FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 17874

FusionGeneSummary for ITGB4_PTN

check button Fusion gene summary
Fusion gene informationFusion gene name: ITGB4_PTN
Fusion gene ID: 17874
HgeneTgene
Gene symbol

ITGB4

PTN

Gene ID

3691

5764

Gene nameintegrin subunit beta 4pleiotrophin
SynonymsCD104|GP150HARP|HB-GAM|HBBM|HBGF-8|HBGF8|HBNF|HBNF-1|NEGF1|OSF-1
Cytomap

17q25.1

7q33

Type of geneprotein-codingprotein-coding
Descriptionintegrin beta-4CD104 antigenpleiotrophinheparin affin regulatory proteinheparin-binding brain mitogenheparin-binding growth factor 8heparin-binding growth-associated moleculeheparin-binding neurite outgrowth promoting factorheparin-binding neurite outgrowth-promoting factor 1
Modification date2018052720180523
UniProtAcc

P16144

P21246

Ensembl transtripts involved in fusion geneENST00000579662, ENST00000339591, 
ENST00000200181, ENST00000450894, 
ENST00000449880, ENST00000584558, 
ENST00000348225, ENST00000393083, 
Fusion gene scores* DoF score15 X 12 X 8=14406 X 2 X 5=60
# samples 166
** MAII scorelog2(16/1440*10)=-3.16992500144231
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(6/60*10)=0
Context

PubMed: ITGB4 [Title/Abstract] AND PTN [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneITGB4

GO:0009611

response to wounding

19403692

HgeneITGB4

GO:0031581

hemidesmosome assembly

12482924

TgenePTN

GO:0008284

positive regulation of cell proliferation

1733956


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLUSCTCGA-85-A50M-01AITGB4chr17

73753898

+PTNchr7

136938384

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
intron-3CDSENST00000579662ENST00000348225ITGB4chr17

73753898

+PTNchr7

136938384

-
intron-3CDSENST00000579662ENST00000393083ITGB4chr17

73753898

+PTNchr7

136938384

-
In-frameENST00000339591ENST00000348225ITGB4chr17

73753898

+PTNchr7

136938384

-
In-frameENST00000339591ENST00000393083ITGB4chr17

73753898

+PTNchr7

136938384

-
Frame-shitENST00000200181ENST00000348225ITGB4chr17

73753898

+PTNchr7

136938384

-
Frame-shitENST00000200181ENST00000393083ITGB4chr17

73753898

+PTNchr7

136938384

-
Frame-shitENST00000450894ENST00000348225ITGB4chr17

73753898

+PTNchr7

136938384

-
Frame-shitENST00000450894ENST00000393083ITGB4chr17

73753898

+PTNchr7

136938384

-
Frame-shitENST00000449880ENST00000348225ITGB4chr17

73753898

+PTNchr7

136938384

-
Frame-shitENST00000449880ENST00000393083ITGB4chr17

73753898

+PTNchr7

136938384

-
intron-3CDSENST00000584558ENST00000348225ITGB4chr17

73753898

+PTNchr7

136938384

-
intron-3CDSENST00000584558ENST00000393083ITGB4chr17

73753898

+PTNchr7

136938384

-

Top

FusionProtFeatures for ITGB4_PTN


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ITGB4

P16144

PTN

P21246

Secreted growth factor that induces neurite outgrowthand which is mitogenic for fibroblasts, epithelial, andendothelial cells (PubMed:1768439, PubMed:1733956). Bindsanaplastic lymphoma kinase (ALK) which induces MAPK pathwayactivation, an important step in the anti-apoptotic signaling ofPTN and regulation of cell proliferation (PubMed:11278720). Bindsto cell-surface target proteins via their chondroitin sulfategroups (PubMed:26896299). Down-regulates PTPRZ1 activity(PubMed:16814777). {ECO:0000269|PubMed:11278720,ECO:0000269|PubMed:16814777, ECO:0000269|PubMed:1768439,ECO:0000269|PubMed:26896299}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for ITGB4_PTN


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ITGB4_ENST00000339591_chr17_73753898_+_PTN_ENST00000348225_chr7_136938384_-_2024aa
MAGPRPSPWARLLLAALISVSLSGTLANRCKKAPVKSCTECVRVDKDCAYCTDEMFRDRRCNTQAELLAAGCQRESIVVMESSFQITEET
QIDTTLRRSQMSPQGLRVRLRPGEERHFELEVFEPLESPVDLYILMDFSNSMSDDLDNLKKMGQNLARVLSQLTSDYTIGFGKFVDKVSV
PQTDMRPEKLKEPWPNSDPPFSFKNVISLTEDVDEFRNKLQGERISGNLDAPEGGFDAILQTAVCTRDIGWRPDSTHLLVFSTESAFHYE
ADGANVLAGIMSRNDERCHLDTTGTYTQYRTQDYPSVPTLVRLLAKHNIIPIFAVTNYSYSYYEKLHTYFPVSSLGVLQEDSSNIVELLE
EAFNRIRSNLDIRALDSPRGLRTEVTSKMFQKTRTGSFHIRRGEVGIYQVQLRALEHVDGTHVCQLPEDQKGNIHLKPSFSDGLKMDAGI
ICDVCTCELQKEVRSARCSFNGDFVCGQCVCSEGWSGQTCNCSTGSLSDIQPCLREGEDKPCSGRGECQCGHCVCYGEGRYEGQFCEYDN
FQCPRTSGFLCNDRGRCSMGQCVCEPGWTGPSCDCPLSNATCIDSNGGICNGRGHCECGRCHCHQQSLYTDTICEINYSAIHPGLCEDLR
SCVQCQAWGTGEKKGRTCEECNFKVKMVDELKRAEEVVVRCSFRDEDDDCTYSYTMEGDGAPGPNSTVLVHKKKDCPPGSFWWLIPLLLL
LLPLLALLLLLCWKYCACCKACLALLPCCNRGHMVGFKEDHYMLRENLMASDHLDTPMLRSGNLKGRDVVRWKVTNNMQRPGFATHAASI
NPTELVPYGLSLRLARLCTENLLKPDTRECAQLRQEVEENLNEVYRQISGVHKLQQTKFRQQPNAGKKQDHTIVDTVLMAPRSAKPALLK
LTEKQVEQRAFHDLKVAPGYYTLTADQDARGMVEFQEGVELVDVRVPLFIRPEDDDEKQLLVEAIDVPAGTATLGRRLVNITIIKEQARD
VVSFEQPEFSVSRGDQVARIPVIRRVLDGGKSQVSYRTQDGTAQGNRDYIPVEGELLFQPGEAWKELQVKLLELQEVDSLLRGRQVRRFH
VQLSNPKFGAHLGQPHSTTIIIRDPDELDRSFTSQMLSSQPPPHGDLGAPQNPNAKAAGSRKIHFNWLPPSGKPMGYRVKYWIQGDSESE
AHLLDSKVPSVELTNLYPYCDYEMKVCAYGAQGEGPYSSLVSCRTHQEVPSEPGRLAFNVVSSTVTQLSWAEPAETNGEITAYEVCYGLV
NDDNRPIGPMKKVLVDNPKNRMLLIENLRESQPYRYTVKARNGAGWGPEREAIINLATQPKRPMSIPIIPDIPIVDAQSGEDYDSFLMYS
DDVLRSPSGSQRPSVSDDTEHLVNGRMDFAFPGSTNSLHRMTTTSAAAYGTHLSPHVPHRVLSTSSTLTRDYNSLTRSEHSHSTTLPRDY
STLTSVSSHGLPPIWEHGRSRLPLSWALGSRSRAQMKGFPPSRGPRDSIILAGRPAAPSWGPDSRLTAGVPDTPTRLVFSALGPTSLRVS
WQEPRCERPLQGYSVEYQLLNGGELHRLNIPNPAQTSVVVEDLLPNHSYVFRVRAQSQEGWGREREGVITIESQVHPQSPLCPLPGSAFT
LSTPSAPGPLVFTALSPDSLQLSWERPRRPNGDIVGYLVTCEMAQGGGPATAFRVDGDSPESRLTVPGLSENVPYKFKVQARTTEGFGPE
REGIITIESQDGGPFPQLGSRAGLFQHPLQSEYSSITTTHTSATEPFLVDGLTLGAQHLEAGGSLTRHVTQEFVSRTLTTSGTLSTHMDQ
QFFQTXPHPAPPPPRPTRRPPDSSPGASSATPSLHPWGPSPPACTEQGLGVSWEAXRGQGPSSVGPNLFVTKELGAAQGPSLCSALNKWF
CYCXKKVKKSDCGEWQWSVCVPTSGDCGLGTREGTRTGAECKQTMKTQRCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTGSLKRA

>In-frame_ITGB4_ENST00000339591_chr17_73753898_+_PTN_ENST00000393083_chr7_136938384_-_2022aa
MAGPRPSPWARLLLAALISVSLSGTLANRCKKAPVKSCTECVRVDKDCAYCTDEMFRDRRCNTQAELLAAGCQRESIVVMESSFQITEET
QIDTTLRRSQMSPQGLRVRLRPGEERHFELEVFEPLESPVDLYILMDFSNSMSDDLDNLKKMGQNLARVLSQLTSDYTIGFGKFVDKVSV
PQTDMRPEKLKEPWPNSDPPFSFKNVISLTEDVDEFRNKLQGERISGNLDAPEGGFDAILQTAVCTRDIGWRPDSTHLLVFSTESAFHYE
ADGANVLAGIMSRNDERCHLDTTGTYTQYRTQDYPSVPTLVRLLAKHNIIPIFAVTNYSYSYYEKLHTYFPVSSLGVLQEDSSNIVELLE
EAFNRIRSNLDIRALDSPRGLRTEVTSKMFQKTRTGSFHIRRGEVGIYQVQLRALEHVDGTHVCQLPEDQKGNIHLKPSFSDGLKMDAGI
ICDVCTCELQKEVRSARCSFNGDFVCGQCVCSEGWSGQTCNCSTGSLSDIQPCLREGEDKPCSGRGECQCGHCVCYGEGRYEGQFCEYDN
FQCPRTSGFLCNDRGRCSMGQCVCEPGWTGPSCDCPLSNATCIDSNGGICNGRGHCECGRCHCHQQSLYTDTICEINYSAIHPGLCEDLR
SCVQCQAWGTGEKKGRTCEECNFKVKMVDELKRAEEVVVRCSFRDEDDDCTYSYTMEGDGAPGPNSTVLVHKKKDCPPGSFWWLIPLLLL
LLPLLALLLLLCWKYCACCKACLALLPCCNRGHMVGFKEDHYMLRENLMASDHLDTPMLRSGNLKGRDVVRWKVTNNMQRPGFATHAASI
NPTELVPYGLSLRLARLCTENLLKPDTRECAQLRQEVEENLNEVYRQISGVHKLQQTKFRQQPNAGKKQDHTIVDTVLMAPRSAKPALLK
LTEKQVEQRAFHDLKVAPGYYTLTADQDARGMVEFQEGVELVDVRVPLFIRPEDDDEKQLLVEAIDVPAGTATLGRRLVNITIIKEQARD
VVSFEQPEFSVSRGDQVARIPVIRRVLDGGKSQVSYRTQDGTAQGNRDYIPVEGELLFQPGEAWKELQVKLLELQEVDSLLRGRQVRRFH
VQLSNPKFGAHLGQPHSTTIIIRDPDELDRSFTSQMLSSQPPPHGDLGAPQNPNAKAAGSRKIHFNWLPPSGKPMGYRVKYWIQGDSESE
AHLLDSKVPSVELTNLYPYCDYEMKVCAYGAQGEGPYSSLVSCRTHQEVPSEPGRLAFNVVSSTVTQLSWAEPAETNGEITAYEVCYGLV
NDDNRPIGPMKKVLVDNPKNRMLLIENLRESQPYRYTVKARNGAGWGPEREAIINLATQPKRPMSIPIIPDIPIVDAQSGEDYDSFLMYS
DDVLRSPSGSQRPSVSDDTEHLVNGRMDFAFPGSTNSLHRMTTTSAAAYGTHLSPHVPHRVLSTSSTLTRDYNSLTRSEHSHSTTLPRDY
STLTSVSSHGLPPIWEHGRSRLPLSWALGSRSRAQMKGFPPSRGPRDSIILAGRPAAPSWGPDSRLTAGVPDTPTRLVFSALGPTSLRVS
WQEPRCERPLQGYSVEYQLLNGGELHRLNIPNPAQTSVVVEDLLPNHSYVFRVRAQSQEGWGREREGVITIESQVHPQSPLCPLPGSAFT
LSTPSAPGPLVFTALSPDSLQLSWERPRRPNGDIVGYLVTCEMAQGGGPATAFRVDGDSPESRLTVPGLSENVPYKFKVQARTTEGFGPE
REGIITIESQDGGPFPQLGSRAGLFQHPLQSEYSSITTTHTSATEPFLVDGLTLGAQHLEAGGSLTRHVTQEFVSRTLTTSGTLSTHMDQ
QFFQTXPHPAPPPPRPTRRPPDSSPGASSATPSLHPWGPSPPACTEQGLGVSWEAXRGQGPSSVGPNLFVTKELGAAQGPSLCSALNKWF
CYCXKKVKKSDCGEWQWSVCVPTSGDCGLGTREGTRTGAECKQTMKTQRCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTGSLKRA


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ITGB4_ENST00000339591_chr17_73753898_+_PTN_ENST00000348225_chr7_136938384_-_6072nt
ATGGCAGGGCCACGCCCCAGCCCATGGGCCAGGCTGCTCCTGGCAGCCTTGATCAGCGTCAGCCTCTCTGGGACCTTGGCAAACCGCTGC
AAGAAGGCCCCAGTGAAGAGCTGCACGGAGTGTGTCCGTGTGGATAAGGACTGCGCCTACTGCACAGACGAGATGTTCAGGGACCGGCGC
TGCAACACCCAGGCGGAGCTGCTGGCCGCGGGCTGCCAGCGGGAGAGCATCGTGGTCATGGAGAGCAGCTTCCAAATCACAGAGGAGACC
CAGATTGACACCACCCTGCGGCGCAGCCAGATGTCCCCCCAAGGCCTGCGGGTCCGTCTGCGGCCCGGTGAGGAGCGGCATTTTGAGCTG
GAGGTGTTTGAGCCACTGGAGAGCCCCGTGGACCTGTACATCCTCATGGACTTCTCCAACTCCATGTCCGATGATCTGGACAACCTCAAG
AAGATGGGGCAGAACCTGGCTCGGGTCCTGAGCCAGCTCACCAGCGACTACACTATTGGATTTGGCAAGTTTGTGGACAAAGTCAGCGTC
CCGCAGACGGACATGAGGCCTGAGAAGCTGAAGGAGCCCTGGCCCAACAGTGACCCCCCCTTCTCCTTCAAGAACGTCATCAGCCTGACA
GAAGATGTGGATGAGTTCCGGAATAAACTGCAGGGAGAGCGGATCTCAGGCAACCTGGATGCTCCTGAGGGCGGCTTCGATGCCATCCTG
CAGACAGCTGTGTGCACGAGGGACATTGGCTGGCGCCCGGACAGCACCCACCTGCTGGTCTTCTCCACCGAGTCAGCCTTCCACTATGAG
GCTGATGGCGCCAACGTGCTGGCTGGCATCATGAGCCGCAACGATGAACGGTGCCACCTGGACACCACGGGCACCTACACCCAGTACAGG
ACACAGGACTACCCGTCGGTGCCCACCCTGGTGCGCCTGCTCGCCAAGCACAACATCATCCCCATCTTTGCTGTCACCAACTACTCCTAT
AGCTACTACGAGAAGCTTCACACCTATTTCCCTGTCTCCTCACTGGGGGTGCTGCAGGAGGACTCGTCCAACATCGTGGAGCTGCTGGAG
GAGGCCTTCAATCGGATCCGCTCCAACCTGGACATCCGGGCCCTAGACAGCCCCCGAGGCCTTCGGACAGAGGTCACCTCCAAGATGTTC
CAGAAGACGAGGACTGGGTCCTTTCACATCCGGCGGGGGGAAGTGGGTATATACCAGGTGCAGCTGCGGGCCCTTGAGCACGTGGATGGG
ACGCACGTGTGCCAGCTGCCGGAGGACCAGAAGGGCAACATCCATCTGAAACCTTCCTTCTCCGACGGCCTCAAGATGGACGCGGGCATC
ATCTGTGATGTGTGCACCTGCGAGCTGCAAAAAGAGGTGCGGTCAGCTCGCTGCAGCTTCAACGGAGACTTCGTGTGCGGACAGTGTGTG
TGCAGCGAGGGCTGGAGTGGCCAGACCTGCAACTGCTCCACCGGCTCTCTGAGTGACATTCAGCCCTGCCTGCGGGAGGGCGAGGACAAG
CCGTGCTCCGGCCGTGGGGAGTGCCAGTGCGGGCACTGTGTGTGCTACGGCGAAGGCCGCTACGAGGGTCAGTTCTGCGAGTATGACAAC
TTCCAGTGTCCCCGCACTTCCGGGTTCCTCTGCAATGACCGAGGACGCTGCTCCATGGGCCAGTGTGTGTGTGAGCCTGGTTGGACAGGC
CCAAGCTGTGACTGTCCCCTCAGCAATGCCACCTGCATCGACAGCAATGGGGGCATCTGTAATGGACGTGGCCACTGTGAGTGTGGCCGC
TGCCACTGCCACCAGCAGTCGCTCTACACGGACACCATCTGCGAGATCAACTACTCGGCGATCCACCCGGGCCTCTGCGAGGACCTACGC
TCCTGCGTGCAGTGCCAGGCGTGGGGCACCGGCGAGAAGAAGGGGCGCACGTGTGAGGAATGCAACTTCAAGGTCAAGATGGTGGACGAG
CTTAAGAGAGCCGAGGAGGTGGTGGTGCGCTGCTCCTTCCGGGACGAGGATGACGACTGCACCTACAGCTACACCATGGAAGGTGACGGC
GCCCCTGGGCCCAACAGCACTGTCCTGGTGCACAAGAAGAAGGACTGCCCTCCGGGCTCCTTCTGGTGGCTCATCCCCCTGCTCCTCCTC
CTCCTGCCGCTCCTGGCCCTGCTACTGCTGCTATGCTGGAAGTACTGTGCCTGCTGCAAGGCCTGCCTGGCACTTCTCCCGTGCTGCAAC
CGAGGTCACATGGTGGGCTTTAAGGAAGACCACTACATGCTGCGGGAGAACCTGATGGCCTCTGACCACTTGGACACGCCCATGCTGCGC
AGCGGGAACCTCAAGGGCCGTGACGTGGTCCGCTGGAAGGTCACCAACAACATGCAGCGGCCTGGCTTTGCCACTCATGCCGCCAGCATC
AACCCCACAGAGCTGGTGCCCTACGGGCTGTCCTTGCGCCTGGCCCGCCTTTGCACCGAGAACCTGCTGAAGCCTGACACTCGGGAGTGC
GCCCAGCTGCGCCAGGAGGTGGAGGAGAACCTGAACGAGGTCTACAGGCAGATCTCCGGTGTACACAAGCTCCAGCAGACCAAGTTCCGG
CAGCAGCCCAATGCCGGGAAAAAGCAAGACCACACCATTGTGGACACAGTGCTGATGGCGCCCCGCTCGGCCAAGCCGGCCCTGCTGAAG
CTTACAGAGAAGCAGGTGGAACAGAGGGCCTTCCACGACCTCAAGGTGGCCCCCGGCTACTACACCCTCACTGCAGACCAGGACGCCCGG
GGCATGGTGGAGTTCCAGGAGGGCGTGGAGCTGGTGGACGTACGGGTGCCCCTCTTTATCCGGCCTGAGGATGACGACGAGAAGCAGCTG
CTGGTGGAGGCCATCGACGTGCCCGCAGGCACTGCCACCCTCGGCCGCCGCCTGGTAAACATCACCATCATCAAGGAGCAAGCCAGAGAC
GTGGTGTCCTTTGAGCAGCCTGAGTTCTCGGTCAGCCGCGGGGACCAGGTGGCCCGCATCCCTGTCATCCGGCGTGTCCTGGACGGCGGG
AAGTCCCAGGTCTCCTACCGCACACAGGATGGCACCGCGCAGGGCAACCGGGACTACATCCCCGTGGAGGGTGAGCTGCTGTTCCAGCCT
GGGGAGGCCTGGAAAGAGCTGCAGGTGAAGCTCCTGGAGCTGCAAGAAGTTGACTCCCTCCTGCGGGGCCGCCAGGTCCGCCGTTTCCAC
GTCCAGCTCAGCAACCCTAAGTTTGGGGCCCACCTGGGCCAGCCCCACTCCACCACCATCATCATCAGGGACCCAGATGAACTGGACCGG
AGCTTCACGAGTCAGATGTTGTCATCACAGCCACCCCCTCACGGCGACCTGGGCGCCCCGCAGAACCCCAATGCTAAGGCCGCTGGGTCC
AGGAAGATCCATTTCAACTGGCTGCCCCCTTCTGGCAAGCCAATGGGGTACAGGGTAAAGTACTGGATTCAGGGTGACTCCGAATCCGAA
GCCCACCTGCTCGACAGCAAGGTGCCCTCAGTGGAGCTCACCAACCTGTACCCGTATTGCGACTATGAGATGAAGGTGTGCGCCTACGGG
GCTCAGGGCGAGGGACCCTACAGCTCCCTGGTGTCCTGCCGCACCCACCAGGAAGTGCCCAGCGAGCCAGGGCGTCTGGCCTTCAATGTC
GTCTCCTCCACGGTGACCCAGCTGAGCTGGGCTGAGCCGGCTGAGACCAACGGTGAGATCACAGCCTACGAGGTCTGCTATGGCCTGGTC
AACGATGACAACCGACCTATTGGGCCCATGAAGAAAGTGCTGGTTGACAACCCTAAGAACCGGATGCTGCTTATTGAGAACCTTCGGGAG
TCCCAGCCCTACCGCTACACGGTGAAGGCGCGCAACGGGGCCGGCTGGGGGCCTGAGCGGGAGGCCATCATCAACCTGGCCACCCAGCCC
AAGAGGCCCATGTCCATCCCCATCATCCCTGACATCCCTATCGTGGACGCCCAGAGCGGGGAGGACTACGACAGCTTCCTTATGTACAGC
GATGACGTTCTACGCTCTCCATCGGGCAGCCAGAGGCCCAGCGTCTCCGATGACACTGAGCACCTGGTGAATGGCCGGATGGACTTTGCC
TTCCCGGGCAGCACCAACTCCCTGCACAGGATGACCACGACCAGTGCTGCTGCCTATGGCACCCACCTGAGCCCACACGTGCCCCACCGC
GTGCTAAGCACATCCTCCACCCTCACACGGGACTACAACTCACTGACCCGCTCAGAACACTCACACTCGACCACACTGCCCAGGGACTAC
TCCACCCTCACCTCCGTCTCCTCCCACGGCCTCCCTCCCATCTGGGAACACGGGAGGAGCAGGCTTCCGCTGTCCTGGGCCCTGGGGTCC
CGGAGTCGGGCTCAGATGAAAGGGTTCCCCCCTTCCAGGGGCCCACGAGACTCTATAATCCTGGCTGGGAGGCCAGCAGCGCCCTCCTGG
GGCCCAGACTCTCGCCTGACTGCTGGTGTGCCCGACACGCCCACCCGCCTGGTGTTCTCTGCCCTGGGGCCCACATCTCTCAGAGTGAGC
TGGCAGGAGCCGCGGTGCGAGCGGCCGCTGCAGGGCTACAGTGTGGAGTACCAGCTGCTGAACGGCGGTGAGCTGCATCGGCTCAACATC
CCCAACCCTGCCCAGACCTCGGTGGTGGTGGAAGACCTCCTGCCCAACCACTCCTACGTGTTCCGCGTGCGGGCCCAGAGCCAGGAAGGC
TGGGGCCGAGAGCGTGAGGGTGTCATCACCATTGAATCCCAGGTGCACCCGCAGAGCCCACTGTGTCCCCTGCCAGGCTCCGCCTTCACT
TTGAGCACTCCCAGTGCCCCAGGCCCGCTGGTGTTCACTGCCCTGAGCCCAGACTCGCTGCAGCTGAGCTGGGAGCGGCCACGGAGGCCC
AATGGGGATATCGTCGGCTACCTGGTGACCTGTGAGATGGCCCAAGGAGGAGGGCCAGCCACCGCATTCCGGGTGGATGGAGACAGCCCC
GAGAGCCGGCTGACCGTGCCGGGCCTCAGCGAGAACGTGCCCTACAAGTTCAAGGTGCAGGCCAGGACCACTGAGGGCTTCGGGCCAGAG
CGCGAGGGCATCATCACCATAGAGTCCCAGGATGGAGGACCCTTCCCGCAGCTGGGCAGCCGTGCCGGGCTCTTCCAGCACCCGCTGCAA
AGCGAGTACAGCAGCATCACCACCACCCACACCAGCGCCACCGAGCCCTTCCTAGTGGATGGGCTGACCCTGGGGGCCCAGCACCTGGAG
GCAGGCGGCTCCCTCACCCGGCATGTGACCCAGGAGTTTGTGAGCCGGACACTGACCACCAGCGGAACCCTTAGCACCCACATGGACCAA
CAGTTCTTCCAAACTTGACCGCACCCTGCCCCACCCCCGCCACGTCCCACTAGGCGTCCTCCCGACTCCTCTCCCGGAGCCTCCTCAGCT
ACTCCATCCTTGCACCCCTGGGGGCCCAGCCCACCCGCATGCACAGAGCAGGGGCTAGGTGTCTCCTGGGAGGCATGAAGGGGGCAAGGT
CCGTCCTCTGTGGGCCCAAACCTATTTGTAACCAAAGAGCTGGGAGCAGCACAAGGACCCAGCCTTTGTTCTGCACTTAATAAATGGTTT
TGCTACTGCTAAAAAAAAGTGAAGAAGTCTGACTGTGGAGAATGGCAGTGGAGTGTGTGTGTGCCCACCAGTGGAGACTGTGGGCTGGGC
ACACGGGAGGGCACTCGGACTGGAGCTGAGTGCAAGCAAACCATGAAGACCCAGAGATGTAAGATCCCCTGCAACTGGAAGAAGCAATTT
GGCGCGGAGTGCAAATACCAGTTCCAGGCCTGGGGAGAATGTGACCTGAACACAGCCCTGAAGACCAGAACTGGAAGTCTGAAGCGAGCC
CTGCACAATGCCGAATGCCAGAAGACTGTCACCATCTCCAAGCCCTGTGGCAAACTGACCAAGCCCAAACCTCAAGCAGAATCTAAGAAG

