
TgeneCTNNA3chr10:65140078chr10:68535282ENST00000433211-618325_379349896Coiled coilOntology_term=ECO:0000255
TgeneCTNNA3chr10:65140078chr10:68535282ENST00000433211-61874_111349896Coiled coilOntology_term=ECO:0000255


Top

FusionGeneSequence for JMJD1C_CTNNA3


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_JMJD1C_ENST00000399262_chr10_65140078_-_CTNNA3_ENST00000433211_chr10_68535282_-_658aa
MAVETRAELVGKRFLCVAVGDEARSERWESGRGWRSWRAGVIRAVSHRDSRNPDLAVYVEFDDLEWDKREWVKVYEDFSTFLVEYHLIWA
KRNDPSQTQGSKSKQIQWPALAGKKERSNTLNIALDNMCKKTRDLRRQLRKAIIDHVSDSFLDTTVPLLVLIEAAKNGREKEIKEYAAIF
HEHTSRLVEVANLACSMSTNEDGIKIVKIAANHLETLCPQIINAALALAARPKSQAVKNTMEMYKRTWENHIHVLTEAVDDITSIDDFLA
VSESHILEDVNKCIIALRDQDADNLDRAAGAIRGRAARVAHIVTGEMDSYEPGAYTEGVMRNVNFLTSTVIPEFVTQVNVALEALSKSSL
NVLDDNQFVDISKKIYDTIHDIRCSVMMIRTPEELEDVSDLEEEHEVRSHTSIQTEGKTDRAKMTQLPEAEKEKIAEQVADFKKVKSKLD
AEIEIWDDTSNDIIVLAKNMCMIMMEMTDFTRGKGPLKHTTDVIYAAKMISESGSRMDVLARQIANQCPDPSCKQDLLAYLEQIKFYSHQ
LKICSQVKAEIQNLGGELIMSALDSVTSLIQAAKNLMNAVVQTVKMSYIASTKIIRIQSPAGPRHPVVMWRMKAPAKKPLIKREKPEETC

>In-frame_JMJD1C_ENST00000399262_chr10_65140078_-_CTNNA3_ENST00000373744_chr10_68535282_-_658aa
MAVETRAELVGKRFLCVAVGDEARSERWESGRGWRSWRAGVIRAVSHRDSRNPDLAVYVEFDDLEWDKREWVKVYEDFSTFLVEYHLIWA
KRNDPSQTQGSKSKQIQWPALAGKKERSNTLNIALDNMCKKTRDLRRQLRKAIIDHVSDSFLDTTVPLLVLIEAAKNGREKEIKEYAAIF
HEHTSRLVEVANLACSMSTNEDGIKIVKIAANHLETLCPQIINAALALAARPKSQAVKNTMEMYKRTWENHIHVLTEAVDDITSIDDFLA
VSESHILEDVNKCIIALRDQDADNLDRAAGAIRGRAARVAHIVTGEMDSYEPGAYTEGVMRNVNFLTSTVIPEFVTQVNVALEALSKSSL
NVLDDNQFVDISKKIYDTIHDIRCSVMMIRTPEELEDVSDLEEEHEVRSHTSIQTEGKTDRAKMTQLPEAEKEKIAEQVADFKKVKSKLD
AEIEIWDDTSNDIIVLAKNMCMIMMEMTDFTRGKGPLKHTTDVIYAAKMISESGSRMDVLARQIANQCPDPSCKQDLLAYLEQIKFYSHQ
LKICSQVKAEIQNLGGELIMSALDSVTSLIQAAKNLMNAVVQTVKMSYIASTKIIRIQSPAGPRHPVVMWRMKAPAKKPLIKREKPEETC


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_JMJD1C_ENST00000399262_chr10_65140078_-_CTNNA3_ENST00000433211_chr10_68535282_-_1974nt
ATGGCGGTAGAGACGCGGGCAGAGCTGGTGGGTAAGCGGTTCCTGTGTGTGGCGGTCGGCGACGAGGCACGTTCGGAGCGCTGGGAGAGC
GGACGCGGCTGGCGAAGCTGGCGAGCGGGGGTCATCCGAGCCGTGTCACACAGGGACAGCCGCAATCCGGACCTGGCGGTGTATGTGGAA
TTTGATGATCTTGAATGGGATAAACGAGAGTGGGTTAAAGTTTATGAAGATTTTTCAACTTTCTTGGTGGAATACCACTTAATCTGGGCC
AAAAGGAATGACCCTAGCCAGACTCAGGGATCAAAGAGCAAACAGATTCAGTGGCCTGCATTGGCTGGAAAAAAAGAAAGGAGTAATACC
CTGAATATTGCTTTAGACAACATGTGTAAGAAGACAAGAGACCTTCGCAGACAGCTCCGCAAGGCTATTATAGATCATGTGTCAGACTCT
TTCCTGGATACGACAGTCCCTCTTTTGGTTCTCATTGAAGCTGCTAAGAATGGCCGGGAAAAGGAAATAAAAGAATATGCTGCGATATTT
