FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 17834

FusionGeneSummary for ITGA6_RAPGEF4

check button Fusion gene summary
Fusion gene informationFusion gene name: ITGA6_RAPGEF4
Fusion gene ID: 17834
HgeneTgene
Gene symbol

ITGA6

RAPGEF4

Gene ID

3655

11069

Gene nameintegrin subunit alpha 6Rap guanine nucleotide exchange factor 4
SynonymsCD49f|ITGA6B|VLA-6CAMP-GEFII|CGEF2|EPAC|EPAC 2|EPAC2|Nbla00496
Cytomap

2q31.1

2q31.1

Type of geneprotein-codingprotein-coding
Descriptionintegrin alpha-6CD49 antigen-like family member Fintegrin alpha6Bintegrin, alpha 6rap guanine nucleotide exchange factor 4RAP guanine-nucleotide-exchange factor (GEF) 4Rap guanine nucleotide exchange factor (GEF) 4cAMP-regulated guanine nucleotide exchange factor IIexchange factor directly activated by cAMP 2exchange protein direc
Modification date2018052220180519
UniProtAcc

P23229

Q8WZA2

Ensembl transtripts involved in fusion geneENST00000409532, ENST00000264107, 
ENST00000343713, ENST00000264106, 
ENST00000375221, ENST00000409080, 
ENST00000264111, ENST00000397081, 
ENST00000409036, ENST00000397087, 
ENST00000538974, ENST00000540783, 
ENST00000539331, ENST00000473043, 
ENST00000535187, 
Fusion gene scores* DoF score6 X 4 X 5=1208 X 8 X 5=320
# samples 68
** MAII scorelog2(6/120*10)=-1
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(8/320*10)=-2
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: ITGA6 [Title/Abstract] AND RAPGEF4 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDSTADTCGA-D7-A4YY-01AITGA6chr2

173356251

+RAPGEF4chr2

173898642

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000409532ENST00000264111ITGA6chr2