>In-frame_ITGB4_ENST00000339591_chr17_73753898_+_PTN_ENST00000393083_chr7_136938384_-_6066nt
ATGGCAGGGCCACGCCCCAGCCCATGGGCCAGGCTGCTCCTGGCAGCCTTGATCAGCGTCAGCCTCTCTGGGACCTTGGCAAACCGCTGC
AAGAAGGCCCCAGTGAAGAGCTGCACGGAGTGTGTCCGTGTGGATAAGGACTGCGCCTACTGCACAGACGAGATGTTCAGGGACCGGCGC
TGCAACACCCAGGCGGAGCTGCTGGCCGCGGGCTGCCAGCGGGAGAGCATCGTGGTCATGGAGAGCAGCTTCCAAATCACAGAGGAGACC
CAGATTGACACCACCCTGCGGCGCAGCCAGATGTCCCCCCAAGGCCTGCGGGTCCGTCTGCGGCCCGGTGAGGAGCGGCATTTTGAGCTG
GAGGTGTTTGAGCCACTGGAGAGCCCCGTGGACCTGTACATCCTCATGGACTTCTCCAACTCCATGTCCGATGATCTGGACAACCTCAAG
AAGATGGGGCAGAACCTGGCTCGGGTCCTGAGCCAGCTCACCAGCGACTACACTATTGGATTTGGCAAGTTTGTGGACAAAGTCAGCGTC
CCGCAGACGGACATGAGGCCTGAGAAGCTGAAGGAGCCCTGGCCCAACAGTGACCCCCCCTTCTCCTTCAAGAACGTCATCAGCCTGACA
GAAGATGTGGATGAGTTCCGGAATAAACTGCAGGGAGAGCGGATCTCAGGCAACCTGGATGCTCCTGAGGGCGGCTTCGATGCCATCCTG
CAGACAGCTGTGTGCACGAGGGACATTGGCTGGCGCCCGGACAGCACCCACCTGCTGGTCTTCTCCACCGAGTCAGCCTTCCACTATGAG
GCTGATGGCGCCAACGTGCTGGCTGGCATCATGAGCCGCAACGATGAACGGTGCCACCTGGACACCACGGGCACCTACACCCAGTACAGG
ACACAGGACTACCCGTCGGTGCCCACCCTGGTGCGCCTGCTCGCCAAGCACAACATCATCCCCATCTTTGCTGTCACCAACTACTCCTAT
AGCTACTACGAGAAGCTTCACACCTATTTCCCTGTCTCCTCACTGGGGGTGCTGCAGGAGGACTCGTCCAACATCGTGGAGCTGCTGGAG
GAGGCCTTCAATCGGATCCGCTCCAACCTGGACATCCGGGCCCTAGACAGCCCCCGAGGCCTTCGGACAGAGGTCACCTCCAAGATGTTC
CAGAAGACGAGGACTGGGTCCTTTCACATCCGGCGGGGGGAAGTGGGTATATACCAGGTGCAGCTGCGGGCCCTTGAGCACGTGGATGGG
ACGCACGTGTGCCAGCTGCCGGAGGACCAGAAGGGCAACATCCATCTGAAACCTTCCTTCTCCGACGGCCTCAAGATGGACGCGGGCATC
ATCTGTGATGTGTGCACCTGCGAGCTGCAAAAAGAGGTGCGGTCAGCTCGCTGCAGCTTCAACGGAGACTTCGTGTGCGGACAGTGTGTG
TGCAGCGAGGGCTGGAGTGGCCAGACCTGCAACTGCTCCACCGGCTCTCTGAGTGACATTCAGCCCTGCCTGCGGGAGGGCGAGGACAAG
CCGTGCTCCGGCCGTGGGGAGTGCCAGTGCGGGCACTGTGTGTGCTACGGCGAAGGCCGCTACGAGGGTCAGTTCTGCGAGTATGACAAC
TTCCAGTGTCCCCGCACTTCCGGGTTCCTCTGCAATGACCGAGGACGCTGCTCCATGGGCCAGTGTGTGTGTGAGCCTGGTTGGACAGGC
CCAAGCTGTGACTGTCCCCTCAGCAATGCCACCTGCATCGACAGCAATGGGGGCATCTGTAATGGACGTGGCCACTGTGAGTGTGGCCGC
TGCCACTGCCACCAGCAGTCGCTCTACACGGACACCATCTGCGAGATCAACTACTCGGCGATCCACCCGGGCCTCTGCGAGGACCTACGC
TCCTGCGTGCAGTGCCAGGCGTGGGGCACCGGCGAGAAGAAGGGGCGCACGTGTGAGGAATGCAACTTCAAGGTCAAGATGGTGGACGAG
CTTAAGAGAGCCGAGGAGGTGGTGGTGCGCTGCTCCTTCCGGGACGAGGATGACGACTGCACCTACAGCTACACCATGGAAGGTGACGGC
GCCCCTGGGCCCAACAGCACTGTCCTGGTGCACAAGAAGAAGGACTGCCCTCCGGGCTCCTTCTGGTGGCTCATCCCCCTGCTCCTCCTC
CTCCTGCCGCTCCTGGCCCTGCTACTGCTGCTATGCTGGAAGTACTGTGCCTGCTGCAAGGCCTGCCTGGCACTTCTCCCGTGCTGCAAC
CGAGGTCACATGGTGGGCTTTAAGGAAGACCACTACATGCTGCGGGAGAACCTGATGGCCTCTGACCACTTGGACACGCCCATGCTGCGC
AGCGGGAACCTCAAGGGCCGTGACGTGGTCCGCTGGAAGGTCACCAACAACATGCAGCGGCCTGGCTTTGCCACTCATGCCGCCAGCATC
AACCCCACAGAGCTGGTGCCCTACGGGCTGTCCTTGCGCCTGGCCCGCCTTTGCACCGAGAACCTGCTGAAGCCTGACACTCGGGAGTGC
GCCCAGCTGCGCCAGGAGGTGGAGGAGAACCTGAACGAGGTCTACAGGCAGATCTCCGGTGTACACAAGCTCCAGCAGACCAAGTTCCGG
CAGCAGCCCAATGCCGGGAAAAAGCAAGACCACACCATTGTGGACACAGTGCTGATGGCGCCCCGCTCGGCCAAGCCGGCCCTGCTGAAG
CTTACAGAGAAGCAGGTGGAACAGAGGGCCTTCCACGACCTCAAGGTGGCCCCCGGCTACTACACCCTCACTGCAGACCAGGACGCCCGG
GGCATGGTGGAGTTCCAGGAGGGCGTGGAGCTGGTGGACGTACGGGTGCCCCTCTTTATCCGGCCTGAGGATGACGACGAGAAGCAGCTG
CTGGTGGAGGCCATCGACGTGCCCGCAGGCACTGCCACCCTCGGCCGCCGCCTGGTAAACATCACCATCATCAAGGAGCAAGCCAGAGAC
GTGGTGTCCTTTGAGCAGCCTGAGTTCTCGGTCAGCCGCGGGGACCAGGTGGCCCGCATCCCTGTCATCCGGCGTGTCCTGGACGGCGGG
AAGTCCCAGGTCTCCTACCGCACACAGGATGGCACCGCGCAGGGCAACCGGGACTACATCCCCGTGGAGGGTGAGCTGCTGTTCCAGCCT
GGGGAGGCCTGGAAAGAGCTGCAGGTGAAGCTCCTGGAGCTGCAAGAAGTTGACTCCCTCCTGCGGGGCCGCCAGGTCCGCCGTTTCCAC
GTCCAGCTCAGCAACCCTAAGTTTGGGGCCCACCTGGGCCAGCCCCACTCCACCACCATCATCATCAGGGACCCAGATGAACTGGACCGG
AGCTTCACGAGTCAGATGTTGTCATCACAGCCACCCCCTCACGGCGACCTGGGCGCCCCGCAGAACCCCAATGCTAAGGCCGCTGGGTCC
AGGAAGATCCATTTCAACTGGCTGCCCCCTTCTGGCAAGCCAATGGGGTACAGGGTAAAGTACTGGATTCAGGGTGACTCCGAATCCGAA
GCCCACCTGCTCGACAGCAAGGTGCCCTCAGTGGAGCTCACCAACCTGTACCCGTATTGCGACTATGAGATGAAGGTGTGCGCCTACGGG
GCTCAGGGCGAGGGACCCTACAGCTCCCTGGTGTCCTGCCGCACCCACCAGGAAGTGCCCAGCGAGCCAGGGCGTCTGGCCTTCAATGTC
GTCTCCTCCACGGTGACCCAGCTGAGCTGGGCTGAGCCGGCTGAGACCAACGGTGAGATCACAGCCTACGAGGTCTGCTATGGCCTGGTC
AACGATGACAACCGACCTATTGGGCCCATGAAGAAAGTGCTGGTTGACAACCCTAAGAACCGGATGCTGCTTATTGAGAACCTTCGGGAG
TCCCAGCCCTACCGCTACACGGTGAAGGCGCGCAACGGGGCCGGCTGGGGGCCTGAGCGGGAGGCCATCATCAACCTGGCCACCCAGCCC
AAGAGGCCCATGTCCATCCCCATCATCCCTGACATCCCTATCGTGGACGCCCAGAGCGGGGAGGACTACGACAGCTTCCTTATGTACAGC
GATGACGTTCTACGCTCTCCATCGGGCAGCCAGAGGCCCAGCGTCTCCGATGACACTGAGCACCTGGTGAATGGCCGGATGGACTTTGCC
TTCCCGGGCAGCACCAACTCCCTGCACAGGATGACCACGACCAGTGCTGCTGCCTATGGCACCCACCTGAGCCCACACGTGCCCCACCGC
GTGCTAAGCACATCCTCCACCCTCACACGGGACTACAACTCACTGACCCGCTCAGAACACTCACACTCGACCACACTGCCCAGGGACTAC
TCCACCCTCACCTCCGTCTCCTCCCACGGCCTCCCTCCCATCTGGGAACACGGGAGGAGCAGGCTTCCGCTGTCCTGGGCCCTGGGGTCC
CGGAGTCGGGCTCAGATGAAAGGGTTCCCCCCTTCCAGGGGCCCACGAGACTCTATAATCCTGGCTGGGAGGCCAGCAGCGCCCTCCTGG
GGCCCAGACTCTCGCCTGACTGCTGGTGTGCCCGACACGCCCACCCGCCTGGTGTTCTCTGCCCTGGGGCCCACATCTCTCAGAGTGAGC
TGGCAGGAGCCGCGGTGCGAGCGGCCGCTGCAGGGCTACAGTGTGGAGTACCAGCTGCTGAACGGCGGTGAGCTGCATCGGCTCAACATC
CCCAACCCTGCCCAGACCTCGGTGGTGGTGGAAGACCTCCTGCCCAACCACTCCTACGTGTTCCGCGTGCGGGCCCAGAGCCAGGAAGGC
TGGGGCCGAGAGCGTGAGGGTGTCATCACCATTGAATCCCAGGTGCACCCGCAGAGCCCACTGTGTCCCCTGCCAGGCTCCGCCTTCACT
TTGAGCACTCCCAGTGCCCCAGGCCCGCTGGTGTTCACTGCCCTGAGCCCAGACTCGCTGCAGCTGAGCTGGGAGCGGCCACGGAGGCCC
AATGGGGATATCGTCGGCTACCTGGTGACCTGTGAGATGGCCCAAGGAGGAGGGCCAGCCACCGCATTCCGGGTGGATGGAGACAGCCCC
GAGAGCCGGCTGACCGTGCCGGGCCTCAGCGAGAACGTGCCCTACAAGTTCAAGGTGCAGGCCAGGACCACTGAGGGCTTCGGGCCAGAG
CGCGAGGGCATCATCACCATAGAGTCCCAGGATGGAGGACCCTTCCCGCAGCTGGGCAGCCGTGCCGGGCTCTTCCAGCACCCGCTGCAA
AGCGAGTACAGCAGCATCACCACCACCCACACCAGCGCCACCGAGCCCTTCCTAGTGGATGGGCTGACCCTGGGGGCCCAGCACCTGGAG
GCAGGCGGCTCCCTCACCCGGCATGTGACCCAGGAGTTTGTGAGCCGGACACTGACCACCAGCGGAACCCTTAGCACCCACATGGACCAA
CAGTTCTTCCAAACTTGACCGCACCCTGCCCCACCCCCGCCACGTCCCACTAGGCGTCCTCCCGACTCCTCTCCCGGAGCCTCCTCAGCT
ACTCCATCCTTGCACCCCTGGGGGCCCAGCCCACCCGCATGCACAGAGCAGGGGCTAGGTGTCTCCTGGGAGGCATGAAGGGGGCAAGGT
CCGTCCTCTGTGGGCCCAAACCTATTTGTAACCAAAGAGCTGGGAGCAGCACAAGGACCCAGCCTTTGTTCTGCACTTAATAAATGGTTT
TGCTACTGCTAAAAAAAAGTGAAGAAGTCTGACTGTGGAGAATGGCAGTGGAGTGTGTGTGTGCCCACCAGTGGAGACTGTGGGCTGGGC
ACACGGGAGGGCACTCGGACTGGAGCTGAGTGCAAGCAAACCATGAAGACCCAGAGATGTAAGATCCCCTGCAACTGGAAGAAGCAATTT
GGCGCGGAGTGCAAATACCAGTTCCAGGCCTGGGGAGAATGTGACCTGAACACAGCCCTGAAGACCAGAACTGGAAGTCTGAAGCGAGCC
CTGCACAATGCCGAATGCCAGAAGACTGTCACCATCTCCAAGCCCTGTGGCAAACTGACCAAGCCCAAACCTCAAGAGAAGGGAAAATGG