CATGAACACACCAGCAGGCTTGTAGAGGTGGCAAATCTTGCTTGTTCCATGTCAACAAATGAAGATGGAATTAAAATTGTCAAAATTGCA
GCCAATCATTTGGAAACCTTGTGTCCACAGATTATTAATGCTGCACTTGCTTTGGCTGCAAGACCCAAAAGTCAAGCGGTCAAAAACACC
ATGGAAATGTACAAGCGTACATGGGAGAATCATATACATGTCCTCACTGAAGCCGTAGATGACATTACAAGCATTGATGACTTCCTTGCT
GTATCTGAAAGCCATATCTTGGAAGATGTCAACAAGTGTATCATAGCCTTAAGAGACCAGGATGCTGATAATTTAGACCGTGCTGCGGGT
GCTATCAGAGGCCGGGCAGCAAGAGTTGCTCACATCGTCACGGGTGAAATGGACAGTTACGAGCCAGGGGCTTACACGGAAGGTGTAATG
AGAAATGTTAACTTCCTTACAAGTACTGTAATTCCTGAATTTGTAACACAAGTGAATGTTGCCTTGGAAGCCTTAAGCAAAAGCTCATTG
AATGTGTTGGATGATAATCAATTTGTGGACATCTCAAAGAAGATCTATGATACAATTCATGATATCAGATGTTCAGTCATGATGATTCGG
ACCCCAGAGGAACTGGAGGATGTTTCTGACCTTGAAGAGGAACACGAGGTCCGCAGTCACACCAGCATTCAGACCGAAGGGAAAACTGAT
AGGGCTAAGATGACTCAACTGCCTGAGGCAGAAAAAGAAAAGATTGCTGAGCAAGTTGCTGATTTCAAGAAAGTAAAGAGTAAGCTGGAT
GCTGAGATTGAGATATGGGATGATACAAGCAACGACATCATTGTTCTGGCCAAGAACATGTGTATGATCATGATGGAGATGACAGACTTC
ACTAGGGGCAAAGGACCACTAAAGCATACAACTGATGTGATCTATGCAGCGAAAATGATATCAGAATCAGGATCAAGGATGGATGTCCTT
GCTCGGCAGATTGCTAATCAGTGCCCAGATCCATCTTGTAAACAGGACTTGTTGGCCTACCTGGAACAGATTAAGTTCTACTCCCACCAA
CTGAAAATCTGCAGTCAAGTTAAAGCTGAGATCCAGAACCTGGGAGGAGAGCTCATCATGTCAGCTTTGGACAGTGTCACATCCCTGATC
CAAGCAGCCAAAAATTTAATGAATGCTGTAGTGCAAACAGTGAAAATGTCTTACATTGCCTCAACCAAGATCATCCGAATCCAGAGTCCT
GCTGGGCCCCGGCACCCAGTTGTGATGTGGAGAATGAAGGCTCCTGCAAAAAAACCCTTGATTAAAAGAGAGAAGCCAGAGGAAACGTGT

>In-frame_JMJD1C_ENST00000399262_chr10_65140078_-_CTNNA3_ENST00000373744_chr10_68535282_-_1974nt
ATGGCGGTAGAGACGCGGGCAGAGCTGGTGGGTAAGCGGTTCCTGTGTGTGGCGGTCGGCGACGAGGCACGTTCGGAGCGCTGGGAGAGC
GGACGCGGCTGGCGAAGCTGGCGAGCGGGGGTCATCCGAGCCGTGTCACACAGGGACAGCCGCAATCCGGACCTGGCGGTGTATGTGGAA
TTTGATGATCTTGAATGGGATAAACGAGAGTGGGTTAAAGTTTATGAAGATTTTTCAACTTTCTTGGTGGAATACCACTTAATCTGGGCC
AAAAGGAATGACCCTAGCCAGACTCAGGGATCAAAGAGCAAACAGATTCAGTGGCCTGCATTGGCTGGAAAAAAAGAAAGGAGTAATACC
CTGAATATTGCTTTAGACAACATGTGTAAGAAGACAAGAGACCTTCGCAGACAGCTCCGCAAGGCTATTATAGATCATGTGTCAGACTCT
TTCCTGGATACGACAGTCCCTCTTTTGGTTCTCATTGAAGCTGCTAAGAATGGCCGGGAAAAGGAAATAAAAGAATATGCTGCGATATTT
CATGAACACACCAGCAGGCTTGTAGAGGTGGCAAATCTTGCTTGTTCCATGTCAACAAATGAAGATGGAATTAAAATTGTCAAAATTGCA
GCCAATCATTTGGAAACCTTGTGTCCACAGATTATTAATGCTGCACTTGCTTTGGCTGCAAGACCCAAAAGTCAAGCGGTCAAAAACACC
ATGGAAATGTACAAGCGTACATGGGAGAATCATATACATGTCCTCACTGAAGCCGTAGATGACATTACAAGCATTGATGACTTCCTTGCT
GTATCTGAAAGCCATATCTTGGAAGATGTCAACAAGTGTATCATAGCCTTAAGAGACCAGGATGCTGATAATTTAGACCGTGCTGCGGGT
GCTATCAGAGGCCGGGCAGCAAGAGTTGCTCACATCGTCACGGGTGAAATGGACAGTTACGAGCCAGGGGCTTACACGGAAGGTGTAATG