173356251

+RAPGEF4chr2

173898642

+
In-frameENST00000409532ENST00000397081ITGA6chr2

173356251

+RAPGEF4chr2

173898642

+
5CDS-intronENST00000409532ENST00000409036ITGA6chr2

173356251

+RAPGEF4chr2

173898642

+
5CDS-intronENST00000409532ENST00000397087ITGA6chr2

173356251

+RAPGEF4chr2

173898642

+
5CDS-intronENST00000409532ENST00000538974ITGA6chr2

173356251

+RAPGEF4chr2

173898642

+
5CDS-intronENST00000409532ENST00000540783ITGA6chr2

173356251

+RAPGEF4chr2

173898642

+
5CDS-intronENST00000409532ENST00000539331ITGA6chr2

173356251

+RAPGEF4chr2

173898642

+
5CDS-intronENST00000409532ENST00000473043ITGA6chr2

173356251

+RAPGEF4chr2

173898642

+
5CDS-intronENST00000409532ENST00000535187ITGA6chr2

173356251

+RAPGEF4chr2

173898642

+
In-frameENST00000264107ENST00000264111ITGA6chr2

173356251

+RAPGEF4chr2

173898642

+
In-frameENST00000264107ENST00000397081ITGA6chr2

173356251

+RAPGEF4chr2

173898642

+
5CDS-intronENST00000264107ENST00000409036ITGA6chr2

173356251

+RAPGEF4chr2

173898642

+
5CDS-intronENST00000264107ENST00000397087ITGA6chr2

173356251

+RAPGEF4chr2

173898642

+
5CDS-intronENST00000264107ENST00000538974ITGA6chr2

173356251

+RAPGEF4chr2

173898642

+
5CDS-intronENST00000264107ENST00000540783ITGA6chr2

173356251

+RAPGEF4chr2

173898642

+
5CDS-intronENST00000264107ENST00000539331ITGA6chr2

173356251

+RAPGEF4chr2

173898642

+
5CDS-intronENST00000264107ENST00000473043ITGA6chr2

173356251

+RAPGEF4chr2

173898642

+
5CDS-intronENST00000264107ENST00000535187ITGA6chr2

173356251

+RAPGEF4chr2

173898642

+
In-frameENST00000343713ENST00000264111ITGA6chr2

173356251

+RAPGEF4chr2

173898642

+
In-frameENST00000343713ENST00000397081ITGA6chr2

173356251

+RAPGEF4chr2

173898642

+
5CDS-intronENST00000343713ENST00000409036ITGA6chr2

173356251

+RAPGEF4chr2

173898642

+
5CDS-intronENST00000343713ENST00000397087ITGA6chr2

173356251

+RAPGEF4chr2

173898642

+
5CDS-intronENST00000343713ENST00000538974ITGA6chr2

173356251

+RAPGEF4chr2

173898642

+
5CDS-intronENST00000343713ENST00000540783ITGA6chr2

173356251

+RAPGEF4chr2

173898642

+
5CDS-intronENST00000343713ENST00000539331ITGA6chr2

173356251

+RAPGEF4chr2

173898642

+
5CDS-intronENST00000343713ENST00000473043ITGA6chr2

173356251

+RAPGEF4chr2

173898642

+
5CDS-intronENST00000343713ENST00000535187ITGA6chr2

173356251

+RAPGEF4chr2

173898642

+
In-frameENST00000264106ENST00000264111ITGA6chr2

173356251

+RAPGEF4chr2

173898642

+
In-frameENST00000264106ENST00000397081ITGA6chr2

173356251

+RAPGEF4chr2

173898642

+
5CDS-intronENST00000264106ENST00000409036ITGA6chr2

173356251

+RAPGEF4chr2

173898642

+
5CDS-intronENST00000264106ENST00000397087ITGA6chr2

173356251

+RAPGEF4chr2

173898642

+
5CDS-intronENST00000264106ENST00000538974ITGA6chr2

173356251

+RAPGEF4chr2

173898642

+
5CDS-intronENST00000264106ENST00000540783ITGA6chr2

173356251

+RAPGEF4chr2

173898642

+
5CDS-intronENST00000264106ENST00000539331ITGA6chr2

173356251

+RAPGEF4chr2

173898642

+
5CDS-intronENST00000264106ENST00000473043ITGA6chr2

173356251

+RAPGEF4chr2

173898642

+
5CDS-intronENST00000264106ENST00000535187ITGA6chr2

173356251

+RAPGEF4chr2

173898642

+
In-frameENST00000375221ENST00000264111ITGA6chr2

173356251

+RAPGEF4chr2

173898642

+
In-frameENST00000375221ENST00000397081ITGA6chr2

173356251

+RAPGEF4chr2

173898642

+
5CDS-intronENST00000375221ENST00000409036ITGA6chr2

173356251

+RAPGEF4chr2

173898642

+
5CDS-intronENST00000375221ENST00000397087ITGA6chr2

173356251

+RAPGEF4chr2

173898642

+
5CDS-intronENST00000375221ENST00000538974ITGA6chr2

173356251

+RAPGEF4chr2

173898642

+
5CDS-intronENST00000375221ENST00000540783ITGA6chr2

173356251

+RAPGEF4chr2

173898642

+
5CDS-intronENST00000375221ENST00000539331ITGA6chr2

173356251

+RAPGEF4chr2

173898642

+
5CDS-intronENST00000375221ENST00000473043ITGA6chr2

173356251

+RAPGEF4chr2

173898642

+
5CDS-intronENST00000375221ENST00000535187ITGA6chr2

173356251

+RAPGEF4chr2

173898642

+
In-frameENST00000409080ENST00000264111ITGA6chr2

173356251

+RAPGEF4chr2

173898642

+
In-frameENST00000409080ENST00000397081ITGA6chr2

173356251

+RAPGEF4chr2

173898642

+
5CDS-intronENST00000409080ENST00000409036ITGA6chr2

173356251

+RAPGEF4chr2

173898642

+
5CDS-intronENST00000409080ENST00000397087ITGA6chr2

173356251

+RAPGEF4chr2

173898642

+
5CDS-intronENST00000409080ENST00000538974ITGA6chr2

173356251

+RAPGEF4chr2

173898642

+
5CDS-intronENST00000409080ENST00000540783ITGA6chr2

173356251

+RAPGEF4chr2

173898642

+
5CDS-intronENST00000409080ENST00000539331ITGA6chr2

173356251

+RAPGEF4chr2

173898642

+
5CDS-intronENST00000409080ENST00000473043ITGA6chr2

173356251

+RAPGEF4chr2

173898642

+
5CDS-intronENST00000409080ENST00000535187ITGA6chr2

173356251

+RAPGEF4chr2

173898642

+

Top

FusionProtFeatures for ITGA6_RAPGEF4


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ITGA6

P23229

RAPGEF4

Q8WZA2

Guanine nucleotide exchange factor (GEF) for RAP1A,RAP1B and RAP2A small GTPases that is activated by binding cAMP.Seems not to activate RAB3A. Involved in cAMP-dependent, PKA-independent exocytosis through interaction with RIMS2 (Bysimilarity). {ECO:0000250, ECO:0000269|PubMed:10777494,ECO:0000269|PubMed:9856955}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneITGA6chr2:173356251chr2:173898642ENST00000264106+2426363_37110351131Calcium bindingOntology_term=ECO:0000255
HgeneITGA6chr2:173356251chr2:173898642ENST00000264106+2426425_43310351131Calcium bindingOntology_term=ECO:0000255
HgeneITGA6chr2:173356251chr2:173898642ENST00000264106+2426480_48810351131Calcium bindingOntology_term=ECO:0000255
HgeneITGA6chr2:173356251chr2:173898642ENST00000264107+2326363_3719961648Calcium bindingOntology_term=ECO:0000255
HgeneITGA6chr2:173356251chr2:173898642ENST00000264107+2326425_4339961648Calcium bindingOntology_term=ECO:0000255
HgeneITGA6chr2:173356251chr2:173898642ENST00000264107+2326480_4889961648Calcium bindingOntology_term=ECO:0000255
HgeneITGA6chr2:173356251chr2:173898642ENST00000343713+2326363_3719911728Calcium bindingOntology_term=ECO:0000255
HgeneITGA6chr2:173356251chr2:173898642ENST00000343713+2326425_4339911728Calcium bindingOntology_term=ECO:0000255
HgeneITGA6chr2:173356251chr2:173898642ENST00000343713+2326480_4889911728Calcium bindingOntology_term=ECO:0000255
HgeneITGA6chr2:173356251chr2:173898642ENST00000375221+2427363_37110351772Calcium bindingOntology_term=ECO:0000255
HgeneITGA6chr2:173356251chr2:173898642ENST00000375221+2427425_43310351772Calcium bindingOntology_term=ECO:0000255
HgeneITGA6chr2:173356251chr2:173898642ENST00000375221+2427480_48810351772Calcium bindingOntology_term=ECO:0000255
HgeneITGA6chr2:173356251chr2:173898642ENST00000409080+2325363_3719961092Calcium bindingOntology_term=ECO:0000255
HgeneITGA6chr2:173356251chr2:173898642ENST00000409080+2325425_4339961092Calcium bindingOntology_term=ECO:0000255
HgeneITGA6chr2:173356251chr2:173898642ENST00000409080+2325480_4889961092Calcium bindingOntology_term=ECO:0000255
HgeneITGA6chr2:173356251chr2:173898642ENST00000409532+2326363_3718771085Calcium bindingOntology_term=ECO:0000255
HgeneITGA6chr2:173356251chr2:173898642ENST00000409532+2326425_4338771085Calcium bindingOntology_term=ECO:0000255
HgeneITGA6chr2:173356251chr2:173898642ENST00000409532+2326480_4888771085Calcium bindingOntology_term=ECO:0000255
HgeneITGA6chr2:173356251chr2:173898642ENST00000264106+2426101_16610351131RepeatFG-GAP 2
HgeneITGA6chr2:173356251chr2:173898642ENST00000264106+2426176_22910351131RepeatFG-GAP 3
HgeneITGA6chr2:173356251chr2:173898642ENST00000264106+2426283_33910351131RepeatFG-GAP 4
HgeneITGA6chr2:173356251chr2:173898642ENST00000264106+242630_9510351131RepeatFG-GAP 1
HgeneITGA6chr2:173356251chr2:173898642ENST00000264106+2426340_40210351131RepeatFG-GAP 5
HgeneITGA6chr2:173356251chr2:173898642ENST00000264106+2426403_45810351131RepeatFG-GAP 6
HgeneITGA6chr2:173356251chr2:173898642ENST00000264106+2426459_51810351131RepeatFG-GAP 7
HgeneITGA6chr2:173356251chr2:173898642ENST00000264107+2326101_1669961648RepeatFG-GAP 2
HgeneITGA6chr2:173356251chr2:173898642ENST00000264107+2326176_2299961648RepeatFG-GAP 3
HgeneITGA6chr2:173356251chr2:173898642ENST00000264107+2326283_3399961648RepeatFG-GAP 4
HgeneITGA6chr2:173356251chr2:173898642ENST00000264107+232630_959961648RepeatFG-GAP 1
HgeneITGA6chr2:173356251chr2:173898642ENST00000264107+2326340_4029961648RepeatFG-GAP 5
HgeneITGA6chr2:173356251chr2:173898642ENST00000264107+2326403_4589961648RepeatFG-GAP 6
HgeneITGA6chr2:173356251chr2:173898642ENST00000264107+2326459_5189961648RepeatFG-GAP 7
HgeneITGA6chr2:173356251chr2:173898642ENST00000343713+2326101_1669911728RepeatFG-GAP 2
HgeneITGA6chr2:173356251chr2:173898642ENST00000343713+2326176_2299911728RepeatFG-GAP 3
HgeneITGA6chr2:173356251chr2:173898642ENST00000343713+2326283_3399911728RepeatFG-GAP 4
HgeneITGA6chr2:173356251chr2:173898642ENST00000343713+232630_959911728RepeatFG-GAP 1
HgeneITGA6chr2:173356251chr2:173898642ENST00000343713+2326340_4029911728RepeatFG-GAP 5
HgeneITGA6chr2:173356251chr2:173898642ENST00000343713+2326403_4589911728RepeatFG-GAP 6
HgeneITGA6chr2:173356251chr2:173898642ENST00000343713+2326459_5189911728RepeatFG-GAP 7
HgeneITGA6chr2:173356251chr2:173898642ENST00000375221+2427101_16610351772RepeatFG-GAP 2
HgeneITGA6chr2:173356251chr2:173898642ENST00000375221+2427176_22910351772RepeatFG-GAP 3
HgeneITGA6chr2:173356251chr2:173898642ENST00000375221+2427283_33910351772RepeatFG-GAP 4
HgeneITGA6chr2:173356251chr2:173898642ENST00000375221+242730_9510351772RepeatFG-GAP 1
HgeneITGA6chr2:173356251chr2:173898642ENST00000375221+2427340_40210351772RepeatFG-GAP 5
HgeneITGA6chr2:173356251chr2:173898642ENST00000375221+2427403_45810351772RepeatFG-GAP 6
HgeneITGA6chr2:173356251chr2:173898642ENST00000375221+2427459_51810351772RepeatFG-GAP 7
HgeneITGA6chr2:173356251chr2:173898642ENST00000409080+2325101_1669961092RepeatFG-GAP 2
HgeneITGA6chr2:173356251chr2:173898642ENST00000409080+2325176_2299961092RepeatFG-GAP 3
HgeneITGA6chr2:173356251chr2:173898642ENST00000409080+2325283_3399961092RepeatFG-GAP 4
HgeneITGA6chr2:173356251chr2:173898642ENST00000409080+232530_959961092RepeatFG-GAP 1
HgeneITGA6chr2:173356251chr2:173898642ENST00000409080+2325340_4029961092RepeatFG-GAP 5
HgeneITGA6chr2:173356251chr2:173898642ENST00000409080+2325403_4589961092RepeatFG-GAP 6
HgeneITGA6chr2:173356251chr2:173898642ENST00000409080+2325459_5189961092RepeatFG-GAP 7
HgeneITGA6chr2:173356251chr2:173898642ENST00000409532+2326101_1668771085RepeatFG-GAP 2
HgeneITGA6chr2:173356251chr2:173898642ENST00000409532+2326176_2298771085RepeatFG-GAP 3
HgeneITGA6chr2:173356251chr2:173898642ENST00000409532+2326283_3398771085RepeatFG-GAP 4
HgeneITGA6chr2:173356251chr2:173898642ENST00000409532+232630_958771085RepeatFG-GAP 1
HgeneITGA6chr2:173356251chr2:173898642ENST00000409532+2326340_4028771085RepeatFG-GAP 5
HgeneITGA6chr2:173356251chr2:173898642ENST00000409532+2326403_4588771085RepeatFG-GAP 6
HgeneITGA6chr2:173356251chr2:173898642ENST00000409532+2326459_5188771085RepeatFG-GAP 7
TgeneRAPGEF4chr2:173356251chr2:173898642ENST00000397087+2228772_1009739868DomainRas-GEF

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneITGA6chr2:173356251chr2:173898642ENST00000264106+24261079_108310351131MotifNote=GFFKR motif
HgeneITGA6chr2:173356251chr2:173898642ENST00000264107+23261079_10839961648MotifNote=GFFKR motif
HgeneITGA6chr2:173356251chr2:173898642ENST00000343713+23261079_10839911728MotifNote=GFFKR motif
HgeneITGA6chr2:173356251chr2:173898642ENST00000375221+24271079_108310351772MotifNote=GFFKR motif
HgeneITGA6chr2:173356251chr2:173898642ENST00000409080+23251079_10839961092MotifNote=GFFKR motif
HgeneITGA6chr2:173356251chr2:173898642ENST00000409532+23261079_10838771085MotifNote=GFFKR motif
HgeneITGA6chr2:173356251chr2:173898642ENST00000264106+24261077_113010351131Topological domainCytoplasmic
HgeneITGA6chr2:173356251chr2:173898642ENST00000264106+242624_105010351131Topological domainExtracellular
HgeneITGA6chr2:173356251chr2:173898642ENST00000264107+23261077_11309961648Topological domainCytoplasmic
HgeneITGA6chr2:173356251chr2:173898642ENST00000264107+232624_10509961648Topological domainExtracellular
HgeneITGA6chr2:173356251chr2:173898642ENST00000343713+23261077_11309911728Topological domainCytoplasmic
HgeneITGA6chr2:173356251chr2:173898642ENST00000343713+232624_10509911728Topological domainExtracellular
HgeneITGA6chr2:173356251chr2:173898642ENST00000375221+24271077_113010351772Topological domainCytoplasmic
HgeneITGA6chr2:173356251chr2:173898642ENST00000375221+242724_105010351772Topological domainExtracellular
HgeneITGA6chr2:173356251chr2:173898642ENST00000409080+23251077_11309961092Topological domainCytoplasmic
HgeneITGA6chr2:173356251chr2:173898642ENST00000409080+232524_10509961092Topological domainExtracellular
HgeneITGA6chr2:173356251chr2:173898642ENST00000409532+23261077_11308771085Topological domainCytoplasmic
HgeneITGA6chr2:173356251chr2:173898642ENST00000409532+232624_10508771085Topological domainExtracellular
HgeneITGA6chr2:173356251chr2:173898642ENST00000264106+24261051_107610351131TransmembraneHelical
HgeneITGA6chr2:173356251chr2:173898642ENST00000264107+23261051_10769961648TransmembraneHelical
HgeneITGA6chr2:173356251chr2:173898642ENST00000343713+23261051_10769911728TransmembraneHelical
HgeneITGA6chr2:173356251chr2:173898642ENST00000375221+24271051_107610351772TransmembraneHelical
HgeneITGA6chr2:173356251chr2:173898642ENST00000409080+23251051_10769961092TransmembraneHelical
HgeneITGA6chr2:173356251chr2:173898642ENST00000409532+23261051_10768771085TransmembraneHelical
TgeneRAPGEF4chr2:173356251chr2:173898642ENST00000397081+2531216_2918831012DomainDEP
TgeneRAPGEF4chr2:173356251chr2:173898642ENST00000397081+2531496_6348831012DomainN-terminal Ras-GEF
TgeneRAPGEF4chr2:173356251chr2:173898642ENST00000397081+2531772_10098831012DomainRas-GEF
TgeneRAPGEF4chr2:173356251chr2:173898642ENST00000397087+2228216_291739868DomainDEP
TgeneRAPGEF4chr2:173356251chr2:173898642ENST00000397087+2228496_634739868DomainN-terminal Ras-GEF
TgeneRAPGEF4chr2:173356251chr2:173898642ENST00000397081+2531356_4768831012Nucleotide bindingNote=cAMP 2
TgeneRAPGEF4chr2:173356251chr2:173898642ENST00000397081+253143_1668831012Nucleotide bindingNote=cAMP 1
TgeneRAPGEF4chr2:173356251chr2:173898642ENST00000397087+2228356_476739868Nucleotide bindingNote=cAMP 2
TgeneRAPGEF4chr2:173356251chr2:173898642ENST00000397087+222843_166739868Nucleotide bindingNote=cAMP 1


Top

FusionGeneSequence for ITGA6_RAPGEF4


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ITGA6_ENST00000409532_chr2_173356251_+_RAPGEF4_ENST00000264111_chr2_173898642_+_1006aa
MGVTVQSQGPGGKVVTCAHRTEKRQHVNTKQESRDIFGRCTVLSQNLRIEDDMDGGDWSFCDGRLRGHEKFGSCQQGVAATFTKDFHYIV
FGAPGTTNWKGLLFLTSVSTTDPDQFVTKTRPPREQPDTFPDVMMNSYLGFSLDSGKGIVSKDEITFVSGAPRANHSGAVVLLKRDMKSA
HLLPEHIFDGEGLASSFGTDVAVVDLNKDGWQDIVIGAPQTFDRDGEVGGAVTVYMNQQGRWNNVKPIRLNGTKDSMFGIAVKNIGDINQ
DGYPDIAVGAPTDDLGKVFITHGSANGINTKPTQVLKGISPTFGTSIAGNMDLDRNSYPDVAVGSLSDSVTIFRSRPVINIQKTITVTPN
RIDLRQKTACGAPSGICLQVKSCFETTANPAGTNPSISIVGTLEAEKERRKSGLSSRVQFRNQGSEPKTTQELTLKRQKQKVCMEETLWL
QDNIRDKLRPIPITASVEIQEPSSRRRVNSLPEVLPILNSDEPKTAHIDVHFLKEGCGDDNVCNSNLKLETKFCTREGNQDKFSTLPIQK
GVPELVLKDQKDIALEITVTNSPSNPRNPTKDGDDAHEAKLIATFPDTLTTSATRELRAFPEKQLSCVANQNGSQADCELGNPFKRNSNV
TFTLVLSTTEVTFDTPDLDINLKLETTSNQDNLAPITAKAKVVIELLLSVSGVAKPSQVTFGGTVVGEQAMKSEDEVGSLIETEFRVINL
GKPLTNLGTATLNIQWPKEISNGKWLLTLVKVESKGLEKVTCEPQKEINSLNLTESHNSRKKREITEKQIDDNRKFSLFAERKYQTLNCS
VNVNCVNIRCPLRGLDSKASLILRSRLWNSTFLEETSKLNYLDILMRAFIDVTAAAENIRLPNAGTQKLPSKFKKFTAEFESLMDPSRNH
RAYRLTVAKLEPPLIPFMPLLIKDMTFTHEGNKTFIDNLVNFEKMRMIANTARTVRYYRSQPFNPDAAQANKNHQDVRSTVRQLNVIDNQ