* Fusion transcript sequences (Full-length transcript).
>In-frame_ITGB4_ENST00000339591_chr17_73753898_+_PTN_ENST00000348225_chr7_136938384_-_6938nt
GCGCTGCCCGCCTCGTCCCCACCCCCCCAACCCCCGCGCCCGCCCTCGGACAGTCCCTGCTCGCCCGCGCGCTGCAGCCCCATCTCCTAG
CGGCAGCCCAGGCGCGGAGGGAGCGAGTCCGCCCCGAGGTAGGTCCAGGACGGGCGCACAGCAGCAGCCGAGGCTGGCCGGGAGAGGGAG
GAAGAGGATGGCAGGGCCACGCCCCAGCCCATGGGCCAGGCTGCTCCTGGCAGCCTTGATCAGCGTCAGCCTCTCTGGGACCTTGGCAAA
CCGCTGCAAGAAGGCCCCAGTGAAGAGCTGCACGGAGTGTGTCCGTGTGGATAAGGACTGCGCCTACTGCACAGACGAGATGTTCAGGGA
CCGGCGCTGCAACACCCAGGCGGAGCTGCTGGCCGCGGGCTGCCAGCGGGAGAGCATCGTGGTCATGGAGAGCAGCTTCCAAATCACAGA
GGAGACCCAGATTGACACCACCCTGCGGCGCAGCCAGATGTCCCCCCAAGGCCTGCGGGTCCGTCTGCGGCCCGGTGAGGAGCGGCATTT
TGAGCTGGAGGTGTTTGAGCCACTGGAGAGCCCCGTGGACCTGTACATCCTCATGGACTTCTCCAACTCCATGTCCGATGATCTGGACAA
CCTCAAGAAGATGGGGCAGAACCTGGCTCGGGTCCTGAGCCAGCTCACCAGCGACTACACTATTGGATTTGGCAAGTTTGTGGACAAAGT
CAGCGTCCCGCAGACGGACATGAGGCCTGAGAAGCTGAAGGAGCCCTGGCCCAACAGTGACCCCCCCTTCTCCTTCAAGAACGTCATCAG
CCTGACAGAAGATGTGGATGAGTTCCGGAATAAACTGCAGGGAGAGCGGATCTCAGGCAACCTGGATGCTCCTGAGGGCGGCTTCGATGC
CATCCTGCAGACAGCTGTGTGCACGAGGGACATTGGCTGGCGCCCGGACAGCACCCACCTGCTGGTCTTCTCCACCGAGTCAGCCTTCCA
CTATGAGGCTGATGGCGCCAACGTGCTGGCTGGCATCATGAGCCGCAACGATGAACGGTGCCACCTGGACACCACGGGCACCTACACCCA
GTACAGGACACAGGACTACCCGTCGGTGCCCACCCTGGTGCGCCTGCTCGCCAAGCACAACATCATCCCCATCTTTGCTGTCACCAACTA
CTCCTATAGCTACTACGAGAAGCTTCACACCTATTTCCCTGTCTCCTCACTGGGGGTGCTGCAGGAGGACTCGTCCAACATCGTGGAGCT
GCTGGAGGAGGCCTTCAATCGGATCCGCTCCAACCTGGACATCCGGGCCCTAGACAGCCCCCGAGGCCTTCGGACAGAGGTCACCTCCAA
GATGTTCCAGAAGACGAGGACTGGGTCCTTTCACATCCGGCGGGGGGAAGTGGGTATATACCAGGTGCAGCTGCGGGCCCTTGAGCACGT
GGATGGGACGCACGTGTGCCAGCTGCCGGAGGACCAGAAGGGCAACATCCATCTGAAACCTTCCTTCTCCGACGGCCTCAAGATGGACGC
GGGCATCATCTGTGATGTGTGCACCTGCGAGCTGCAAAAAGAGGTGCGGTCAGCTCGCTGCAGCTTCAACGGAGACTTCGTGTGCGGACA
GTGTGTGTGCAGCGAGGGCTGGAGTGGCCAGACCTGCAACTGCTCCACCGGCTCTCTGAGTGACATTCAGCCCTGCCTGCGGGAGGGCGA
GGACAAGCCGTGCTCCGGCCGTGGGGAGTGCCAGTGCGGGCACTGTGTGTGCTACGGCGAAGGCCGCTACGAGGGTCAGTTCTGCGAGTA
TGACAACTTCCAGTGTCCCCGCACTTCCGGGTTCCTCTGCAATGACCGAGGACGCTGCTCCATGGGCCAGTGTGTGTGTGAGCCTGGTTG
GACAGGCCCAAGCTGTGACTGTCCCCTCAGCAATGCCACCTGCATCGACAGCAATGGGGGCATCTGTAATGGACGTGGCCACTGTGAGTG
TGGCCGCTGCCACTGCCACCAGCAGTCGCTCTACACGGACACCATCTGCGAGATCAACTACTCGGCGATCCACCCGGGCCTCTGCGAGGA
CCTACGCTCCTGCGTGCAGTGCCAGGCGTGGGGCACCGGCGAGAAGAAGGGGCGCACGTGTGAGGAATGCAACTTCAAGGTCAAGATGGT
GGACGAGCTTAAGAGAGCCGAGGAGGTGGTGGTGCGCTGCTCCTTCCGGGACGAGGATGACGACTGCACCTACAGCTACACCATGGAAGG
TGACGGCGCCCCTGGGCCCAACAGCACTGTCCTGGTGCACAAGAAGAAGGACTGCCCTCCGGGCTCCTTCTGGTGGCTCATCCCCCTGCT
CCTCCTCCTCCTGCCGCTCCTGGCCCTGCTACTGCTGCTATGCTGGAAGTACTGTGCCTGCTGCAAGGCCTGCCTGGCACTTCTCCCGTG
CTGCAACCGAGGTCACATGGTGGGCTTTAAGGAAGACCACTACATGCTGCGGGAGAACCTGATGGCCTCTGACCACTTGGACACGCCCAT
GCTGCGCAGCGGGAACCTCAAGGGCCGTGACGTGGTCCGCTGGAAGGTCACCAACAACATGCAGCGGCCTGGCTTTGCCACTCATGCCGC
CAGCATCAACCCCACAGAGCTGGTGCCCTACGGGCTGTCCTTGCGCCTGGCCCGCCTTTGCACCGAGAACCTGCTGAAGCCTGACACTCG
GGAGTGCGCCCAGCTGCGCCAGGAGGTGGAGGAGAACCTGAACGAGGTCTACAGGCAGATCTCCGGTGTACACAAGCTCCAGCAGACCAA
GTTCCGGCAGCAGCCCAATGCCGGGAAAAAGCAAGACCACACCATTGTGGACACAGTGCTGATGGCGCCCCGCTCGGCCAAGCCGGCCCT
GCTGAAGCTTACAGAGAAGCAGGTGGAACAGAGGGCCTTCCACGACCTCAAGGTGGCCCCCGGCTACTACACCCTCACTGCAGACCAGGA
CGCCCGGGGCATGGTGGAGTTCCAGGAGGGCGTGGAGCTGGTGGACGTACGGGTGCCCCTCTTTATCCGGCCTGAGGATGACGACGAGAA
GCAGCTGCTGGTGGAGGCCATCGACGTGCCCGCAGGCACTGCCACCCTCGGCCGCCGCCTGGTAAACATCACCATCATCAAGGAGCAAGC
CAGAGACGTGGTGTCCTTTGAGCAGCCTGAGTTCTCGGTCAGCCGCGGGGACCAGGTGGCCCGCATCCCTGTCATCCGGCGTGTCCTGGA
CGGCGGGAAGTCCCAGGTCTCCTACCGCACACAGGATGGCACCGCGCAGGGCAACCGGGACTACATCCCCGTGGAGGGTGAGCTGCTGTT
CCAGCCTGGGGAGGCCTGGAAAGAGCTGCAGGTGAAGCTCCTGGAGCTGCAAGAAGTTGACTCCCTCCTGCGGGGCCGCCAGGTCCGCCG