AGAAATGTTAACTTCCTTACAAGTACTGTAATTCCTGAATTTGTAACACAAGTGAATGTTGCCTTGGAAGCCTTAAGCAAAAGCTCATTG
AATGTGTTGGATGATAATCAATTTGTGGACATCTCAAAGAAGATCTATGATACAATTCATGATATCAGATGTTCAGTCATGATGATTCGG
ACCCCAGAGGAACTGGAGGATGTTTCTGACCTTGAAGAGGAACACGAGGTCCGCAGTCACACCAGCATTCAGACCGAAGGGAAAACTGAT
AGGGCTAAGATGACTCAACTGCCTGAGGCAGAAAAAGAAAAGATTGCTGAGCAAGTTGCTGATTTCAAGAAAGTAAAGAGTAAGCTGGAT
GCTGAGATTGAGATATGGGATGATACAAGCAACGACATCATTGTTCTGGCCAAGAACATGTGTATGATCATGATGGAGATGACAGACTTC
ACTAGGGGCAAAGGACCACTAAAGCATACAACTGATGTGATCTATGCAGCGAAAATGATATCAGAATCAGGATCAAGGATGGATGTCCTT
GCTCGGCAGATTGCTAATCAGTGCCCAGATCCATCTTGTAAACAGGACTTGTTGGCCTACCTGGAACAGATTAAGTTCTACTCCCACCAA
CTGAAAATCTGCAGTCAAGTTAAAGCTGAGATCCAGAACCTGGGAGGAGAGCTCATCATGTCAGCTTTGGACAGTGTCACATCCCTGATC
CAAGCAGCCAAAAATTTAATGAATGCTGTAGTGCAAACAGTGAAAATGTCTTACATTGCCTCAACCAAGATCATCCGAATCCAGAGTCCT
GCTGGGCCCCGGCACCCAGTTGTGATGTGGAGAATGAAGGCTCCTGCAAAAAAACCCTTGATTAAAAGAGAGAAGCCAGAGGAAACGTGT


* Fusion transcript sequences (Full-length transcript).
>In-frame_JMJD1C_ENST00000399262_chr10_65140078_-_CTNNA3_ENST00000433211_chr10_68535282_-_10005nt
CACAAGGCTGCGAATCTGGGAGTCCAAAGGAGTGTTTGCGGGGAGGGCCCGAGGTCGCTGTGTCCGGGGCAGAGCGGCCGGTTCGTCCCG
AGTCTGCGCTCTTTCGGGTCCGCTGCTGTGTCCCGGTCCGCTCTCCTCAGCATGAGCGGCCGGTAGGAGTGAGGTTTCATCGGTTCCCTC
GCACTGGAGGAGGCAGCGGCCGCTTCGGCAGCGACAGCTATGGCGGTAGAGACGCGGGCAGAGCTGGTGGGTAAGCGGTTCCTGTGTGTG
GCGGTCGGCGACGAGGCACGTTCGGAGCGCTGGGAGAGCGGACGCGGCTGGCGAAGCTGGCGAGCGGGGGTCATCCGAGCCGTGTCACAC
AGGGACAGCCGCAATCCGGACCTGGCGGTGTATGTGGAATTTGATGATCTTGAATGGGATAAACGAGAGTGGGTTAAAGTTTATGAAGAT
TTTTCAACTTTCTTGGTGGAATACCACTTAATCTGGGCCAAAAGGAATGACCCTAGCCAGACTCAGGGATCAAAGAGCAAACAGATTCAG
TGGCCTGCATTGGCTGGAAAAAAAGAAAGGAGTAATACCCTGAATATTGCTTTAGACAACATGTGTAAGAAGACAAGAGACCTTCGCAGA
CAGCTCCGCAAGGCTATTATAGATCATGTGTCAGACTCTTTCCTGGATACGACAGTCCCTCTTTTGGTTCTCATTGAAGCTGCTAAGAAT
GGCCGGGAAAAGGAAATAAAAGAATATGCTGCGATATTTCATGAACACACCAGCAGGCTTGTAGAGGTGGCAAATCTTGCTTGTTCCATG
TCAACAAATGAAGATGGAATTAAAATTGTCAAAATTGCAGCCAATCATTTGGAAACCTTGTGTCCACAGATTATTAATGCTGCACTTGCT
TTGGCTGCAAGACCCAAAAGTCAAGCGGTCAAAAACACCATGGAAATGTACAAGCGTACATGGGAGAATCATATACATGTCCTCACTGAA
GCCGTAGATGACATTACAAGCATTGATGACTTCCTTGCTGTATCTGAAAGCCATATCTTGGAAGATGTCAACAAGTGTATCATAGCCTTA
AGAGACCAGGATGCTGATAATTTAGACCGTGCTGCGGGTGCTATCAGAGGCCGGGCAGCAAGAGTTGCTCACATCGTCACGGGTGAAATG
GACAGTTACGAGCCAGGGGCTTACACGGAAGGTGTAATGAGAAATGTTAACTTCCTTACAAGTACTGTAATTCCTGAATTTGTAACACAA
GTGAATGTTGCCTTGGAAGCCTTAAGCAAAAGCTCATTGAATGTGTTGGATGATAATCAATTTGTGGACATCTCAAAGAAGATCTATGAT