>In-frame_ITGA6_ENST00000409532_chr2_173356251_+_RAPGEF4_ENST00000397081_chr2_173898642_+_1006aa
MGVTVQSQGPGGKVVTCAHRTEKRQHVNTKQESRDIFGRCTVLSQNLRIEDDMDGGDWSFCDGRLRGHEKFGSCQQGVAATFTKDFHYIV
FGAPGTTNWKGLLFLTSVSTTDPDQFVTKTRPPREQPDTFPDVMMNSYLGFSLDSGKGIVSKDEITFVSGAPRANHSGAVVLLKRDMKSA
HLLPEHIFDGEGLASSFGTDVAVVDLNKDGWQDIVIGAPQTFDRDGEVGGAVTVYMNQQGRWNNVKPIRLNGTKDSMFGIAVKNIGDINQ
DGYPDIAVGAPTDDLGKVFITHGSANGINTKPTQVLKGISPTFGTSIAGNMDLDRNSYPDVAVGSLSDSVTIFRSRPVINIQKTITVTPN
RIDLRQKTACGAPSGICLQVKSCFETTANPAGTNPSISIVGTLEAEKERRKSGLSSRVQFRNQGSEPKTTQELTLKRQKQKVCMEETLWL
QDNIRDKLRPIPITASVEIQEPSSRRRVNSLPEVLPILNSDEPKTAHIDVHFLKEGCGDDNVCNSNLKLETKFCTREGNQDKFSTLPIQK
GVPELVLKDQKDIALEITVTNSPSNPRNPTKDGDDAHEAKLIATFPDTLTTSATRELRAFPEKQLSCVANQNGSQADCELGNPFKRNSNV
TFTLVLSTTEVTFDTPDLDINLKLETTSNQDNLAPITAKAKVVIELLLSVSGVAKPSQVTFGGTVVGEQAMKSEDEVGSLIETEFRVINL
GKPLTNLGTATLNIQWPKEISNGKWLLTLVKVESKGLEKVTCEPQKEINSLNLTESHNSRKKREITEKQIDDNRKFSLFAERKYQTLNCS
VNVNCVNIRCPLRGLDSKASLILRSRLWNSTFLEETSKLNYLDILMRAFIDVTAAAENIRLPNAGTQKLPSKFKKFTAEFESLMDPSRNH
RAYRLTVAKLEPPLIPFMPLLIKDMTFTHEGNKTFIDNLVNFEKMRMIANTARTVRYYRSQPFNPDAAQANKNHQDVRSTVRQLNVIDNQ

>In-frame_ITGA6_ENST00000264107_chr2_173356251_+_RAPGEF4_ENST00000264111_chr2_173898642_+_1125aa
MAAAGQLCLLYLSAGLLSRLGAAFNLDTREDNVIRKTGDPGSLFGFSLAMHWQLQPEDKRLLLVGAPRAEALPLQRANRTGGLYSCDITA
RGPCTRIEFDNDADPTSESKEDQWMGVTVQSQGPGGKVVTCAHRTEKRQHVNTKQESRDIFGRCTVLSQNLRIEDDMDGGDWSFCDGRLR
GHEKFGSCQQGVAATFTKDFHYIVFGAPGTTNWKGIVRVEQKNNTFFDMNIFEDGPTEVGGETEHDESLVPVPANSYLGFSLDSGKGIVS
KDEITFVSGAPRANHSGAVVLLKRDMKSAHLLPEHIFDGEGLASSFGTDVAVVDLNKDGWQDIVIGAPQTFDRDGEVGGAVTVYMNQQGR
WNNVKPIRLNGTKDSMFGIAVKNIGDINQDGYPDIAVGAPTDDLGKVFITHGSANGINTKPTQVLKGISPTFGTSIAGNMDLDRNSYPDV
AVGSLSDSVTIFRSRPVINIQKTITVTPNRIDLRQKTACGAPSGICLQVKSCFETTANPAGTNPSISIVGTLEAEKERRKSGLSSRVQFR
NQGSEPKTTQELTLKRQKQKVCMEETLWLQDNIRDKLRPIPITASVEIQEPSSRRRVNSLPEVLPILNSDEPKTAHIDVHFLKEGCGDDN
VCNSNLKLETKFCTREGNQDKFSTLPIQKGVPELVLKDQKDIALEITVTNSPSNPRNPTKDGDDAHEAKLIATFPDTLTTSATRELRAFP
EKQLSCVANQNGSQADCELGNPFKRNSNVTFTLVLSTTEVTFDTPDLDINLKLETTSNQDNLAPITAKAKVVIELLLSVSGVAKPSQVTF
GGTVVGEQAMKSEDEVGSLIETEFRVINLGKPLTNLGTATLNIQWPKEISNGKWLLTLVKVESKGLEKVTCEPQKEINSLNLTESHNSRK
KREITEKQIDDNRKFSLFAERKYQTLNCSVNVNCVNIRCPLRGLDSKASLILRSRLWNSTFLEETSKLNYLDILMRAFIDVTAAAENIRL
PNAGTQKLPSKFKKFTAEFESLMDPSRNHRAYRLTVAKLEPPLIPFMPLLIKDMTFTHEGNKTFIDNLVNFEKMRMIANTARTVRYYRSQ

>In-frame_ITGA6_ENST00000264107_chr2_173356251_+_RAPGEF4_ENST00000397081_chr2_173898642_+_1125aa
MAAAGQLCLLYLSAGLLSRLGAAFNLDTREDNVIRKTGDPGSLFGFSLAMHWQLQPEDKRLLLVGAPRAEALPLQRANRTGGLYSCDITA
RGPCTRIEFDNDADPTSESKEDQWMGVTVQSQGPGGKVVTCAHRTEKRQHVNTKQESRDIFGRCTVLSQNLRIEDDMDGGDWSFCDGRLR
GHEKFGSCQQGVAATFTKDFHYIVFGAPGTTNWKGIVRVEQKNNTFFDMNIFEDGPTEVGGETEHDESLVPVPANSYLGFSLDSGKGIVS
KDEITFVSGAPRANHSGAVVLLKRDMKSAHLLPEHIFDGEGLASSFGTDVAVVDLNKDGWQDIVIGAPQTFDRDGEVGGAVTVYMNQQGR
WNNVKPIRLNGTKDSMFGIAVKNIGDINQDGYPDIAVGAPTDDLGKVFITHGSANGINTKPTQVLKGISPTFGTSIAGNMDLDRNSYPDV
AVGSLSDSVTIFRSRPVINIQKTITVTPNRIDLRQKTACGAPSGICLQVKSCFETTANPAGTNPSISIVGTLEAEKERRKSGLSSRVQFR
NQGSEPKTTQELTLKRQKQKVCMEETLWLQDNIRDKLRPIPITASVEIQEPSSRRRVNSLPEVLPILNSDEPKTAHIDVHFLKEGCGDDN
VCNSNLKLETKFCTREGNQDKFSTLPIQKGVPELVLKDQKDIALEITVTNSPSNPRNPTKDGDDAHEAKLIATFPDTLTTSATRELRAFP
EKQLSCVANQNGSQADCELGNPFKRNSNVTFTLVLSTTEVTFDTPDLDINLKLETTSNQDNLAPITAKAKVVIELLLSVSGVAKPSQVTF
GGTVVGEQAMKSEDEVGSLIETEFRVINLGKPLTNLGTATLNIQWPKEISNGKWLLTLVKVESKGLEKVTCEPQKEINSLNLTESHNSRK
KREITEKQIDDNRKFSLFAERKYQTLNCSVNVNCVNIRCPLRGLDSKASLILRSRLWNSTFLEETSKLNYLDILMRAFIDVTAAAENIRL
PNAGTQKLPSKFKKFTAEFESLMDPSRNHRAYRLTVAKLEPPLIPFMPLLIKDMTFTHEGNKTFIDNLVNFEKMRMIANTARTVRYYRSQ

>In-frame_ITGA6_ENST00000343713_chr2_173356251_+_RAPGEF4_ENST00000264111_chr2_173898642_+_1120aa
MAAAGQLCLLYLSAGLLSRLGAAFNLDTREDNVIRKTGDPGSLFGFSLAMHWQLQPEDKRLLLVGAPRAEALPLQRANRTGGLYSCDITA
RGPCTRIEFDNDADPTSESKEDQWMGVTVQSQGPGGKVVTCAHRTEKRQHVNTKQESRDIFGRCTVLSQNLRIEDDMDGGDWSFCDGRLR
GHEKFGSCQQGVAATFTKDFHYIVFGAPGTTNWKGLLFLTSVSTTDPDQFVTKTRPPREQPDTFPDVMMNSYLGFSLDSGKGIVSKDEIT
FVSGAPRANHSGAVVLLKRDMKSAHLLPEHIFDGEGLASSFGTDVAVVDLNKDGWQDIVIGAPQTFDRDGEVGGAVTVYMNQQGRWNNVK
PIRLNGTKDSMFGIAVKNIGDINQDGYPDIAVGAPTDDLGKVFITHGSANGINTKPTQVLKGISPTFGTSIAGNMDLDRNSYPDVAVGSL
SDSVTIFRSRPVINIQKTITVTPNRIDLRQKTACGAPSGICLQVKSCFETTANPAGTNPSISIVGTLEAEKERRKSGLSSRVQFRNQGSE
PKTTQELTLKRQKQKVCMEETLWLQDNIRDKLRPIPITASVEIQEPSSRRRVNSLPEVLPILNSDEPKTAHIDVHFLKEGCGDDNVCNSN
LKLETKFCTREGNQDKFSTLPIQKGVPELVLKDQKDIALEITVTNSPSNPRNPTKDGDDAHEAKLIATFPDTLTTSATRELRAFPEKQLS
CVANQNGSQADCELGNPFKRNSNVTFTLVLSTTEVTFDTPDLDINLKLETTSNQDNLAPITAKAKVVIELLLSVSGVAKPSQVTFGGTVV
GEQAMKSEDEVGSLIETEFRVINLGKPLTNLGTATLNIQWPKEISNGKWLLTLVKVESKGLEKVTCEPQKEINSLNLTESHNSRKKREIT
EKQIDDNRKFSLFAERKYQTLNCSVNVNCVNIRCPLRGLDSKASLILRSRLWNSTFLEETSKLNYLDILMRAFIDVTAAAENIRLPNAGT
QKLPSKFKKFTAEFESLMDPSRNHRAYRLTVAKLEPPLIPFMPLLIKDMTFTHEGNKTFIDNLVNFEKMRMIANTARTVRYYRSQPFNPD

>In-frame_ITGA6_ENST00000343713_chr2_173356251_+_RAPGEF4_ENST00000397081_chr2_173898642_+_1120aa
MAAAGQLCLLYLSAGLLSRLGAAFNLDTREDNVIRKTGDPGSLFGFSLAMHWQLQPEDKRLLLVGAPRAEALPLQRANRTGGLYSCDITA
RGPCTRIEFDNDADPTSESKEDQWMGVTVQSQGPGGKVVTCAHRTEKRQHVNTKQESRDIFGRCTVLSQNLRIEDDMDGGDWSFCDGRLR
GHEKFGSCQQGVAATFTKDFHYIVFGAPGTTNWKGLLFLTSVSTTDPDQFVTKTRPPREQPDTFPDVMMNSYLGFSLDSGKGIVSKDEIT
FVSGAPRANHSGAVVLLKRDMKSAHLLPEHIFDGEGLASSFGTDVAVVDLNKDGWQDIVIGAPQTFDRDGEVGGAVTVYMNQQGRWNNVK
PIRLNGTKDSMFGIAVKNIGDINQDGYPDIAVGAPTDDLGKVFITHGSANGINTKPTQVLKGISPTFGTSIAGNMDLDRNSYPDVAVGSL
SDSVTIFRSRPVINIQKTITVTPNRIDLRQKTACGAPSGICLQVKSCFETTANPAGTNPSISIVGTLEAEKERRKSGLSSRVQFRNQGSE
PKTTQELTLKRQKQKVCMEETLWLQDNIRDKLRPIPITASVEIQEPSSRRRVNSLPEVLPILNSDEPKTAHIDVHFLKEGCGDDNVCNSN
LKLETKFCTREGNQDKFSTLPIQKGVPELVLKDQKDIALEITVTNSPSNPRNPTKDGDDAHEAKLIATFPDTLTTSATRELRAFPEKQLS
CVANQNGSQADCELGNPFKRNSNVTFTLVLSTTEVTFDTPDLDINLKLETTSNQDNLAPITAKAKVVIELLLSVSGVAKPSQVTFGGTVV
GEQAMKSEDEVGSLIETEFRVINLGKPLTNLGTATLNIQWPKEISNGKWLLTLVKVESKGLEKVTCEPQKEINSLNLTESHNSRKKREIT
EKQIDDNRKFSLFAERKYQTLNCSVNVNCVNIRCPLRGLDSKASLILRSRLWNSTFLEETSKLNYLDILMRAFIDVTAAAENIRLPNAGT
QKLPSKFKKFTAEFESLMDPSRNHRAYRLTVAKLEPPLIPFMPLLIKDMTFTHEGNKTFIDNLVNFEKMRMIANTARTVRYYRSQPFNPD