TTTCCACGTCCAGCTCAGCAACCCTAAGTTTGGGGCCCACCTGGGCCAGCCCCACTCCACCACCATCATCATCAGGGACCCAGATGAACT
GGACCGGAGCTTCACGAGTCAGATGTTGTCATCACAGCCACCCCCTCACGGCGACCTGGGCGCCCCGCAGAACCCCAATGCTAAGGCCGC
TGGGTCCAGGAAGATCCATTTCAACTGGCTGCCCCCTTCTGGCAAGCCAATGGGGTACAGGGTAAAGTACTGGATTCAGGGTGACTCCGA
ATCCGAAGCCCACCTGCTCGACAGCAAGGTGCCCTCAGTGGAGCTCACCAACCTGTACCCGTATTGCGACTATGAGATGAAGGTGTGCGC
CTACGGGGCTCAGGGCGAGGGACCCTACAGCTCCCTGGTGTCCTGCCGCACCCACCAGGAAGTGCCCAGCGAGCCAGGGCGTCTGGCCTT
CAATGTCGTCTCCTCCACGGTGACCCAGCTGAGCTGGGCTGAGCCGGCTGAGACCAACGGTGAGATCACAGCCTACGAGGTCTGCTATGG
CCTGGTCAACGATGACAACCGACCTATTGGGCCCATGAAGAAAGTGCTGGTTGACAACCCTAAGAACCGGATGCTGCTTATTGAGAACCT
TCGGGAGTCCCAGCCCTACCGCTACACGGTGAAGGCGCGCAACGGGGCCGGCTGGGGGCCTGAGCGGGAGGCCATCATCAACCTGGCCAC
CCAGCCCAAGAGGCCCATGTCCATCCCCATCATCCCTGACATCCCTATCGTGGACGCCCAGAGCGGGGAGGACTACGACAGCTTCCTTAT
GTACAGCGATGACGTTCTACGCTCTCCATCGGGCAGCCAGAGGCCCAGCGTCTCCGATGACACTGAGCACCTGGTGAATGGCCGGATGGA
CTTTGCCTTCCCGGGCAGCACCAACTCCCTGCACAGGATGACCACGACCAGTGCTGCTGCCTATGGCACCCACCTGAGCCCACACGTGCC
CCACCGCGTGCTAAGCACATCCTCCACCCTCACACGGGACTACAACTCACTGACCCGCTCAGAACACTCACACTCGACCACACTGCCCAG
GGACTACTCCACCCTCACCTCCGTCTCCTCCCACGGCCTCCCTCCCATCTGGGAACACGGGAGGAGCAGGCTTCCGCTGTCCTGGGCCCT
GGGGTCCCGGAGTCGGGCTCAGATGAAAGGGTTCCCCCCTTCCAGGGGCCCACGAGACTCTATAATCCTGGCTGGGAGGCCAGCAGCGCC
CTCCTGGGGCCCAGACTCTCGCCTGACTGCTGGTGTGCCCGACACGCCCACCCGCCTGGTGTTCTCTGCCCTGGGGCCCACATCTCTCAG
AGTGAGCTGGCAGGAGCCGCGGTGCGAGCGGCCGCTGCAGGGCTACAGTGTGGAGTACCAGCTGCTGAACGGCGGTGAGCTGCATCGGCT
CAACATCCCCAACCCTGCCCAGACCTCGGTGGTGGTGGAAGACCTCCTGCCCAACCACTCCTACGTGTTCCGCGTGCGGGCCCAGAGCCA
GGAAGGCTGGGGCCGAGAGCGTGAGGGTGTCATCACCATTGAATCCCAGGTGCACCCGCAGAGCCCACTGTGTCCCCTGCCAGGCTCCGC
CTTCACTTTGAGCACTCCCAGTGCCCCAGGCCCGCTGGTGTTCACTGCCCTGAGCCCAGACTCGCTGCAGCTGAGCTGGGAGCGGCCACG
GAGGCCCAATGGGGATATCGTCGGCTACCTGGTGACCTGTGAGATGGCCCAAGGAGGAGGGCCAGCCACCGCATTCCGGGTGGATGGAGA
CAGCCCCGAGAGCCGGCTGACCGTGCCGGGCCTCAGCGAGAACGTGCCCTACAAGTTCAAGGTGCAGGCCAGGACCACTGAGGGCTTCGG
GCCAGAGCGCGAGGGCATCATCACCATAGAGTCCCAGGATGGAGGACCCTTCCCGCAGCTGGGCAGCCGTGCCGGGCTCTTCCAGCACCC
GCTGCAAAGCGAGTACAGCAGCATCACCACCACCCACACCAGCGCCACCGAGCCCTTCCTAGTGGATGGGCTGACCCTGGGGGCCCAGCA
CCTGGAGGCAGGCGGCTCCCTCACCCGGCATGTGACCCAGGAGTTTGTGAGCCGGACACTGACCACCAGCGGAACCCTTAGCACCCACAT
GGACCAACAGTTCTTCCAAACTTGACCGCACCCTGCCCCACCCCCGCCACGTCCCACTAGGCGTCCTCCCGACTCCTCTCCCGGAGCCTC
CTCAGCTACTCCATCCTTGCACCCCTGGGGGCCCAGCCCACCCGCATGCACAGAGCAGGGGCTAGGTGTCTCCTGGGAGGCATGAAGGGG
GCAAGGTCCGTCCTCTGTGGGCCCAAACCTATTTGTAACCAAAGAGCTGGGAGCAGCACAAGGACCCAGCCTTTGTTCTGCACTTAATAA
ATGGTTTTGCTACTGCTAAAAAAAAGTGAAGAAGTCTGACTGTGGAGAATGGCAGTGGAGTGTGTGTGTGCCCACCAGTGGAGACTGTGG
GCTGGGCACACGGGAGGGCACTCGGACTGGAGCTGAGTGCAAGCAAACCATGAAGACCCAGAGATGTAAGATCCCCTGCAACTGGAAGAA
GCAATTTGGCGCGGAGTGCAAATACCAGTTCCAGGCCTGGGGAGAATGTGACCTGAACACAGCCCTGAAGACCAGAACTGGAAGTCTGAA
GCGAGCCCTGCACAATGCCGAATGCCAGAAGACTGTCACCATCTCCAAGCCCTGTGGCAAACTGACCAAGCCCAAACCTCAAGCAGAATC
TAAGAAGAAGAAAAAGGAAGGCAAGAAACAGGAGAAGATGCTGGATTAAAAGATGTCACCTGTGGAACATAAAAAGGACATCAGCAAACA
GGATCAGTTAACTATTGCATTTATATGTACCGTAGGCTTTGTATTCAAAAATTATCTATAGCTAAGTACACAATAAGCAAAAACAAAAAG
AAAAGAAAATTTTTGTAGTAGCGTTTTTTAAATGTATACTATAGTACCAGTAGGGGCTTATAATAAAGGACTGTAATCTTATTTAGGAAG
TTGACTTATAGTACATGATAAATGATAGACAATTGAGGTAAGTTTTTTGAAATTATGTGACATTTTACATTAAATTTTTTTTACATTTTT
TGGGCAGCAATTTAAATGTTATGACTATGTAAACTACTTCTCTTGTTAGGTAATTTTTTTCACCTAGATTTTTTTCCCAATTGAGAAAAA
TATATACTAAACAAAATAGCAATAAAACATAATCACTCTATTTGAAGAAAATATCTTGTTTTCTGCCAATAGATTTTTTAAAATGTAGTC
AGCAAAATGGGGGTGGGGAAGCAGAGCATGTCCTAGTTCAATGTTGACTTTTTTTTTTTTTAAAGAAAAGCATTAAGACATAAAATTCTT
TCACTTTGGCAGAAGCATTTGTTTTCTTGATGAAATTATTTTTCCATCTGAGGAAAAAAATACTAGGAAAATAAATCAAGGTGATGCTGA