ACAATTCATGATATCAGATGTTCAGTCATGATGATTCGGACCCCAGAGGAACTGGAGGATGTTTCTGACCTTGAAGAGGAACACGAGGTC
CGCAGTCACACCAGCATTCAGACCGAAGGGAAAACTGATAGGGCTAAGATGACTCAACTGCCTGAGGCAGAAAAAGAAAAGATTGCTGAG
CAAGTTGCTGATTTCAAGAAAGTAAAGAGTAAGCTGGATGCTGAGATTGAGATATGGGATGATACAAGCAACGACATCATTGTTCTGGCC
AAGAACATGTGTATGATCATGATGGAGATGACAGACTTCACTAGGGGCAAAGGACCACTAAAGCATACAACTGATGTGATCTATGCAGCG
AAAATGATATCAGAATCAGGATCAAGGATGGATGTCCTTGCTCGGCAGATTGCTAATCAGTGCCCAGATCCATCTTGTAAACAGGACTTG
TTGGCCTACCTGGAACAGATTAAGTTCTACTCCCACCAACTGAAAATCTGCAGTCAAGTTAAAGCTGAGATCCAGAACCTGGGAGGAGAG
CTCATCATGTCAGCTTTGGACAGTGTCACATCCCTGATCCAAGCAGCCAAAAATTTAATGAATGCTGTAGTGCAAACAGTGAAAATGTCT
TACATTGCCTCAACCAAGATCATCCGAATCCAGAGTCCTGCTGGGCCCCGGCACCCAGTTGTGATGTGGAGAATGAAGGCTCCTGCAAAA
AAACCCTTGATTAAAAGAGAGAAGCCAGAGGAAACGTGTGCAGCTGTCAGACGAGGCTCAGCAAAGAAAAAAATCCATCCATTGCAAGTC
ATGAGTGAATTTAGAGGAAGACAAATCTACTGAAACCACTATTCTACATATAGTGCCTATATGACAAAATCCTGCCTAACCACACTGCTT
TATTTTACACTTAAGAAGTTCTGTAATTTCACTAAGTTTTGGTGTTTAACTCACAAATAACATAAAATATTGGGCGCTAAATCAACAAAA
GCAATATATATTTGGGATCATATCACTGTCATTTCTGTATGGTCAGCACCTAATAGTTAAGGAATATTTGCTTGTTGAATGAATGAAATT
ATCACGTGTCATTCAGCGTTTCCCATCATAGAGATTATCTACTATTCGTTACCAAATAAACACAGGAGAGGCCAGAGAGTCCTGTTTATC
TGTAATACTTCATGTACACTTATCATCCTTATCTTGAATTAAAACACTAACATGAGCTCCTAACTTGGTTTTTTAATAGAAACAAAAGAC
TTTTATAAAATATTTTCCCATTTAATCTCCATGCTTTCTTTATCTGATCTAACCTGGCACCTAACCAGGCAGAAATGTATGATTCCTGCC
ATAGCAAAAAAACCACCTTTTAATCTCTAGATAGCTGTACTCATTGTCAACTTATTAGGCTAATATCCATTATAAACTAATCAAATTTGA
ATAGTTAGGCTACTTGCTGGATTTTGAAGGTCAACCTTGTTTATTAATAAAATGCTTTCTTAACATTATAAAGGTTACAATGAGTTCTGA
TGCCACATACTCACCTTTTGGGTTTCCAATGTGTTAGAGAGTTCTGTACTTTTGAGTGTTAGGCCTATCCGAATACATATGTGAAAGAAG
AGTTATCACCCATTGGGAAAATGAGACAACAAACTATATCCCAAAGTGAGTTATATTAATAATAACAGAAGTGTAAGTTCTGTATGACCC
TATTTTTACAAACATAAAAATACATTTTTATCAGCTTGCAATTGTAATTAAAAGGAAAATGGCAGTTTGAAAAATCTTTTGACGTTGAGT
AAAATATAACTGCATGAACTGTACCATTGAACTATGAAGCAGTTAATGGCAATGAAGCTGGAGTGATTTTAATAACGTTCTTTTAAATAA
AAGTCACTGGGGTCATTTTACAACTCCAGTCACTGTGTTCATTCCTAGTTGAGTTCATAATGGACTTCATAATAGTCTTAGAGTCTAGTG
TACCTCTCTCTGTCATTCTCTCTCTCTTTTTCTCTCCCCTGATGACCTGCCTCTCTCTGTCTTTCAAAAATGTCCTTAACAGAAACTCTT
TGGAGGCCATAAGTTTTGTTTTCATTTTTTCTCATTCATAGAGTTCTGATTCACAGACTTTAAAAAACATTTTCTATTCTACATTATCAT
AATAGTATTATATTGTACCTTTTTACTTCTAAAACATTGCCATTGATGAGAGGCGTCTCAGCAACGATGTAACCTTAGATTGATGAGAAA
AAAATTTACACATACAATACCAGTTGATATTAGGAGAACCAGTTTGGGTAAAAGGATGCATGAAACATAGAAAAGCATAAAGATTGACAG
TACGATATGTGTGGAATCTTAAGCATAATGGTATGGGAAAAGAAGGATCTATTTAATAGGTCATTATTAATTATGCAGGAAATGTTAAAT