>In-frame_ITGA6_ENST00000264106_chr2_173356251_+_RAPGEF4_ENST00000264111_chr2_173898642_+_1164aa
MAAAGQLCLLYLSAGLLSRLGAAFNLDTREDNVIRKTGDPGSLFGFSLAMHWQLQPEDKRLLLVGAPRAEALPLQRANRTGGLYSCDITA
RGPCTRIEFDNDADPTSESKEDQWMGVTVQSQGPGGKVVTCAHRTEKRQHVNTKQESRDIFGRCTVLSQNLRIEDDMDGGDWSFCDGRLR
GHEKFGSCQQGVAATFTKDFHYIVFGAPGTTNWKGIVRVEQKNNTFFDMNIFEDGPTEVGGETEHDESLVPVPANSYLGLLFLTSVSTTD
PDQFVTKTRPPREQPDTFPDVMMNSYLGFSLDSGKGIVSKDEITFVSGAPRANHSGAVVLLKRDMKSAHLLPEHIFDGEGLASSFGTDVA
VVDLNKDGWQDIVIGAPQTFDRDGEVGGAVTVYMNQQGRWNNVKPIRLNGTKDSMFGIAVKNIGDINQDGYPDIAVGAPTDDLGKVFITH
GSANGINTKPTQVLKGISPTFGTSIAGNMDLDRNSYPDVAVGSLSDSVTIFRSRPVINIQKTITVTPNRIDLRQKTACGAPSGICLQVKS
CFETTANPAGTNPSISIVGTLEAEKERRKSGLSSRVQFRNQGSEPKTTQELTLKRQKQKVCMEETLWLQDNIRDKLRPIPITASVEIQEP
SSRRRVNSLPEVLPILNSDEPKTAHIDVHFLKEGCGDDNVCNSNLKLETKFCTREGNQDKFSTLPIQKGVPELVLKDQKDIALEITVTNS
PSNPRNPTKDGDDAHEAKLIATFPDTLTTSATRELRAFPEKQLSCVANQNGSQADCELGNPFKRNSNVTFTLVLSTTEVTFDTPDLDINL
KLETTSNQDNLAPITAKAKVVIELLLSVSGVAKPSQVTFGGTVVGEQAMKSEDEVGSLIETEFRVINLGKPLTNLGTATLNIQWPKEISN
GKWLLTLVKVESKGLEKVTCEPQKEINSLNLTESHNSRKKREITEKQIDDNRKFSLFAERKYQTLNCSVNVNCVNIRCPLRGLDSKASLI
LRSRLWNSTFLEETSKLNYLDILMRAFIDVTAAAENIRLPNAGTQKLPSKFKKFTAEFESLMDPSRNHRAYRLTVAKLEPPLIPFMPLLI

>In-frame_ITGA6_ENST00000264106_chr2_173356251_+_RAPGEF4_ENST00000397081_chr2_173898642_+_1164aa
MAAAGQLCLLYLSAGLLSRLGAAFNLDTREDNVIRKTGDPGSLFGFSLAMHWQLQPEDKRLLLVGAPRAEALPLQRANRTGGLYSCDITA
RGPCTRIEFDNDADPTSESKEDQWMGVTVQSQGPGGKVVTCAHRTEKRQHVNTKQESRDIFGRCTVLSQNLRIEDDMDGGDWSFCDGRLR
GHEKFGSCQQGVAATFTKDFHYIVFGAPGTTNWKGIVRVEQKNNTFFDMNIFEDGPTEVGGETEHDESLVPVPANSYLGLLFLTSVSTTD
PDQFVTKTRPPREQPDTFPDVMMNSYLGFSLDSGKGIVSKDEITFVSGAPRANHSGAVVLLKRDMKSAHLLPEHIFDGEGLASSFGTDVA
VVDLNKDGWQDIVIGAPQTFDRDGEVGGAVTVYMNQQGRWNNVKPIRLNGTKDSMFGIAVKNIGDINQDGYPDIAVGAPTDDLGKVFITH
GSANGINTKPTQVLKGISPTFGTSIAGNMDLDRNSYPDVAVGSLSDSVTIFRSRPVINIQKTITVTPNRIDLRQKTACGAPSGICLQVKS
CFETTANPAGTNPSISIVGTLEAEKERRKSGLSSRVQFRNQGSEPKTTQELTLKRQKQKVCMEETLWLQDNIRDKLRPIPITASVEIQEP
SSRRRVNSLPEVLPILNSDEPKTAHIDVHFLKEGCGDDNVCNSNLKLETKFCTREGNQDKFSTLPIQKGVPELVLKDQKDIALEITVTNS
PSNPRNPTKDGDDAHEAKLIATFPDTLTTSATRELRAFPEKQLSCVANQNGSQADCELGNPFKRNSNVTFTLVLSTTEVTFDTPDLDINL
KLETTSNQDNLAPITAKAKVVIELLLSVSGVAKPSQVTFGGTVVGEQAMKSEDEVGSLIETEFRVINLGKPLTNLGTATLNIQWPKEISN
GKWLLTLVKVESKGLEKVTCEPQKEINSLNLTESHNSRKKREITEKQIDDNRKFSLFAERKYQTLNCSVNVNCVNIRCPLRGLDSKASLI
LRSRLWNSTFLEETSKLNYLDILMRAFIDVTAAAENIRLPNAGTQKLPSKFKKFTAEFESLMDPSRNHRAYRLTVAKLEPPLIPFMPLLI

>In-frame_ITGA6_ENST00000375221_chr2_173356251_+_RAPGEF4_ENST00000264111_chr2_173898642_+_1164aa
MAAAGQLCLLYLSAGLLSRLGAAFNLDTREDNVIRKTGDPGSLFGFSLAMHWQLQPEDKRLLLVGAPRAEALPLQRANRTGGLYSCDITA
RGPCTRIEFDNDADPTSESKEDQWMGVTVQSQGPGGKVVTCAHRTEKRQHVNTKQESRDIFGRCTVLSQNLRIEDDMDGGDWSFCDGRLR
GHEKFGSCQQGVAATFTKDFHYIVFGAPGTTNWKGIVRVEQKNNTFFDMNIFEDGPTEVGGETEHDESLVPVPANSYLGLLFLTSVSTTD
PDQFVTKTRPPREQPDTFPDVMMNSYLGFSLDSGKGIVSKDEITFVSGAPRANHSGAVVLLKRDMKSAHLLPEHIFDGEGLASSFGTDVA
VVDLNKDGWQDIVIGAPQTFDRDGEVGGAVTVYMNQQGRWNNVKPIRLNGTKDSMFGIAVKNIGDINQDGYPDIAVGAPTDDLGKVFITH
GSANGINTKPTQVLKGISPTFGTSIAGNMDLDRNSYPDVAVGSLSDSVTIFRSRPVINIQKTITVTPNRIDLRQKTACGAPSGICLQVKS
CFETTANPAGTNPSISIVGTLEAEKERRKSGLSSRVQFRNQGSEPKTTQELTLKRQKQKVCMEETLWLQDNIRDKLRPIPITASVEIQEP
SSRRRVNSLPEVLPILNSDEPKTAHIDVHFLKEGCGDDNVCNSNLKLETKFCTREGNQDKFSTLPIQKGVPELVLKDQKDIALEITVTNS
PSNPRNPTKDGDDAHEAKLIATFPDTLTTSATRELRAFPEKQLSCVANQNGSQADCELGNPFKRNSNVTFTLVLSTTEVTFDTPDLDINL
KLETTSNQDNLAPITAKAKVVIELLLSVSGVAKPSQVTFGGTVVGEQAMKSEDEVGSLIETEFRVINLGKPLTNLGTATLNIQWPKEISN
GKWLLTLVKVESKGLEKVTCEPQKEINSLNLTESHNSRKKREITEKQIDDNRKFSLFAERKYQTLNCSVNVNCVNIRCPLRGLDSKASLI
LRSRLWNSTFLEETSKLNYLDILMRAFIDVTAAAENIRLPNAGTQKLPSKFKKFTAEFESLMDPSRNHRAYRLTVAKLEPPLIPFMPLLI

>In-frame_ITGA6_ENST00000375221_chr2_173356251_+_RAPGEF4_ENST00000397081_chr2_173898642_+_1164aa
MAAAGQLCLLYLSAGLLSRLGAAFNLDTREDNVIRKTGDPGSLFGFSLAMHWQLQPEDKRLLLVGAPRAEALPLQRANRTGGLYSCDITA
RGPCTRIEFDNDADPTSESKEDQWMGVTVQSQGPGGKVVTCAHRTEKRQHVNTKQESRDIFGRCTVLSQNLRIEDDMDGGDWSFCDGRLR
GHEKFGSCQQGVAATFTKDFHYIVFGAPGTTNWKGIVRVEQKNNTFFDMNIFEDGPTEVGGETEHDESLVPVPANSYLGLLFLTSVSTTD
PDQFVTKTRPPREQPDTFPDVMMNSYLGFSLDSGKGIVSKDEITFVSGAPRANHSGAVVLLKRDMKSAHLLPEHIFDGEGLASSFGTDVA
VVDLNKDGWQDIVIGAPQTFDRDGEVGGAVTVYMNQQGRWNNVKPIRLNGTKDSMFGIAVKNIGDINQDGYPDIAVGAPTDDLGKVFITH
GSANGINTKPTQVLKGISPTFGTSIAGNMDLDRNSYPDVAVGSLSDSVTIFRSRPVINIQKTITVTPNRIDLRQKTACGAPSGICLQVKS
CFETTANPAGTNPSISIVGTLEAEKERRKSGLSSRVQFRNQGSEPKTTQELTLKRQKQKVCMEETLWLQDNIRDKLRPIPITASVEIQEP
SSRRRVNSLPEVLPILNSDEPKTAHIDVHFLKEGCGDDNVCNSNLKLETKFCTREGNQDKFSTLPIQKGVPELVLKDQKDIALEITVTNS
PSNPRNPTKDGDDAHEAKLIATFPDTLTTSATRELRAFPEKQLSCVANQNGSQADCELGNPFKRNSNVTFTLVLSTTEVTFDTPDLDINL
KLETTSNQDNLAPITAKAKVVIELLLSVSGVAKPSQVTFGGTVVGEQAMKSEDEVGSLIETEFRVINLGKPLTNLGTATLNIQWPKEISN
GKWLLTLVKVESKGLEKVTCEPQKEINSLNLTESHNSRKKREITEKQIDDNRKFSLFAERKYQTLNCSVNVNCVNIRCPLRGLDSKASLI
LRSRLWNSTFLEETSKLNYLDILMRAFIDVTAAAENIRLPNAGTQKLPSKFKKFTAEFESLMDPSRNHRAYRLTVAKLEPPLIPFMPLLI