>In-frame_ITGB4_ENST00000339591_chr17_73753898_+_PTN_ENST00000393083_chr7_136938384_-_7014nt
GCGCTGCCCGCCTCGTCCCCACCCCCCCAACCCCCGCGCCCGCCCTCGGACAGTCCCTGCTCGCCCGCGCGCTGCAGCCCCATCTCCTAG
CGGCAGCCCAGGCGCGGAGGGAGCGAGTCCGCCCCGAGGTAGGTCCAGGACGGGCGCACAGCAGCAGCCGAGGCTGGCCGGGAGAGGGAG
GAAGAGGATGGCAGGGCCACGCCCCAGCCCATGGGCCAGGCTGCTCCTGGCAGCCTTGATCAGCGTCAGCCTCTCTGGGACCTTGGCAAA
CCGCTGCAAGAAGGCCCCAGTGAAGAGCTGCACGGAGTGTGTCCGTGTGGATAAGGACTGCGCCTACTGCACAGACGAGATGTTCAGGGA
CCGGCGCTGCAACACCCAGGCGGAGCTGCTGGCCGCGGGCTGCCAGCGGGAGAGCATCGTGGTCATGGAGAGCAGCTTCCAAATCACAGA
GGAGACCCAGATTGACACCACCCTGCGGCGCAGCCAGATGTCCCCCCAAGGCCTGCGGGTCCGTCTGCGGCCCGGTGAGGAGCGGCATTT
TGAGCTGGAGGTGTTTGAGCCACTGGAGAGCCCCGTGGACCTGTACATCCTCATGGACTTCTCCAACTCCATGTCCGATGATCTGGACAA
CCTCAAGAAGATGGGGCAGAACCTGGCTCGGGTCCTGAGCCAGCTCACCAGCGACTACACTATTGGATTTGGCAAGTTTGTGGACAAAGT
CAGCGTCCCGCAGACGGACATGAGGCCTGAGAAGCTGAAGGAGCCCTGGCCCAACAGTGACCCCCCCTTCTCCTTCAAGAACGTCATCAG
CCTGACAGAAGATGTGGATGAGTTCCGGAATAAACTGCAGGGAGAGCGGATCTCAGGCAACCTGGATGCTCCTGAGGGCGGCTTCGATGC
CATCCTGCAGACAGCTGTGTGCACGAGGGACATTGGCTGGCGCCCGGACAGCACCCACCTGCTGGTCTTCTCCACCGAGTCAGCCTTCCA
CTATGAGGCTGATGGCGCCAACGTGCTGGCTGGCATCATGAGCCGCAACGATGAACGGTGCCACCTGGACACCACGGGCACCTACACCCA
GTACAGGACACAGGACTACCCGTCGGTGCCCACCCTGGTGCGCCTGCTCGCCAAGCACAACATCATCCCCATCTTTGCTGTCACCAACTA
CTCCTATAGCTACTACGAGAAGCTTCACACCTATTTCCCTGTCTCCTCACTGGGGGTGCTGCAGGAGGACTCGTCCAACATCGTGGAGCT
GCTGGAGGAGGCCTTCAATCGGATCCGCTCCAACCTGGACATCCGGGCCCTAGACAGCCCCCGAGGCCTTCGGACAGAGGTCACCTCCAA
GATGTTCCAGAAGACGAGGACTGGGTCCTTTCACATCCGGCGGGGGGAAGTGGGTATATACCAGGTGCAGCTGCGGGCCCTTGAGCACGT
GGATGGGACGCACGTGTGCCAGCTGCCGGAGGACCAGAAGGGCAACATCCATCTGAAACCTTCCTTCTCCGACGGCCTCAAGATGGACGC
GGGCATCATCTGTGATGTGTGCACCTGCGAGCTGCAAAAAGAGGTGCGGTCAGCTCGCTGCAGCTTCAACGGAGACTTCGTGTGCGGACA
GTGTGTGTGCAGCGAGGGCTGGAGTGGCCAGACCTGCAACTGCTCCACCGGCTCTCTGAGTGACATTCAGCCCTGCCTGCGGGAGGGCGA
GGACAAGCCGTGCTCCGGCCGTGGGGAGTGCCAGTGCGGGCACTGTGTGTGCTACGGCGAAGGCCGCTACGAGGGTCAGTTCTGCGAGTA
TGACAACTTCCAGTGTCCCCGCACTTCCGGGTTCCTCTGCAATGACCGAGGACGCTGCTCCATGGGCCAGTGTGTGTGTGAGCCTGGTTG
GACAGGCCCAAGCTGTGACTGTCCCCTCAGCAATGCCACCTGCATCGACAGCAATGGGGGCATCTGTAATGGACGTGGCCACTGTGAGTG
TGGCCGCTGCCACTGCCACCAGCAGTCGCTCTACACGGACACCATCTGCGAGATCAACTACTCGGCGATCCACCCGGGCCTCTGCGAGGA
CCTACGCTCCTGCGTGCAGTGCCAGGCGTGGGGCACCGGCGAGAAGAAGGGGCGCACGTGTGAGGAATGCAACTTCAAGGTCAAGATGGT
GGACGAGCTTAAGAGAGCCGAGGAGGTGGTGGTGCGCTGCTCCTTCCGGGACGAGGATGACGACTGCACCTACAGCTACACCATGGAAGG
TGACGGCGCCCCTGGGCCCAACAGCACTGTCCTGGTGCACAAGAAGAAGGACTGCCCTCCGGGCTCCTTCTGGTGGCTCATCCCCCTGCT
CCTCCTCCTCCTGCCGCTCCTGGCCCTGCTACTGCTGCTATGCTGGAAGTACTGTGCCTGCTGCAAGGCCTGCCTGGCACTTCTCCCGTG
CTGCAACCGAGGTCACATGGTGGGCTTTAAGGAAGACCACTACATGCTGCGGGAGAACCTGATGGCCTCTGACCACTTGGACACGCCCAT
GCTGCGCAGCGGGAACCTCAAGGGCCGTGACGTGGTCCGCTGGAAGGTCACCAACAACATGCAGCGGCCTGGCTTTGCCACTCATGCCGC
CAGCATCAACCCCACAGAGCTGGTGCCCTACGGGCTGTCCTTGCGCCTGGCCCGCCTTTGCACCGAGAACCTGCTGAAGCCTGACACTCG
GGAGTGCGCCCAGCTGCGCCAGGAGGTGGAGGAGAACCTGAACGAGGTCTACAGGCAGATCTCCGGTGTACACAAGCTCCAGCAGACCAA
GTTCCGGCAGCAGCCCAATGCCGGGAAAAAGCAAGACCACACCATTGTGGACACAGTGCTGATGGCGCCCCGCTCGGCCAAGCCGGCCCT
GCTGAAGCTTACAGAGAAGCAGGTGGAACAGAGGGCCTTCCACGACCTCAAGGTGGCCCCCGGCTACTACACCCTCACTGCAGACCAGGA
CGCCCGGGGCATGGTGGAGTTCCAGGAGGGCGTGGAGCTGGTGGACGTACGGGTGCCCCTCTTTATCCGGCCTGAGGATGACGACGAGAA
GCAGCTGCTGGTGGAGGCCATCGACGTGCCCGCAGGCACTGCCACCCTCGGCCGCCGCCTGGTAAACATCACCATCATCAAGGAGCAAGC
CAGAGACGTGGTGTCCTTTGAGCAGCCTGAGTTCTCGGTCAGCCGCGGGGACCAGGTGGCCCGCATCCCTGTCATCCGGCGTGTCCTGGA
CGGCGGGAAGTCCCAGGTCTCCTACCGCACACAGGATGGCACCGCGCAGGGCAACCGGGACTACATCCCCGTGGAGGGTGAGCTGCTGTT
CCAGCCTGGGGAGGCCTGGAAAGAGCTGCAGGTGAAGCTCCTGGAGCTGCAAGAAGTTGACTCCCTCCTGCGGGGCCGCCAGGTCCGCCG
TTTCCACGTCCAGCTCAGCAACCCTAAGTTTGGGGCCCACCTGGGCCAGCCCCACTCCACCACCATCATCATCAGGGACCCAGATGAACT
GGACCGGAGCTTCACGAGTCAGATGTTGTCATCACAGCCACCCCCTCACGGCGACCTGGGCGCCCCGCAGAACCCCAATGCTAAGGCCGC
TGGGTCCAGGAAGATCCATTTCAACTGGCTGCCCCCTTCTGGCAAGCCAATGGGGTACAGGGTAAAGTACTGGATTCAGGGTGACTCCGA
ATCCGAAGCCCACCTGCTCGACAGCAAGGTGCCCTCAGTGGAGCTCACCAACCTGTACCCGTATTGCGACTATGAGATGAAGGTGTGCGC
CTACGGGGCTCAGGGCGAGGGACCCTACAGCTCCCTGGTGTCCTGCCGCACCCACCAGGAAGTGCCCAGCGAGCCAGGGCGTCTGGCCTT
CAATGTCGTCTCCTCCACGGTGACCCAGCTGAGCTGGGCTGAGCCGGCTGAGACCAACGGTGAGATCACAGCCTACGAGGTCTGCTATGG
CCTGGTCAACGATGACAACCGACCTATTGGGCCCATGAAGAAAGTGCTGGTTGACAACCCTAAGAACCGGATGCTGCTTATTGAGAACCT
TCGGGAGTCCCAGCCCTACCGCTACACGGTGAAGGCGCGCAACGGGGCCGGCTGGGGGCCTGAGCGGGAGGCCATCATCAACCTGGCCAC
CCAGCCCAAGAGGCCCATGTCCATCCCCATCATCCCTGACATCCCTATCGTGGACGCCCAGAGCGGGGAGGACTACGACAGCTTCCTTAT
GTACAGCGATGACGTTCTACGCTCTCCATCGGGCAGCCAGAGGCCCAGCGTCTCCGATGACACTGAGCACCTGGTGAATGGCCGGATGGA
CTTTGCCTTCCCGGGCAGCACCAACTCCCTGCACAGGATGACCACGACCAGTGCTGCTGCCTATGGCACCCACCTGAGCCCACACGTGCC
CCACCGCGTGCTAAGCACATCCTCCACCCTCACACGGGACTACAACTCACTGACCCGCTCAGAACACTCACACTCGACCACACTGCCCAG
GGACTACTCCACCCTCACCTCCGTCTCCTCCCACGGCCTCCCTCCCATCTGGGAACACGGGAGGAGCAGGCTTCCGCTGTCCTGGGCCCT
GGGGTCCCGGAGTCGGGCTCAGATGAAAGGGTTCCCCCCTTCCAGGGGCCCACGAGACTCTATAATCCTGGCTGGGAGGCCAGCAGCGCC
CTCCTGGGGCCCAGACTCTCGCCTGACTGCTGGTGTGCCCGACACGCCCACCCGCCTGGTGTTCTCTGCCCTGGGGCCCACATCTCTCAG
AGTGAGCTGGCAGGAGCCGCGGTGCGAGCGGCCGCTGCAGGGCTACAGTGTGGAGTACCAGCTGCTGAACGGCGGTGAGCTGCATCGGCT
CAACATCCCCAACCCTGCCCAGACCTCGGTGGTGGTGGAAGACCTCCTGCCCAACCACTCCTACGTGTTCCGCGTGCGGGCCCAGAGCCA
GGAAGGCTGGGGCCGAGAGCGTGAGGGTGTCATCACCATTGAATCCCAGGTGCACCCGCAGAGCCCACTGTGTCCCCTGCCAGGCTCCGC
CTTCACTTTGAGCACTCCCAGTGCCCCAGGCCCGCTGGTGTTCACTGCCCTGAGCCCAGACTCGCTGCAGCTGAGCTGGGAGCGGCCACG
GAGGCCCAATGGGGATATCGTCGGCTACCTGGTGACCTGTGAGATGGCCCAAGGAGGAGGGCCAGCCACCGCATTCCGGGTGGATGGAGA
CAGCCCCGAGAGCCGGCTGACCGTGCCGGGCCTCAGCGAGAACGTGCCCTACAAGTTCAAGGTGCAGGCCAGGACCACTGAGGGCTTCGG
GCCAGAGCGCGAGGGCATCATCACCATAGAGTCCCAGGATGGAGGACCCTTCCCGCAGCTGGGCAGCCGTGCCGGGCTCTTCCAGCACCC
GCTGCAAAGCGAGTACAGCAGCATCACCACCACCCACACCAGCGCCACCGAGCCCTTCCTAGTGGATGGGCTGACCCTGGGGGCCCAGCA
CCTGGAGGCAGGCGGCTCCCTCACCCGGCATGTGACCCAGGAGTTTGTGAGCCGGACACTGACCACCAGCGGAACCCTTAGCACCCACAT
GGACCAACAGTTCTTCCAAACTTGACCGCACCCTGCCCCACCCCCGCCACGTCCCACTAGGCGTCCTCCCGACTCCTCTCCCGGAGCCTC
CTCAGCTACTCCATCCTTGCACCCCTGGGGGCCCAGCCCACCCGCATGCACAGAGCAGGGGCTAGGTGTCTCCTGGGAGGCATGAAGGGG
GCAAGGTCCGTCCTCTGTGGGCCCAAACCTATTTGTAACCAAAGAGCTGGGAGCAGCACAAGGACCCAGCCTTTGTTCTGCACTTAATAA
ATGGTTTTGCTACTGCTAAAAAAAAGTGAAGAAGTCTGACTGTGGAGAATGGCAGTGGAGTGTGTGTGTGCCCACCAGTGGAGACTGTGG
GCTGGGCACACGGGAGGGCACTCGGACTGGAGCTGAGTGCAAGCAAACCATGAAGACCCAGAGATGTAAGATCCCCTGCAACTGGAAGAA
GCAATTTGGCGCGGAGTGCAAATACCAGTTCCAGGCCTGGGGAGAATGTGACCTGAACACAGCCCTGAAGACCAGAACTGGAAGTCTGAA
GCGAGCCCTGCACAATGCCGAATGCCAGAAGACTGTCACCATCTCCAAGCCCTGTGGCAAACTGACCAAGCCCAAACCTCAAGAGAAGGG
AAAATGGAGACACAGGAGTGGGGAGAGTTTGAGAAGATGGTAGAGAGGAGTGTTTGGGTGAAGGGAGATGGATTCGTCTACTGATGCAAC
TGCAGAATCTAAGAAGAAGAAAAAGGAAGGCAAGAAACAGGAGAAGATGCTGGATTAAAAGATGTCACCTGTGGAACATAAAAAGGACAT
CAGCAAACAGGATCAGTTAACTATTGCATTTATATGTACCGTAGGCTTTGTATTCAAAAATTATCTATAGCTAAGTACACAATAAGCAAA
AACAAAAAGAAAAGAAAATTTTTGTAGTAGCGTTTTTTAAATGTATACTATAGTACCAGTAGGGGCTTATAATAAAGGACTGTAATCTTA
TTTAGGAAGTTGACTTATAGTACATGATAAATGATAGACAATTGAGGTAAGTTTTTTGAAATTATGTGACATTTTACATTAAATTTTTTT
TACATTTTTTGGGCAGCAATTTAAATGTTATGACTATGTAAACTACTTCTCTTGTTAGGTAATTTTTTTCACCTAGATTTTTTTCCCAAT
TGAGAAAAATATATACTAAACAAAATAGCAATAAAACATAATCACTCTATTTGAAGAAAATATCTTGTTTTCTGCCAATAGATTTTTTAA
AATGTAGTCAGCAAAATGGGGGTGGGGAAGCAGAGCATGTCCTAGTTCAATGTTGACTTTTTTTTTTTTTAAAGAAAAGCATTAAGACAT