TTCTTGTAATGAATTATTTCAATCTTCCAAGTAGCTGGATTGCCTGAGCTCAGTGTAAAACTTCCTAGGAGGTGAAGGCAATAAACTCCT
CCCTGTTTTGCACCATAGACTGGCCTACAATAACTATTCTGAACAGAATGCACTGCCCAGAAGAAAAGGCAGTGAAGAAGGGAATTAGGG
AATTCAGATGACTCTGTTTTTCAGAATTATCTAGATGATTGAGGCAAATAGAGATTTTCTTTTATTGAAATGCTGCCATCATTTTCTGCT
CTAAGTGTAGATGTTGCACGAGTGACATCTGTGGTATATCCTTCTTCCAGATAGAAGTATAAATTTATAATTTAGTGGGGAGAGGAATTT
TCTTTTAATCACCAAACTACCAGCTGTATAGAAAATTTTTTTGAAATCACCAAACTAGCAGTTGTGTATCTTAGCTCCTAAAGCCACATT
CACAAGAATCATAAGCATCTCATTTAGAAAATCTAATGTCCACCGGACCCAACATCATCTTTCCACATGTTGGAGTTTAGAACATGCAGT
ATTGGACACCAAAAGAACAGAAATAACTTGAAATTATACAATTACCAAATAACCTCCATCTCTTTGATAAAAATGACTTTTTACCCAAAG
TGAGATGTGAACAAGTTCTCCTCTTTAACCCAGGCAGATTTTCAGCTTAGCTCAAAGCAAACTATAATTAAATAAAACAATAAAAATTTT
AACTCAATGAATATCCTAGGAGTTAATCTGCTGTGGTAATCGATAGTGACATAAAAACAAGATGCATAGAGCTGAAAAAGGCATCTGTCC
ACCTGAGTGAATTCCTGTAGTAGGCAGCATTTCAAGATTTAGTTTGATTCAAACCTGCTGATAAAACAAATGCTTATATGCAAGAAAAAC
TAGCAGCAAGATATGAATAAATCTCCCCATTATGTTAAAAACTAATCAGCATGACACATTTATATTTAGGTATTTCTTCTGCAGAGGATT
GCCAGAAATTTCTTAATGAGAGTGATAATTTGGTGATCCACCTATGTACCTTTTGATGTCTCATCACAGAGATTAGTGCTTCCTCTGATA
ATACATTTGCTTGATCCTGCTAATAAGAACTCACCTTTCTTTTTAACGAAATCAATTTGTGTTAATTTACATAGGGAAAAACGTTCCTTG
AGAGGGAGGAGAGGGGTGTTTACCACCCACAGGAGCAGTTCCATCCCTGGTTACCCACCAGTATCCCTGCCAGATGTTAGACTGGAATTA
GAATGAAAATTTAAAAAAAAACGAAATAATAATCCACTAAATGGCCTTCTAATTAGAGAAATTTGAAGATTTCTATCAAATATAAAAAGT
GAGAAATAGAAATCATTCCCTTTAATTTATGACAAATTAAAATTATTGAAGTAAAATGTTTCTAAGTCAGTTTCTGGATAGTTCTTGAAT
GAGTCAAGAAAAAACTCAAACACTAAATTTCTAAGCTAATTTGTTCATTATTCCTTTCTGTTTATTATTTATTATATGAGTGCAAATTGC
AAATGTATTAGAAAAGACAATATAGCCTTCACATTCACAAGTGTGCCTTCTGGCCTTTGAAATCTTTTAACATAAGATCAATATAACATA
TTTGTTCCCCATAAAAATCTCTTATGTACAGGGAATAAGGTCCTCCATAGCTACACAGAGACACCCATTCTTGCAGTCTGGCATTCTTAA
CACCTTTAGCTTCAAAGGCAGTCGGTTTCAATTTCAAGCTAAAATTGTGAATATACAATTAAGTGCGCAACTTGGGCCTTCAGACCAAAT
AATTAATGCTCCTCAAATTAAATAATGAGTGGCTGAAAAGCCTAATGTGTAACAACAGAGTAAGTGACTTCAACGGCTTCCTGAACCTTC
ATTTTGAGGGTGTTCTCATCTCACCCACCTCTGGGCTAGGTATCCTCTGTTAATTGCTAACAATTTCCTACCAAAATAGTGCAATCAGGA
CTGCCCATCACAGCAAATTACTCCAATTAATGCCCTTTCCTCTTCTGTGAACCAAAAATATCTCTCTCCTGTCTCTCATCTCTATCCCAG
GTATAAATTGACTAATAAATTTTACAGAGTTTTAGTCAAAATTATGAATTTTAATTTCCAGCAACATTATTCCTTTAGTCTTTCTATTCC
CCAAAACATTCTTAAATTTTGGTATCAAATGTTCATTTCTGTCCTAGAGATTGTGGTTCCCATGGCTACAGATTTTTGTATAGTGGTAGT
ATGAGTGGAATAAGATCTGAGACTTTTCCTGGTGATATCCACCATTCTCTTGTGAACTCATTGCAGAATAAACAGCCTCTTTCACTTTCA
TTGTAAGTAGTTCTTTAGGTTGGCAAAGCAGGCACCAGAATCTGAATTTGAATGAAATCTGTACTTTCTTTTGTTGGCCTATTTTTTGCC