>In-frame_ITGA6_ENST00000409080_chr2_173356251_+_RAPGEF4_ENST00000264111_chr2_173898642_+_1125aa
MAAAGQLCLLYLSAGLLSRLGAAFNLDTREDNVIRKTGDPGSLFGFSLAMHWQLQPEDKRLLLVGAPRAEALPLQRANRTGGLYSCDITA
RGPCTRIEFDNDADPTSESKEDQWMGVTVQSQGPGGKVVTCAHRTEKRQHVNTKQESRDIFGRCTVLSQNLRIEDDMDGGDWSFCDGRLR
GHEKFGSCQQGVAATFTKDFHYIVFGAPGTTNWKGIVRVEQKNNTFFDMNIFEDGPTEVGGETEHDESLVPVPANSYLGFSLDSGKGIVS
KDEITFVSGAPRANHSGAVVLLKRDMKSAHLLPEHIFDGEGLASSFGTDVAVVDLNKDGWQDIVIGAPQTFDRDGEVGGAVTVYMNQQGR
WNNVKPIRLNGTKDSMFGIAVKNIGDINQDGYPDIAVGAPTDDLGKVFITHGSANGINTKPTQVLKGISPTFGTSIAGNMDLDRNSYPDV
AVGSLSDSVTIFRSRPVINIQKTITVTPNRIDLRQKTACGAPSGICLQVKSCFETTANPAGTNPSISIVGTLEAEKERRKSGLSSRVQFR
NQGSEPKTTQELTLKRQKQKVCMEETLWLQDNIRDKLRPIPITASVEIQEPSSRRRVNSLPEVLPILNSDEPKTAHIDVHFLKEGCGDDN
VCNSNLKLETKFCTREGNQDKFSTLPIQKGVPELVLKDQKDIALEITVTNSPSNPRNPTKDGDDAHEAKLIATFPDTLTTSATRELRAFP
EKQLSCVANQNGSQADCELGNPFKRNSNVTFTLVLSTTEVTFDTPDLDINLKLETTSNQDNLAPITAKAKVVIELLLSVSGVAKPSQVTF
GGTVVGEQAMKSEDEVGSLIETEFRVINLGKPLTNLGTATLNIQWPKEISNGKWLLTLVKVESKGLEKVTCEPQKEINSLNLTESHNSRK
KREITEKQIDDNRKFSLFAERKYQTLNCSVNVNCVNIRCPLRGLDSKASLILRSRLWNSTFLEETSKLNYLDILMRAFIDVTAAAENIRL
PNAGTQKLPSKFKKFTAEFESLMDPSRNHRAYRLTVAKLEPPLIPFMPLLIKDMTFTHEGNKTFIDNLVNFEKMRMIANTARTVRYYRSQ

>In-frame_ITGA6_ENST00000409080_chr2_173356251_+_RAPGEF4_ENST00000397081_chr2_173898642_+_1125aa
MAAAGQLCLLYLSAGLLSRLGAAFNLDTREDNVIRKTGDPGSLFGFSLAMHWQLQPEDKRLLLVGAPRAEALPLQRANRTGGLYSCDITA
RGPCTRIEFDNDADPTSESKEDQWMGVTVQSQGPGGKVVTCAHRTEKRQHVNTKQESRDIFGRCTVLSQNLRIEDDMDGGDWSFCDGRLR
GHEKFGSCQQGVAATFTKDFHYIVFGAPGTTNWKGIVRVEQKNNTFFDMNIFEDGPTEVGGETEHDESLVPVPANSYLGFSLDSGKGIVS
KDEITFVSGAPRANHSGAVVLLKRDMKSAHLLPEHIFDGEGLASSFGTDVAVVDLNKDGWQDIVIGAPQTFDRDGEVGGAVTVYMNQQGR
WNNVKPIRLNGTKDSMFGIAVKNIGDINQDGYPDIAVGAPTDDLGKVFITHGSANGINTKPTQVLKGISPTFGTSIAGNMDLDRNSYPDV
AVGSLSDSVTIFRSRPVINIQKTITVTPNRIDLRQKTACGAPSGICLQVKSCFETTANPAGTNPSISIVGTLEAEKERRKSGLSSRVQFR
NQGSEPKTTQELTLKRQKQKVCMEETLWLQDNIRDKLRPIPITASVEIQEPSSRRRVNSLPEVLPILNSDEPKTAHIDVHFLKEGCGDDN
VCNSNLKLETKFCTREGNQDKFSTLPIQKGVPELVLKDQKDIALEITVTNSPSNPRNPTKDGDDAHEAKLIATFPDTLTTSATRELRAFP
EKQLSCVANQNGSQADCELGNPFKRNSNVTFTLVLSTTEVTFDTPDLDINLKLETTSNQDNLAPITAKAKVVIELLLSVSGVAKPSQVTF
GGTVVGEQAMKSEDEVGSLIETEFRVINLGKPLTNLGTATLNIQWPKEISNGKWLLTLVKVESKGLEKVTCEPQKEINSLNLTESHNSRK
KREITEKQIDDNRKFSLFAERKYQTLNCSVNVNCVNIRCPLRGLDSKASLILRSRLWNSTFLEETSKLNYLDILMRAFIDVTAAAENIRL
PNAGTQKLPSKFKKFTAEFESLMDPSRNHRAYRLTVAKLEPPLIPFMPLLIKDMTFTHEGNKTFIDNLVNFEKMRMIANTARTVRYYRSQ


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ITGA6_ENST00000409532_chr2_173356251_+_RAPGEF4_ENST00000264111_chr2_173898642_+_3018nt
ATGGGGGTCACCGTCCAGAGCCAAGGTCCAGGGGGCAAGGTCGTGACATGTGCTCACCGATATGAAAAAAGGCAGCATGTTAATACGAAG
CAGGAATCCCGAGACATCTTTGGGCGGTGTTATGTCCTGAGTCAGAATCTCAGGATTGAAGACGATATGGATGGGGGAGATTGGAGCTTT
TGTGATGGGCGATTGAGAGGCCATGAGAAATTTGGCTCTTGCCAGCAAGGTGTAGCAGCTACTTTTACTAAAGACTTTCATTACATTGTA
TTTGGAGCCCCGGGTACTTATAACTGGAAAGGCCTGCTGTTTTTGACCAGCGTTTCCTATACAGATCCTGATCAGTTTGTTTATAAAACA
CGGCCTCCCCGGGAGCAGCCTGACACATTCCCTGATGTGATGATGAATAGCTACCTAGGTTTTTCTTTGGACTCAGGGAAAGGTATTGTT
TCTAAAGATGAGATCACTTTTGTATCTGGTGCTCCCAGAGCCAATCACAGTGGAGCCGTGGTTTTGCTGAAGAGAGACATGAAGTCTGCA
CATCTCCTCCCTGAGCACATATTCGATGGAGAAGGTCTGGCCTCTTCATTTGGCTATGATGTGGCGGTGGTGGACCTCAACAAGGATGGG
TGGCAAGATATAGTTATTGGAGCCCCACAGTATTTTGATAGAGATGGAGAAGTTGGAGGTGCAGTGTATGTCTACATGAACCAGCAAGGC
AGATGGAATAATGTGAAGCCAATTCGTCTTAATGGAACCAAAGATTCTATGTTTGGCATTGCAGTAAAAAATATTGGAGATATTAATCAA
GATGGCTACCCAGATATTGCAGTTGGAGCTCCGTATGATGACTTGGGAAAGGTTTTTATCTATCATGGATCTGCAAATGGAATAAATACC
AAACCAACACAGGTTCTCAAGGGTATATCACCTTATTTTGGATATTCAATTGCTGGAAACATGGACCTTGATCGAAATTCCTACCCTGAT
GTTGCTGTTGGTTCCCTCTCAGATTCAGTAACTATTTTCAGATCCCGGCCTGTGATTAATATTCAGAAAACCATCACAGTAACTCCTAAC
AGAATTGACCTCCGCCAGAAAACAGCGTGTGGGGCGCCTAGTGGGATATGCCTCCAGGTTAAATCCTGTTTTGAATATACTGCTAACCCC
GCTGGTTATAATCCTTCAATATCAATTGTGGGCACACTTGAAGCTGAAAAAGAAAGAAGAAAATCTGGGCTATCCTCAAGAGTTCAGTTT
CGAAACCAAGGTTCTGAGCCCAAATATACTCAAGAACTAACTCTGAAGAGGCAGAAACAGAAAGTGTGCATGGAGGAAACCCTGTGGCTA
CAGGATAATATCAGAGATAAACTGCGTCCCATTCCCATAACTGCCTCAGTGGAGATCCAAGAGCCAAGCTCTCGTAGGCGAGTGAATTCA
CTTCCAGAAGTTCTTCCAATTCTGAATTCAGATGAACCCAAGACAGCTCATATTGATGTTCACTTCTTAAAAGAGGGATGTGGAGACGAC
AATGTATGTAACAGCAACCTTAAACTAGAATATAAATTTTGCACCCGAGAAGGAAATCAAGACAAATTTTCTTATTTACCAATTCAAAAA
GGTGTACCAGAACTAGTTCTAAAAGATCAGAAGGATATTGCTTTAGAAATAACAGTGACAAACAGCCCTTCCAACCCAAGGAATCCCACA
AAAGATGGCGATGACGCCCATGAGGCTAAACTGATTGCAACGTTTCCAGACACTTTAACCTATTCTGCATATAGAGAACTGAGGGCTTTC
CCTGAGAAACAGTTGAGTTGTGTTGCCAACCAGAATGGCTCGCAAGCTGACTGTGAGCTCGGAAATCCTTTTAAAAGAAATTCAAATGTC
ACTTTTTATTTGGTTTTAAGTACAACTGAAGTCACCTTTGACACCCCAGATCTGGATATTAATCTGAAGTTAGAAACAACAAGCAATCAA
GATAATTTGGCTCCAATTACAGCTAAAGCAAAAGTGGTTATTGAACTGCTTTTATCGGTCTCGGGAGTTGCTAAACCTTCCCAGGTGTAT
TTTGGAGGTACAGTTGTTGGCGAGCAAGCTATGAAATCTGAAGATGAAGTGGGAAGTTTAATAGAGTATGAATTCAGGGTAATAAACTTA
GGTAAACCTCTTACAAACCTCGGCACAGCAACCTTGAACATTCAGTGGCCAAAAGAAATTAGCAATGGGAAATGGTTGCTTTATTTGGTG
AAAGTAGAATCCAAAGGATTGGAAAAGGTAACTTGTGAGCCACAAAAGGAGATAAACTCCCTGAACCTAACGGAGTCTCACAACTCAAGA
AAGAAACGGGAAATTACTGAAAAACAGATAGATGATAACAGAAAATTTTCTTTATTTGCTGAAAGAAAATACCAGACTCTTAACTGTAGC
GTGAACGTGAACTGTGTGAACATCAGATGCCCGCTGCGGGGGCTGGACAGCAAGGCGTCTCTTATTTTGCGCTCGAGGTTATGGAACAGC
ACATTTCTAGAGGAATATTCCAAACTGAACTACTTGGACATTCTCATGCGAGCCTTCATTGATGTGACTGCTGCTGCCGAAAATATCAGG
CTGCCAAATGCAGGCACTCAGAAACTGCCAAGCAAGTTCAAGAAGTTCTATGCGGAGTTTGAAAGTTTAATGGACCCTTCAAGGAACCAC
AGGGCCTACAGGCTGACAGTAGCTAAGCTGGAACCTCCTCTCATCCCCTTCATGCCTTTGCTCATTAAAGATATGACATTTACTCATGAG
GGGAACAAGACGTTCATTGACAATCTAGTAAACTTTGAAAAAATGCGCATGATTGCAAATACGGCCAGAACAGTGAGATACTACAGGAGC
CAACCCTTCAATCCTGATGCAGCTCAAGCTAATAAGAACCATCAGGATGTCCGGAGTTATGTACGGCAATTAAATGTGATTGACAACCAG