Top

FusionGenePPI for ITGB4_PTN


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ITGB4SHC1, EIF6, ERBB2IP, ALOX12, COL17A1, DST, SREBF2, ITGA3, ARRDC3, ATXN1, SMAD2, SMAD3, PLEC, JUP, HNRNPU, ATF2, ENPP2, LPAR1, SEL1L, ILK, HNRNPD, VCP, MYH13, TNRC6A, SGTB, GEMIN7, MYO19, KLC3, BAG6, PPP2R3C, SKI, EGFR, MUC5ACPTNAPOBEC3G, CGA, DFNA5, HSPBAP1, TAF1D, MKKS, PLXNB2, SUPT7L, WFDC2, ATRX, BMI1, BTBD2, CAAP1, CACNB4, CDH10, CDK5RAP2, COX6C, DUSP12, EVA1A, FTL, BLOC1S1, GLYAT, GTF2F1, ITSN2, MLLT3, MYCBP, NAP1L5, CRCT1, PMF1, PSMB10, RIT1, RBM23, SNCAIP, STC2, TAC3, TBRG4, TXNDC9, ARL15, ATP5C1, CAPZB, CCDC53, CRELD1, DNAJB11, EIF3F, SLC25A36, GPD1, GSTP1, LAMA4, LUC7L2, MAD2L1BP, P4HB, UTP3, SAT1, SSR1, TP53BP2, ARIH2, GIPC2, GNB2L1, HGH1, PPP2CA, PSMD11, PTPRS, RPLP1, SGSM2, TOMM20, UBQLN4, PSMD2, CHD3, SGTA, BCCIP, ALK, PTPRZ1, CTNNB1, NUDT21, GSK3B, MRPL44, C7orf25, BCL2L1, PFDN1, GADD45A, C11orf58, BARD1, KPNB1, GADD45G, FEZ1, PTN, PIAS4, GPRASP2, BAG6, TSC22D1, CYP2E1, UBQLN1, NEK6, PTPRB


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ITGB4_PTN


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for ITGB4_PTN


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneITGB4C1856934Epidermolysis bullosa with pyloric atresia9CTD_human;ORPHANET;UNIPROT
HgeneITGB4C0266159Pyloric Atresia2CTD_human
HgeneITGB4C0000786Spontaneous abortion1CTD_human
HgeneITGB4C0010606Adenoid Cystic Carcinoma1CTD_human
HgeneITGB4C0013575Ectodermal Dysplasia1CTD_human
HgeneITGB4C0014527Epidermolysis Bullosa1CTD_human
HgeneITGB4C0017639Gliosis1CTD_human
HgeneITGB4C0036095Salivary Gland Neoplasms1CTD_human
HgeneITGB4C0079301Junctional Epidermolysis Bullosa1CTD_human
HgeneITGB4C0268374Adult junctional epidermolysis bullosa (disorder)1CTD_human;ORPHANET;UNIPROT
TgenePTNC0023893Liver Cirrhosis, Experimental1CTD_human
TgenePTNC0024667Animal Mammary Neoplasms1CTD_human
TgenePTNC0024668Mammary Neoplasms, Experimental1CTD_human