AAGACAGCCTGCCTATTGTATATTTAGGAATCAAATATTCATTTTTTCTGTTTGTAAAGCCAGAAATATTTCAGTTAAAAAGAATATAAT
TTTATATTATTTTAATAATTCTTTTTAAGTAAAGTAGGAAAATTTCTGCCACCTGAGATGTTACTGTTTTTATTTATATGAAAATTCCAT
TTTTTTCTTTATGACTCTTTTCCCATACCATTATGATATGTTCAGCATTAGTATTTTCCATTTTACCACTAAACAAATAAGCCAGGACTA
ATAACAATAGCAGTTTGAGAGTTTTTATTTTGGCATTTTGGTTTTAATTAGGAAAGAAAACATGGATGCTATTAAAACTAGTTGTAGTTA
AAAATGTTTTGAATGAGGCTACTAACGCTATCTTAGTCATCTCAAAGAGAAAGAGAAGAAGTAAAATTTTAAATACCTTTTTGGCATTTT
TAACCAATTCATATGAACAAAAACATATATTCTATTAAAGCAAAATAAAGAATAGTTTAAAACACTAGTCTTCTTGCATGTGAATATTTT
CCCCCTAACAGACAAGATAGAATCCATTTCTGGACACTCTAAAAGAAAGTAATGTTAATTGAGAGAGCTGTCTCCAAATGGAACTCAACC
TGACCAGAATCCCATCCGCAGGCAAGAGATGGGCTGTGGGGCCGACCATAAGTTTTATTCTGAGACGAGATGCTTTATGGCTGCTGGCTG
CATTATGGCATCTAGCAGTCCCCACTGGTTTGTGGGAACAAAACACATGGATTGATATTCAATATGAGTTTGGTAAGTTGGAGAAAAATG
GAGACGATACGGAGTAGTCTAAAGGCACAACAAATAAGAAGGTGCCAGAGGTAGGGAAGGGTCTGAGAGGGGTAGTTGCAGAAGCATTTA
GCTTTCATAGATGAGGGGAGAGTTTTTTGGTTTTATGAAGATTAGGCAGCCCTCCTGAGGAAAGTATTAAGGATAGAATGAGACACTTGT
CTTGGTGGTTTGGTGAAGTCGTGTCGAAGGCAAAAGGATGAACTACACATATTTTGAGCATGATTTAGTAATATTGTTTGCAAGTTGAGA
AACAGAAATTCAGCCATTCTCCTGACTGATGGTAGGTGAAATTCTTCCCAATATTAGAGCCAATCTGGGTTACCATACGTTCATATATTT
AACAGCTATTTGTTAAACAACTGTGATGTTCCAGGCACTGTTCTAGGTTCTTAGGATACACCATATAACAAAACAAATAGTGATCCTTGC
CCTCATGTGCCAGCTCTGTGTTAAATGCTAACTATTATCTTATTCAATCCTCCAAATAACCCTATAGGATATATATCATTCCACAGACAA
GGAAGCTGAGGGTTAAATGGGATAAGAATCTTGCTCAAAGTCTCACTGGCTTTAAAATATTAATATATATTTTACATCATTCAAGACAGA
TATATAATTAGCTGAATATTCTCACCTCTATTAACTGAATGTAGAGTGTCAGGTACATGGGAAGTAAGTTATTTACGTGATCTGAAATAA
GAGGACAACCTTTGCCAAATTACTTTTATTACCATGGAGAAGAAAGCTTCAATGAAATGCCTGTTTCAGCCCATCTTCAGTATTGGTTGG
TTAATACCATTTGTTAACACCAATCCTTTCCTCTTTTACTGCTAACATGTGACTGTGTTTAAAATTATAGATTGCAGCAGAGTGTTGGCC
AAGGATTATTGTAGTAGGATAAAGTTTCCCTGTATTTGAAATTTACCCAAACTGTAGCAAATACATCTTTCCTTCTTTATGGAGGTCACA
CGTGTGCATAGTATGTGCCTGAATACAGGTAAACTTTGTGTTTTAAAATTACATGGCCTTTTTTAGAGTCGACTGAAGGCTAGACTCTTC
TTGCCCATGTTGCTGGATAGGCTTTCAAATCTCAGGCCTTGGAGAGTTAAATGACTTTCTGATATTTCTTACGGTGGAGCCACATAAGAA
ATACACACATTCCTAGTTTGAGCAATGGATGTGTATATTGGGGATCTTCACTTTTATGTATCTGGTAGTCATGATGGTGCCTATTCCCAA
CTGTAGGAAAGGAAAGCCCTCAAGGAGAAAATTCTCTTTCAAAAAGGCTCAGATTTCTAACAATTATGTCTAAATGTTTCTTCAATTTAG
AACATGTACAAAAGCTACTTAATATTAGCAGAGTAGTTCTTGTGTTTTCATTTCAAATGAAATATTCCCAGTTCCAAAGTTTATTTCCTT
GGCATTTTCAAGAAGGATGGTTATTTTTAGTTCTGGTTATTTGGTGTTGGAGGTCTGTGACACTTCCTTATACATTTAAAGCCCCCTTTG
AATAGTTGTATCAATAGTTCAAAAGCCTGTAGATATCTTGCTTTTCTATTCTGACAGCCCAGCTTCTGCAGACTCAGGCCAACCTTAGGT