>In-frame_ITGA6_ENST00000409532_chr2_173356251_+_RAPGEF4_ENST00000397081_chr2_173898642_+_3018nt
ATGGGGGTCACCGTCCAGAGCCAAGGTCCAGGGGGCAAGGTCGTGACATGTGCTCACCGATATGAAAAAAGGCAGCATGTTAATACGAAG
CAGGAATCCCGAGACATCTTTGGGCGGTGTTATGTCCTGAGTCAGAATCTCAGGATTGAAGACGATATGGATGGGGGAGATTGGAGCTTT
TGTGATGGGCGATTGAGAGGCCATGAGAAATTTGGCTCTTGCCAGCAAGGTGTAGCAGCTACTTTTACTAAAGACTTTCATTACATTGTA
TTTGGAGCCCCGGGTACTTATAACTGGAAAGGCCTGCTGTTTTTGACCAGCGTTTCCTATACAGATCCTGATCAGTTTGTTTATAAAACA
CGGCCTCCCCGGGAGCAGCCTGACACATTCCCTGATGTGATGATGAATAGCTACCTAGGTTTTTCTTTGGACTCAGGGAAAGGTATTGTT
TCTAAAGATGAGATCACTTTTGTATCTGGTGCTCCCAGAGCCAATCACAGTGGAGCCGTGGTTTTGCTGAAGAGAGACATGAAGTCTGCA
CATCTCCTCCCTGAGCACATATTCGATGGAGAAGGTCTGGCCTCTTCATTTGGCTATGATGTGGCGGTGGTGGACCTCAACAAGGATGGG
TGGCAAGATATAGTTATTGGAGCCCCACAGTATTTTGATAGAGATGGAGAAGTTGGAGGTGCAGTGTATGTCTACATGAACCAGCAAGGC
AGATGGAATAATGTGAAGCCAATTCGTCTTAATGGAACCAAAGATTCTATGTTTGGCATTGCAGTAAAAAATATTGGAGATATTAATCAA
GATGGCTACCCAGATATTGCAGTTGGAGCTCCGTATGATGACTTGGGAAAGGTTTTTATCTATCATGGATCTGCAAATGGAATAAATACC
AAACCAACACAGGTTCTCAAGGGTATATCACCTTATTTTGGATATTCAATTGCTGGAAACATGGACCTTGATCGAAATTCCTACCCTGAT
GTTGCTGTTGGTTCCCTCTCAGATTCAGTAACTATTTTCAGATCCCGGCCTGTGATTAATATTCAGAAAACCATCACAGTAACTCCTAAC
AGAATTGACCTCCGCCAGAAAACAGCGTGTGGGGCGCCTAGTGGGATATGCCTCCAGGTTAAATCCTGTTTTGAATATACTGCTAACCCC
GCTGGTTATAATCCTTCAATATCAATTGTGGGCACACTTGAAGCTGAAAAAGAAAGAAGAAAATCTGGGCTATCCTCAAGAGTTCAGTTT
CGAAACCAAGGTTCTGAGCCCAAATATACTCAAGAACTAACTCTGAAGAGGCAGAAACAGAAAGTGTGCATGGAGGAAACCCTGTGGCTA
CAGGATAATATCAGAGATAAACTGCGTCCCATTCCCATAACTGCCTCAGTGGAGATCCAAGAGCCAAGCTCTCGTAGGCGAGTGAATTCA
CTTCCAGAAGTTCTTCCAATTCTGAATTCAGATGAACCCAAGACAGCTCATATTGATGTTCACTTCTTAAAAGAGGGATGTGGAGACGAC
AATGTATGTAACAGCAACCTTAAACTAGAATATAAATTTTGCACCCGAGAAGGAAATCAAGACAAATTTTCTTATTTACCAATTCAAAAA
GGTGTACCAGAACTAGTTCTAAAAGATCAGAAGGATATTGCTTTAGAAATAACAGTGACAAACAGCCCTTCCAACCCAAGGAATCCCACA
AAAGATGGCGATGACGCCCATGAGGCTAAACTGATTGCAACGTTTCCAGACACTTTAACCTATTCTGCATATAGAGAACTGAGGGCTTTC
CCTGAGAAACAGTTGAGTTGTGTTGCCAACCAGAATGGCTCGCAAGCTGACTGTGAGCTCGGAAATCCTTTTAAAAGAAATTCAAATGTC
ACTTTTTATTTGGTTTTAAGTACAACTGAAGTCACCTTTGACACCCCAGATCTGGATATTAATCTGAAGTTAGAAACAACAAGCAATCAA
GATAATTTGGCTCCAATTACAGCTAAAGCAAAAGTGGTTATTGAACTGCTTTTATCGGTCTCGGGAGTTGCTAAACCTTCCCAGGTGTAT
TTTGGAGGTACAGTTGTTGGCGAGCAAGCTATGAAATCTGAAGATGAAGTGGGAAGTTTAATAGAGTATGAATTCAGGGTAATAAACTTA
GGTAAACCTCTTACAAACCTCGGCACAGCAACCTTGAACATTCAGTGGCCAAAAGAAATTAGCAATGGGAAATGGTTGCTTTATTTGGTG
AAAGTAGAATCCAAAGGATTGGAAAAGGTAACTTGTGAGCCACAAAAGGAGATAAACTCCCTGAACCTAACGGAGTCTCACAACTCAAGA
AAGAAACGGGAAATTACTGAAAAACAGATAGATGATAACAGAAAATTTTCTTTATTTGCTGAAAGAAAATACCAGACTCTTAACTGTAGC
GTGAACGTGAACTGTGTGAACATCAGATGCCCGCTGCGGGGGCTGGACAGCAAGGCGTCTCTTATTTTGCGCTCGAGGTTATGGAACAGC
ACATTTCTAGAGGAATATTCCAAACTGAACTACTTGGACATTCTCATGCGAGCCTTCATTGATGTGACTGCTGCTGCCGAAAATATCAGG
CTGCCAAATGCAGGCACTCAGAAACTGCCAAGCAAGTTCAAGAAGTTCTATGCGGAGTTTGAAAGTTTAATGGACCCTTCAAGGAACCAC
AGGGCCTACAGGCTGACAGTAGCTAAGCTGGAACCTCCTCTCATCCCCTTCATGCCTTTGCTCATTAAAGATATGACATTTACTCATGAG
GGGAACAAGACGTTCATTGACAATCTAGTAAACTTTGAAAAAATGCGCATGATTGCAAATACGGCCAGAACAGTGAGATACTACAGGAGC
CAACCCTTCAATCCTGATGCAGCTCAAGCTAATAAGAACCATCAGGATGTCCGGAGTTATGTACGGCAATTAAATGTGATTGACAACCAG

>In-frame_ITGA6_ENST00000264107_chr2_173356251_+_RAPGEF4_ENST00000264111_chr2_173898642_+_3375nt
ATGGCCGCCGCCGGGCAGCTGTGCTTGCTCTACCTGTCGGCGGGGCTCCTGTCCCGGCTCGGCGCAGCCTTCAACTTGGACACTCGGGAG
GACAACGTGATCCGGAAATATGGAGACCCCGGGAGCCTCTTCGGCTTCTCGCTGGCCATGCACTGGCAACTGCAGCCCGAGGACAAGCGG
CTGTTGCTCGTGGGGGCCCCGCGGGCAGAAGCGCTTCCACTGCAGAGAGCCAACAGAACGGGAGGGCTGTACAGCTGCGACATCACCGCC
CGGGGGCCATGCACGCGGATCGAGTTTGATAACGATGCTGACCCCACGTCAGAAAGCAAGGAAGATCAGTGGATGGGGGTCACCGTCCAG
AGCCAAGGTCCAGGGGGCAAGGTCGTGACATGTGCTCACCGATATGAAAAAAGGCAGCATGTTAATACGAAGCAGGAATCCCGAGACATC
TTTGGGCGGTGTTATGTCCTGAGTCAGAATCTCAGGATTGAAGACGATATGGATGGGGGAGATTGGAGCTTTTGTGATGGGCGATTGAGA
GGCCATGAGAAATTTGGCTCTTGCCAGCAAGGTGTAGCAGCTACTTTTACTAAAGACTTTCATTACATTGTATTTGGAGCCCCGGGTACT
TATAACTGGAAAGGGATTGTTCGTGTAGAGCAAAAGAATAACACTTTTTTTGACATGAACATCTTTGAAGATGGGCCTTATGAAGTTGGT
GGAGAGACTGAGCATGATGAAAGTCTCGTTCCTGTTCCTGCTAACAGTTACTTAGGTTTTTCTTTGGACTCAGGGAAAGGTATTGTTTCT
AAAGATGAGATCACTTTTGTATCTGGTGCTCCCAGAGCCAATCACAGTGGAGCCGTGGTTTTGCTGAAGAGAGACATGAAGTCTGCACAT
CTCCTCCCTGAGCACATATTCGATGGAGAAGGTCTGGCCTCTTCATTTGGCTATGATGTGGCGGTGGTGGACCTCAACAAGGATGGGTGG
CAAGATATAGTTATTGGAGCCCCACAGTATTTTGATAGAGATGGAGAAGTTGGAGGTGCAGTGTATGTCTACATGAACCAGCAAGGCAGA
TGGAATAATGTGAAGCCAATTCGTCTTAATGGAACCAAAGATTCTATGTTTGGCATTGCAGTAAAAAATATTGGAGATATTAATCAAGAT
GGCTACCCAGATATTGCAGTTGGAGCTCCGTATGATGACTTGGGAAAGGTTTTTATCTATCATGGATCTGCAAATGGAATAAATACCAAA
CCAACACAGGTTCTCAAGGGTATATCACCTTATTTTGGATATTCAATTGCTGGAAACATGGACCTTGATCGAAATTCCTACCCTGATGTT
GCTGTTGGTTCCCTCTCAGATTCAGTAACTATTTTCAGATCCCGGCCTGTGATTAATATTCAGAAAACCATCACAGTAACTCCTAACAGA
ATTGACCTCCGCCAGAAAACAGCGTGTGGGGCGCCTAGTGGGATATGCCTCCAGGTTAAATCCTGTTTTGAATATACTGCTAACCCCGCT
GGTTATAATCCTTCAATATCAATTGTGGGCACACTTGAAGCTGAAAAAGAAAGAAGAAAATCTGGGCTATCCTCAAGAGTTCAGTTTCGA
AACCAAGGTTCTGAGCCCAAATATACTCAAGAACTAACTCTGAAGAGGCAGAAACAGAAAGTGTGCATGGAGGAAACCCTGTGGCTACAG
GATAATATCAGAGATAAACTGCGTCCCATTCCCATAACTGCCTCAGTGGAGATCCAAGAGCCAAGCTCTCGTAGGCGAGTGAATTCACTT
CCAGAAGTTCTTCCAATTCTGAATTCAGATGAACCCAAGACAGCTCATATTGATGTTCACTTCTTAAAAGAGGGATGTGGAGACGACAAT
GTATGTAACAGCAACCTTAAACTAGAATATAAATTTTGCACCCGAGAAGGAAATCAAGACAAATTTTCTTATTTACCAATTCAAAAAGGT
GTACCAGAACTAGTTCTAAAAGATCAGAAGGATATTGCTTTAGAAATAACAGTGACAAACAGCCCTTCCAACCCAAGGAATCCCACAAAA
GATGGCGATGACGCCCATGAGGCTAAACTGATTGCAACGTTTCCAGACACTTTAACCTATTCTGCATATAGAGAACTGAGGGCTTTCCCT
GAGAAACAGTTGAGTTGTGTTGCCAACCAGAATGGCTCGCAAGCTGACTGTGAGCTCGGAAATCCTTTTAAAAGAAATTCAAATGTCACT
TTTTATTTGGTTTTAAGTACAACTGAAGTCACCTTTGACACCCCAGATCTGGATATTAATCTGAAGTTAGAAACAACAAGCAATCAAGAT
AATTTGGCTCCAATTACAGCTAAAGCAAAAGTGGTTATTGAACTGCTTTTATCGGTCTCGGGAGTTGCTAAACCTTCCCAGGTGTATTTT
GGAGGTACAGTTGTTGGCGAGCAAGCTATGAAATCTGAAGATGAAGTGGGAAGTTTAATAGAGTATGAATTCAGGGTAATAAACTTAGGT
AAACCTCTTACAAACCTCGGCACAGCAACCTTGAACATTCAGTGGCCAAAAGAAATTAGCAATGGGAAATGGTTGCTTTATTTGGTGAAA
GTAGAATCCAAAGGATTGGAAAAGGTAACTTGTGAGCCACAAAAGGAGATAAACTCCCTGAACCTAACGGAGTCTCACAACTCAAGAAAG
AAACGGGAAATTACTGAAAAACAGATAGATGATAACAGAAAATTTTCTTTATTTGCTGAAAGAAAATACCAGACTCTTAACTGTAGCGTG
AACGTGAACTGTGTGAACATCAGATGCCCGCTGCGGGGGCTGGACAGCAAGGCGTCTCTTATTTTGCGCTCGAGGTTATGGAACAGCACA
TTTCTAGAGGAATATTCCAAACTGAACTACTTGGACATTCTCATGCGAGCCTTCATTGATGTGACTGCTGCTGCCGAAAATATCAGGCTG
CCAAATGCAGGCACTCAGAAACTGCCAAGCAAGTTCAAGAAGTTCTATGCGGAGTTTGAAAGTTTAATGGACCCTTCAAGGAACCACAGG
GCCTACAGGCTGACAGTAGCTAAGCTGGAACCTCCTCTCATCCCCTTCATGCCTTTGCTCATTAAAGATATGACATTTACTCATGAGGGG
AACAAGACGTTCATTGACAATCTAGTAAACTTTGAAAAAATGCGCATGATTGCAAATACGGCCAGAACAGTGAGATACTACAGGAGCCAA
CCCTTCAATCCTGATGCAGCTCAAGCTAATAAGAACCATCAGGATGTCCGGAGTTATGTACGGCAATTAAATGTGATTGACAACCAGAGA