ATGTCACATCAGTTCCCCATCTGTGTAAATTACCTGAACCTCTCTGTGGTATTCACTGAGAGTTGAGCTTCTACTAAGGGATTTCCTTGA
CCTGGGCTTTTAACACCAGATTTGTAGTGGAGTGTTTATTAGTAAAGCAAAGGAGTAAGTCAGAGATGCTAGCCCCTGCTCTCAGTTAAA
CAGAACTATCCTCCTTCCTGAATATTTAAACATAAAATTAATTTTAAACTACTATAAAAATCATGTTCCATTGCTTGCCAAATCTTATAC
CATTATAATGCTGTATTTTTACATGTTAGTATACATTGTGTCCATAGGGATATAAATATGAGAATTTCAGCAACTGTCTTGCAGGGTTAA
GATGTGCTATTTGTTGATTTTGCAAATTTTTCTCATGTGGTACAGTCCCTCCAAAGAAAATTTCCTTAGACCTAAATGGTAGCATAATAA
TTTCTCCTCCATATCCGTGACTAACAAGTTCCTGAAAACAGAAGTAGACATATTTTATGCCCAATTTAGTACCTAATAATTGAGGCTTAA
AACAAAATTTTCTTGGGCAAGTTGGGTGATTAAATATGAATTAAAACTTCTAGAGAAAGATTTCCAGATGCCCCTGTTTTCCATTTTGAT
TATGGTTTTAGTTTCATAGCAACTTGGGGGAAAAAAATCATTTACTTTATGTCGTATTACAACAACAACTTTGACAGCTTAAATGTAGTG
ACCTCTCTGAAGGTAATATGCACATTATAATTTAGGATGAAAGCAGATTTAAACTAAGACTTTCTGAGATGAAATAAAAGTAACCAATTC
ATAATAGTCATGTTTATTGCAGCAATATCTTGGGAACTTAAGTTTAGTGGCGTTTGAGGTGTTTCTGACTATCTTGCTTGTTCATTTCAC
CCTGCTCTGCAGAGACAGAATATGATTGAATGAACTGCCCATTATATTAATGACCAGTTCAAAGCAGTTTTGTGCTTTGGCTATAGATAA
AATTTGGCAAAAATACTGTAGGCCTTTCTGGTCCATATTTATCCTTAAAGTATTTTTGCCAATCAATAAAAATGAAATATTTATCCAGAA
ATAGAAAAAGCTCTTTCCTATGACATTGACATAGAAGCCCAAATACTCCTTGTTTGAGACCCTGCATGTCTTTTGTGTTTAACTGAATCA
ATGATTTTTTTTAGTTGTGCTCTTAATTGCATTATTTCACATATGTAACACTGGGTTTGTTTTGGTTATATAGTATTATTTTACTTTATT
CTAATTTCAACTCATGTCACTCTGTAGCTCATTAAGAATTTGTTCAACTGAAAATTAAAATGTGTGTTAAAGCAATAAAAATGAAAAGAT

>In-frame_JMJD1C_ENST00000399262_chr10_65140078_-_CTNNA3_ENST00000373744_chr10_68535282_-_2504nt
CACAAGGCTGCGAATCTGGGAGTCCAAAGGAGTGTTTGCGGGGAGGGCCCGAGGTCGCTGTGTCCGGGGCAGAGCGGCCGGTTCGTCCCG
AGTCTGCGCTCTTTCGGGTCCGCTGCTGTGTCCCGGTCCGCTCTCCTCAGCATGAGCGGCCGGTAGGAGTGAGGTTTCATCGGTTCCCTC
GCACTGGAGGAGGCAGCGGCCGCTTCGGCAGCGACAGCTATGGCGGTAGAGACGCGGGCAGAGCTGGTGGGTAAGCGGTTCCTGTGTGTG
GCGGTCGGCGACGAGGCACGTTCGGAGCGCTGGGAGAGCGGACGCGGCTGGCGAAGCTGGCGAGCGGGGGTCATCCGAGCCGTGTCACAC
AGGGACAGCCGCAATCCGGACCTGGCGGTGTATGTGGAATTTGATGATCTTGAATGGGATAAACGAGAGTGGGTTAAAGTTTATGAAGAT
TTTTCAACTTTCTTGGTGGAATACCACTTAATCTGGGCCAAAAGGAATGACCCTAGCCAGACTCAGGGATCAAAGAGCAAACAGATTCAG
TGGCCTGCATTGGCTGGAAAAAAAGAAAGGAGTAATACCCTGAATATTGCTTTAGACAACATGTGTAAGAAGACAAGAGACCTTCGCAGA
CAGCTCCGCAAGGCTATTATAGATCATGTGTCAGACTCTTTCCTGGATACGACAGTCCCTCTTTTGGTTCTCATTGAAGCTGCTAAGAAT
GGCCGGGAAAAGGAAATAAAAGAATATGCTGCGATATTTCATGAACACACCAGCAGGCTTGTAGAGGTGGCAAATCTTGCTTGTTCCATG
TCAACAAATGAAGATGGAATTAAAATTGTCAAAATTGCAGCCAATCATTTGGAAACCTTGTGTCCACAGATTATTAATGCTGCACTTGCT
TTGGCTGCAAGACCCAAAAGTCAAGCGGTCAAAAACACCATGGAAATGTACAAGCGTACATGGGAGAATCATATACATGTCCTCACTGAA
GCCGTAGATGACATTACAAGCATTGATGACTTCCTTGCTGTATCTGAAAGCCATATCTTGGAAGATGTCAACAAGTGTATCATAGCCTTA
AGAGACCAGGATGCTGATAATTTAGACCGTGCTGCGGGTGCTATCAGAGGCCGGGCAGCAAGAGTTGCTCACATCGTCACGGGTGAAATG
GACAGTTACGAGCCAGGGGCTTACACGGAAGGTGTAATGAGAAATGTTAACTTCCTTACAAGTACTGTAATTCCTGAATTTGTAACACAA
GTGAATGTTGCCTTGGAAGCCTTAAGCAAAAGCTCATTGAATGTGTTGGATGATAATCAATTTGTGGACATCTCAAAGAAGATCTATGAT
ACAATTCATGATATCAGATGTTCAGTCATGATGATTCGGACCCCAGAGGAACTGGAGGATGTTTCTGACCTTGAAGAGGAACACGAGGTC
CGCAGTCACACCAGCATTCAGACCGAAGGGAAAACTGATAGGGCTAAGATGACTCAACTGCCTGAGGCAGAAAAAGAAAAGATTGCTGAG
CAAGTTGCTGATTTCAAGAAAGTAAAGAGTAAGCTGGATGCTGAGATTGAGATATGGGATGATACAAGCAACGACATCATTGTTCTGGCC
AAGAACATGTGTATGATCATGATGGAGATGACAGACTTCACTAGGGGCAAAGGACCACTAAAGCATACAACTGATGTGATCTATGCAGCG
AAAATGATATCAGAATCAGGATCAAGGATGGATGTCCTTGCTCGGCAGATTGCTAATCAGTGCCCAGATCCATCTTGTAAACAGGACTTG
TTGGCCTACCTGGAACAGATTAAGTTCTACTCCCACCAACTGAAAATCTGCAGTCAAGTTAAAGCTGAGATCCAGAACCTGGGAGGAGAG
CTCATCATGTCAGCTTTGGACAGTGTCACATCCCTGATCCAAGCAGCCAAAAATTTAATGAATGCTGTAGTGCAAACAGTGAAAATGTCT
TACATTGCCTCAACCAAGATCATCCGAATCCAGAGTCCTGCTGGGCCCCGGCACCCAGTTGTGATGTGGAGAATGAAGGCTCCTGCAAAA
AAACCCTTGATTAAAAGAGAGAAGCCAGAGGAAACGTGTGCAGCTGTCAGACGAGGCTCAGCAAAGAAAAAAATCCATCCATTGCAAGTC
ATGAGTGAATTTAGAGGAAGACAAATCTACTGAAACCACTATTCTACATATAGTGCCTATATGACAAAATCCTGCCTAACCACACTGCTT
TATTTTACACTTAAGAAGTTCTGTAATTTCACTAAGTTTTGGTGTTTAACTCACAAATAACATAAAATATTGGGCGCTAAATCAACAAAA
GCAATATATATTTGGGATCATATCACTGTCATTTCTGTATGGTCAGCACCTAATAGTTAAGGAATATTTGCTTGTTGAATGAATGAAATT


Top

FusionGenePPI for JMJD1C_CTNNA3


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
JMJD1CVHL, ESR2, PPARG, NUDT21, TK1, GADD45A, AR, RNF8, RNF168, MT2A, PSMC1, SRPK2, RBPJ, NR3C1, TXNIPCTNNA3CTNNB1, CTNNA1, JUP, EHMT2, SPRY2, EPS8, CDH3, CDH12, CDH1, APC, CDH24, BLZF1, CDH10, ARVCF, PKP4, CDH4, CTNNBIP1, OSBPL1A, VMA21, RELL1, CDH2, GIMAP8, CTNND1, AMER1, FAM162A, PRKAA2, MYCBP2, ATP5B, TPD52, TRIM25


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for JMJD1C_CTNNA3


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for JMJD1C_CTNNA3


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneJMJD1CC0004352Autistic Disorder1CTD_human
HgeneJMJD1CC0010606Adenoid Cystic Carcinoma1CTD_human
HgeneJMJD1CC3495559Juvenile arthritis1CTD_human
TgeneCTNNA3C0004096Asthma1CTD_human
TgeneCTNNA3C0236969Substance-Related Disorders1CTD_human
TgeneCTNNA3C3810138ARRHYTHMOGENIC RIGHT VENTRICULAR DYSPLASIA, FAMILIAL, 131UNIPROT