>In-frame_ITGA6_ENST00000264107_chr2_173356251_+_RAPGEF4_ENST00000397081_chr2_173898642_+_3375nt
ATGGCCGCCGCCGGGCAGCTGTGCTTGCTCTACCTGTCGGCGGGGCTCCTGTCCCGGCTCGGCGCAGCCTTCAACTTGGACACTCGGGAG
GACAACGTGATCCGGAAATATGGAGACCCCGGGAGCCTCTTCGGCTTCTCGCTGGCCATGCACTGGCAACTGCAGCCCGAGGACAAGCGG
CTGTTGCTCGTGGGGGCCCCGCGGGCAGAAGCGCTTCCACTGCAGAGAGCCAACAGAACGGGAGGGCTGTACAGCTGCGACATCACCGCC
CGGGGGCCATGCACGCGGATCGAGTTTGATAACGATGCTGACCCCACGTCAGAAAGCAAGGAAGATCAGTGGATGGGGGTCACCGTCCAG
AGCCAAGGTCCAGGGGGCAAGGTCGTGACATGTGCTCACCGATATGAAAAAAGGCAGCATGTTAATACGAAGCAGGAATCCCGAGACATC
TTTGGGCGGTGTTATGTCCTGAGTCAGAATCTCAGGATTGAAGACGATATGGATGGGGGAGATTGGAGCTTTTGTGATGGGCGATTGAGA
GGCCATGAGAAATTTGGCTCTTGCCAGCAAGGTGTAGCAGCTACTTTTACTAAAGACTTTCATTACATTGTATTTGGAGCCCCGGGTACT
TATAACTGGAAAGGGATTGTTCGTGTAGAGCAAAAGAATAACACTTTTTTTGACATGAACATCTTTGAAGATGGGCCTTATGAAGTTGGT
GGAGAGACTGAGCATGATGAAAGTCTCGTTCCTGTTCCTGCTAACAGTTACTTAGGTTTTTCTTTGGACTCAGGGAAAGGTATTGTTTCT
AAAGATGAGATCACTTTTGTATCTGGTGCTCCCAGAGCCAATCACAGTGGAGCCGTGGTTTTGCTGAAGAGAGACATGAAGTCTGCACAT
CTCCTCCCTGAGCACATATTCGATGGAGAAGGTCTGGCCTCTTCATTTGGCTATGATGTGGCGGTGGTGGACCTCAACAAGGATGGGTGG
CAAGATATAGTTATTGGAGCCCCACAGTATTTTGATAGAGATGGAGAAGTTGGAGGTGCAGTGTATGTCTACATGAACCAGCAAGGCAGA
TGGAATAATGTGAAGCCAATTCGTCTTAATGGAACCAAAGATTCTATGTTTGGCATTGCAGTAAAAAATATTGGAGATATTAATCAAGAT
GGCTACCCAGATATTGCAGTTGGAGCTCCGTATGATGACTTGGGAAAGGTTTTTATCTATCATGGATCTGCAAATGGAATAAATACCAAA
CCAACACAGGTTCTCAAGGGTATATCACCTTATTTTGGATATTCAATTGCTGGAAACATGGACCTTGATCGAAATTCCTACCCTGATGTT
GCTGTTGGTTCCCTCTCAGATTCAGTAACTATTTTCAGATCCCGGCCTGTGATTAATATTCAGAAAACCATCACAGTAACTCCTAACAGA
ATTGACCTCCGCCAGAAAACAGCGTGTGGGGCGCCTAGTGGGATATGCCTCCAGGTTAAATCCTGTTTTGAATATACTGCTAACCCCGCT
GGTTATAATCCTTCAATATCAATTGTGGGCACACTTGAAGCTGAAAAAGAAAGAAGAAAATCTGGGCTATCCTCAAGAGTTCAGTTTCGA
AACCAAGGTTCTGAGCCCAAATATACTCAAGAACTAACTCTGAAGAGGCAGAAACAGAAAGTGTGCATGGAGGAAACCCTGTGGCTACAG
GATAATATCAGAGATAAACTGCGTCCCATTCCCATAACTGCCTCAGTGGAGATCCAAGAGCCAAGCTCTCGTAGGCGAGTGAATTCACTT
CCAGAAGTTCTTCCAATTCTGAATTCAGATGAACCCAAGACAGCTCATATTGATGTTCACTTCTTAAAAGAGGGATGTGGAGACGACAAT
GTATGTAACAGCAACCTTAAACTAGAATATAAATTTTGCACCCGAGAAGGAAATCAAGACAAATTTTCTTATTTACCAATTCAAAAAGGT
GTACCAGAACTAGTTCTAAAAGATCAGAAGGATATTGCTTTAGAAATAACAGTGACAAACAGCCCTTCCAACCCAAGGAATCCCACAAAA
GATGGCGATGACGCCCATGAGGCTAAACTGATTGCAACGTTTCCAGACACTTTAACCTATTCTGCATATAGAGAACTGAGGGCTTTCCCT
GAGAAACAGTTGAGTTGTGTTGCCAACCAGAATGGCTCGCAAGCTGACTGTGAGCTCGGAAATCCTTTTAAAAGAAATTCAAATGTCACT
TTTTATTTGGTTTTAAGTACAACTGAAGTCACCTTTGACACCCCAGATCTGGATATTAATCTGAAGTTAGAAACAACAAGCAATCAAGAT
AATTTGGCTCCAATTACAGCTAAAGCAAAAGTGGTTATTGAACTGCTTTTATCGGTCTCGGGAGTTGCTAAACCTTCCCAGGTGTATTTT
GGAGGTACAGTTGTTGGCGAGCAAGCTATGAAATCTGAAGATGAAGTGGGAAGTTTAATAGAGTATGAATTCAGGGTAATAAACTTAGGT
AAACCTCTTACAAACCTCGGCACAGCAACCTTGAACATTCAGTGGCCAAAAGAAATTAGCAATGGGAAATGGTTGCTTTATTTGGTGAAA
GTAGAATCCAAAGGATTGGAAAAGGTAACTTGTGAGCCACAAAAGGAGATAAACTCCCTGAACCTAACGGAGTCTCACAACTCAAGAAAG
AAACGGGAAATTACTGAAAAACAGATAGATGATAACAGAAAATTTTCTTTATTTGCTGAAAGAAAATACCAGACTCTTAACTGTAGCGTG
AACGTGAACTGTGTGAACATCAGATGCCCGCTGCGGGGGCTGGACAGCAAGGCGTCTCTTATTTTGCGCTCGAGGTTATGGAACAGCACA
TTTCTAGAGGAATATTCCAAACTGAACTACTTGGACATTCTCATGCGAGCCTTCATTGATGTGACTGCTGCTGCCGAAAATATCAGGCTG
CCAAATGCAGGCACTCAGAAACTGCCAAGCAAGTTCAAGAAGTTCTATGCGGAGTTTGAAAGTTTAATGGACCCTTCAAGGAACCACAGG
GCCTACAGGCTGACAGTAGCTAAGCTGGAACCTCCTCTCATCCCCTTCATGCCTTTGCTCATTAAAGATATGACATTTACTCATGAGGGG
AACAAGACGTTCATTGACAATCTAGTAAACTTTGAAAAAATGCGCATGATTGCAAATACGGCCAGAACAGTGAGATACTACAGGAGCCAA
CCCTTCAATCCTGATGCAGCTCAAGCTAATAAGAACCATCAGGATGTCCGGAGTTATGTACGGCAATTAAATGTGATTGACAACCAGAGA

>In-frame_ITGA6_ENST00000343713_chr2_173356251_+_RAPGEF4_ENST00000264111_chr2_173898642_+_3360nt
ATGGCCGCCGCCGGGCAGCTGTGCTTGCTCTACCTGTCGGCGGGGCTCCTGTCCCGGCTCGGCGCAGCCTTCAACTTGGACACTCGGGAG
GACAACGTGATCCGGAAATATGGAGACCCCGGGAGCCTCTTCGGCTTCTCGCTGGCCATGCACTGGCAACTGCAGCCCGAGGACAAGCGG
CTGTTGCTCGTGGGGGCCCCGCGGGCAGAAGCGCTTCCACTGCAGAGAGCCAACAGAACGGGAGGGCTGTACAGCTGCGACATCACCGCC
CGGGGGCCATGCACGCGGATCGAGTTTGATAACGATGCTGACCCCACGTCAGAAAGCAAGGAAGATCAGTGGATGGGGGTCACCGTCCAG
AGCCAAGGTCCAGGGGGCAAGGTCGTGACATGTGCTCACCGATATGAAAAAAGGCAGCATGTTAATACGAAGCAGGAATCCCGAGACATC
TTTGGGCGGTGTTATGTCCTGAGTCAGAATCTCAGGATTGAAGACGATATGGATGGGGGAGATTGGAGCTTTTGTGATGGGCGATTGAGA
GGCCATGAGAAATTTGGCTCTTGCCAGCAAGGTGTAGCAGCTACTTTTACTAAAGACTTTCATTACATTGTATTTGGAGCCCCGGGTACT
TATAACTGGAAAGGCCTGCTGTTTTTGACCAGCGTTTCCTATACAGATCCTGATCAGTTTGTTTATAAAACACGGCCTCCCCGGGAGCAG
CCTGACACATTCCCTGATGTGATGATGAATAGCTACCTAGGTTTTTCTTTGGACTCAGGGAAAGGTATTGTTTCTAAAGATGAGATCACT
TTTGTATCTGGTGCTCCCAGAGCCAATCACAGTGGAGCCGTGGTTTTGCTGAAGAGAGACATGAAGTCTGCACATCTCCTCCCTGAGCAC
ATATTCGATGGAGAAGGTCTGGCCTCTTCATTTGGCTATGATGTGGCGGTGGTGGACCTCAACAAGGATGGGTGGCAAGATATAGTTATT
GGAGCCCCACAGTATTTTGATAGAGATGGAGAAGTTGGAGGTGCAGTGTATGTCTACATGAACCAGCAAGGCAGATGGAATAATGTGAAG
CCAATTCGTCTTAATGGAACCAAAGATTCTATGTTTGGCATTGCAGTAAAAAATATTGGAGATATTAATCAAGATGGCTACCCAGATATT
GCAGTTGGAGCTCCGTATGATGACTTGGGAAAGGTTTTTATCTATCATGGATCTGCAAATGGAATAAATACCAAACCAACACAGGTTCTC
AAGGGTATATCACCTTATTTTGGATATTCAATTGCTGGAAACATGGACCTTGATCGAAATTCCTACCCTGATGTTGCTGTTGGTTCCCTC
TCAGATTCAGTAACTATTTTCAGATCCCGGCCTGTGATTAATATTCAGAAAACCATCACAGTAACTCCTAACAGAATTGACCTCCGCCAG
AAAACAGCGTGTGGGGCGCCTAGTGGGATATGCCTCCAGGTTAAATCCTGTTTTGAATATACTGCTAACCCCGCTGGTTATAATCCTTCA
ATATCAATTGTGGGCACACTTGAAGCTGAAAAAGAAAGAAGAAAATCTGGGCTATCCTCAAGAGTTCAGTTTCGAAACCAAGGTTCTGAG
CCCAAATATACTCAAGAACTAACTCTGAAGAGGCAGAAACAGAAAGTGTGCATGGAGGAAACCCTGTGGCTACAGGATAATATCAGAGAT
AAACTGCGTCCCATTCCCATAACTGCCTCAGTGGAGATCCAAGAGCCAAGCTCTCGTAGGCGAGTGAATTCACTTCCAGAAGTTCTTCCA
ATTCTGAATTCAGATGAACCCAAGACAGCTCATATTGATGTTCACTTCTTAAAAGAGGGATGTGGAGACGACAATGTATGTAACAGCAAC
CTTAAACTAGAATATAAATTTTGCACCCGAGAAGGAAATCAAGACAAATTTTCTTATTTACCAATTCAAAAAGGTGTACCAGAACTAGTT
CTAAAAGATCAGAAGGATATTGCTTTAGAAATAACAGTGACAAACAGCCCTTCCAACCCAAGGAATCCCACAAAAGATGGCGATGACGCC
CATGAGGCTAAACTGATTGCAACGTTTCCAGACACTTTAACCTATTCTGCATATAGAGAACTGAGGGCTTTCCCTGAGAAACAGTTGAGT
TGTGTTGCCAACCAGAATGGCTCGCAAGCTGACTGTGAGCTCGGAAATCCTTTTAAAAGAAATTCAAATGTCACTTTTTATTTGGTTTTA
AGTACAACTGAAGTCACCTTTGACACCCCAGATCTGGATATTAATCTGAAGTTAGAAACAACAAGCAATCAAGATAATTTGGCTCCAATT
ACAGCTAAAGCAAAAGTGGTTATTGAACTGCTTTTATCGGTCTCGGGAGTTGCTAAACCTTCCCAGGTGTATTTTGGAGGTACAGTTGTT
GGCGAGCAAGCTATGAAATCTGAAGATGAAGTGGGAAGTTTAATAGAGTATGAATTCAGGGTAATAAACTTAGGTAAACCTCTTACAAAC
CTCGGCACAGCAACCTTGAACATTCAGTGGCCAAAAGAAATTAGCAATGGGAAATGGTTGCTTTATTTGGTGAAAGTAGAATCCAAAGGA
TTGGAAAAGGTAACTTGTGAGCCACAAAAGGAGATAAACTCCCTGAACCTAACGGAGTCTCACAACTCAAGAAAGAAACGGGAAATTACT
GAAAAACAGATAGATGATAACAGAAAATTTTCTTTATTTGCTGAAAGAAAATACCAGACTCTTAACTGTAGCGTGAACGTGAACTGTGTG
AACATCAGATGCCCGCTGCGGGGGCTGGACAGCAAGGCGTCTCTTATTTTGCGCTCGAGGTTATGGAACAGCACATTTCTAGAGGAATAT
TCCAAACTGAACTACTTGGACATTCTCATGCGAGCCTTCATTGATGTGACTGCTGCTGCCGAAAATATCAGGCTGCCAAATGCAGGCACT
CAGAAACTGCCAAGCAAGTTCAAGAAGTTCTATGCGGAGTTTGAAAGTTTAATGGACCCTTCAAGGAACCACAGGGCCTACAGGCTGACA
GTAGCTAAGCTGGAACCTCCTCTCATCCCCTTCATGCCTTTGCTCATTAAAGATATGACATTTACTCATGAGGGGAACAAGACGTTCATT
GACAATCTAGTAAACTTTGAAAAAATGCGCATGATTGCAAATACGGCCAGAACAGTGAGATACTACAGGAGCCAACCCTTCAATCCTGAT
GCAGCTCAAGCTAATAAGAACCATCAGGATGTCCGGAGTTATGTACGGCAATTAAATGTGATTGACAACCAGAGAACTTTATCACAGATG

>In-frame_ITGA6_ENST00000343713_chr2_173356251_+_RAPGEF4_ENST00000397081_chr2_173898642_+_3360nt
ATGGCCGCCGCCGGGCAGCTGTGCTTGCTCTACCTGTCGGCGGGGCTCCTGTCCCGGCTCGGCGCAGCCTTCAACTTGGACACTCGGGAG
GACAACGTGATCCGGAAATATGGAGACCCCGGGAGCCTCTTCGGCTTCTCGCTGGCCATGCACTGGCAACTGCAGCCCGAGGACAAGCGG
CTGTTGCTCGTGGGGGCCCCGCGGGCAGAAGCGCTTCCACTGCAGAGAGCCAACAGAACGGGAGGGCTGTACAGCTGCGACATCACCGCC
CGGGGGCCATGCACGCGGATCGAGTTTGATAACGATGCTGACCCCACGTCAGAAAGCAAGGAAGATCAGTGGATGGGGGTCACCGTCCAG
AGCCAAGGTCCAGGGGGCAAGGTCGTGACATGTGCTCACCGATATGAAAAAAGGCAGCATGTTAATACGAAGCAGGAATCCCGAGACATC
TTTGGGCGGTGTTATGTCCTGAGTCAGAATCTCAGGATTGAAGACGATATGGATGGGGGAGATTGGAGCTTTTGTGATGGGCGATTGAGA
GGCCATGAGAAATTTGGCTCTTGCCAGCAAGGTGTAGCAGCTACTTTTACTAAAGACTTTCATTACATTGTATTTGGAGCCCCGGGTACT
TATAACTGGAAAGGCCTGCTGTTTTTGACCAGCGTTTCCTATACAGATCCTGATCAGTTTGTTTATAAAACACGGCCTCCCCGGGAGCAG
CCTGACACATTCCCTGATGTGATGATGAATAGCTACCTAGGTTTTTCTTTGGACTCAGGGAAAGGTATTGTTTCTAAAGATGAGATCACT
TTTGTATCTGGTGCTCCCAGAGCCAATCACAGTGGAGCCGTGGTTTTGCTGAAGAGAGACATGAAGTCTGCACATCTCCTCCCTGAGCAC
ATATTCGATGGAGAAGGTCTGGCCTCTTCATTTGGCTATGATGTGGCGGTGGTGGACCTCAACAAGGATGGGTGGCAAGATATAGTTATT
GGAGCCCCACAGTATTTTGATAGAGATGGAGAAGTTGGAGGTGCAGTGTATGTCTACATGAACCAGCAAGGCAGATGGAATAATGTGAAG
CCAATTCGTCTTAATGGAACCAAAGATTCTATGTTTGGCATTGCAGTAAAAAATATTGGAGATATTAATCAAGATGGCTACCCAGATATT
GCAGTTGGAGCTCCGTATGATGACTTGGGAAAGGTTTTTATCTATCATGGATCTGCAAATGGAATAAATACCAAACCAACACAGGTTCTC
AAGGGTATATCACCTTATTTTGGATATTCAATTGCTGGAAACATGGACCTTGATCGAAATTCCTACCCTGATGTTGCTGTTGGTTCCCTC
TCAGATTCAGTAACTATTTTCAGATCCCGGCCTGTGATTAATATTCAGAAAACCATCACAGTAACTCCTAACAGAATTGACCTCCGCCAG
AAAACAGCGTGTGGGGCGCCTAGTGGGATATGCCTCCAGGTTAAATCCTGTTTTGAATATACTGCTAACCCCGCTGGTTATAATCCTTCA
ATATCAATTGTGGGCACACTTGAAGCTGAAAAAGAAAGAAGAAAATCTGGGCTATCCTCAAGAGTTCAGTTTCGAAACCAAGGTTCTGAG
CCCAAATATACTCAAGAACTAACTCTGAAGAGGCAGAAACAGAAAGTGTGCATGGAGGAAACCCTGTGGCTACAGGATAATATCAGAGAT
AAACTGCGTCCCATTCCCATAACTGCCTCAGTGGAGATCCAAGAGCCAAGCTCTCGTAGGCGAGTGAATTCACTTCCAGAAGTTCTTCCA
ATTCTGAATTCAGATGAACCCAAGACAGCTCATATTGATGTTCACTTCTTAAAAGAGGGATGTGGAGACGACAATGTATGTAACAGCAAC
CTTAAACTAGAATATAAATTTTGCACCCGAGAAGGAAATCAAGACAAATTTTCTTATTTACCAATTCAAAAAGGTGTACCAGAACTAGTT
CTAAAAGATCAGAAGGATATTGCTTTAGAAATAACAGTGACAAACAGCCCTTCCAACCCAAGGAATCCCACAAAAGATGGCGATGACGCC
CATGAGGCTAAACTGATTGCAACGTTTCCAGACACTTTAACCTATTCTGCATATAGAGAACTGAGGGCTTTCCCTGAGAAACAGTTGAGT
TGTGTTGCCAACCAGAATGGCTCGCAAGCTGACTGTGAGCTCGGAAATCCTTTTAAAAGAAATTCAAATGTCACTTTTTATTTGGTTTTA
AGTACAACTGAAGTCACCTTTGACACCCCAGATCTGGATATTAATCTGAAGTTAGAAACAACAAGCAATCAAGATAATTTGGCTCCAATT
ACAGCTAAAGCAAAAGTGGTTATTGAACTGCTTTTATCGGTCTCGGGAGTTGCTAAACCTTCCCAGGTGTATTTTGGAGGTACAGTTGTT
GGCGAGCAAGCTATGAAATCTGAAGATGAAGTGGGAAGTTTAATAGAGTATGAATTCAGGGTAATAAACTTAGGTAAACCTCTTACAAAC
CTCGGCACAGCAACCTTGAACATTCAGTGGCCAAAAGAAATTAGCAATGGGAAATGGTTGCTTTATTTGGTGAAAGTAGAATCCAAAGGA
TTGGAAAAGGTAACTTGTGAGCCACAAAAGGAGATAAACTCCCTGAACCTAACGGAGTCTCACAACTCAAGAAAGAAACGGGAAATTACT
GAAAAACAGATAGATGATAACAGAAAATTTTCTTTATTTGCTGAAAGAAAATACCAGACTCTTAACTGTAGCGTGAACGTGAACTGTGTG
AACATCAGATGCCCGCTGCGGGGGCTGGACAGCAAGGCGTCTCTTATTTTGCGCTCGAGGTTATGGAACAGCACATTTCTAGAGGAATAT
TCCAAACTGAACTACTTGGACATTCTCATGCGAGCCTTCATTGATGTGACTGCTGCTGCCGAAAATATCAGGCTGCCAAATGCAGGCACT
CAGAAACTGCCAAGCAAGTTCAAGAAGTTCTATGCGGAGTTTGAAAGTTTAATGGACCCTTCAAGGAACCACAGGGCCTACAGGCTGACA
GTAGCTAAGCTGGAACCTCCTCTCATCCCCTTCATGCCTTTGCTCATTAAAGATATGACATTTACTCATGAGGGGAACAAGACGTTCATT
GACAATCTAGTAAACTTTGAAAAAATGCGCATGATTGCAAATACGGCCAGAACAGTGAGATACTACAGGAGCCAACCCTTCAATCCTGAT
GCAGCTCAAGCTAATAAGAACCATCAGGATGTCCGGAGTTATGTACGGCAATTAAATGTGATTGACAACCAGAGAACTTTATCACAGATG

>In-frame_ITGA6_ENST00000264106_chr2_173356251_+_RAPGEF4_ENST00000264111_chr2_173898642_+_3492nt
ATGGCCGCCGCCGGGCAGCTGTGCTTGCTCTACCTGTCGGCGGGGCTCCTGTCCCGGCTCGGCGCAGCCTTCAACTTGGACACTCGGGAG
GACAACGTGATCCGGAAATATGGAGACCCCGGGAGCCTCTTCGGCTTCTCGCTGGCCATGCACTGGCAACTGCAGCCCGAGGACAAGCGG
CTGTTGCTCGTGGGGGCCCCGCGGGCAGAAGCGCTTCCACTGCAGAGAGCCAACAGAACGGGAGGGCTGTACAGCTGCGACATCACCGCC
CGGGGGCCATGCACGCGGATCGAGTTTGATAACGATGCTGACCCCACGTCAGAAAGCAAGGAAGATCAGTGGATGGGGGTCACCGTCCAG
AGCCAAGGTCCAGGGGGCAAGGTCGTGACATGTGCTCACCGATATGAAAAAAGGCAGCATGTTAATACGAAGCAGGAATCCCGAGACATC
TTTGGGCGGTGTTATGTCCTGAGTCAGAATCTCAGGATTGAAGACGATATGGATGGGGGAGATTGGAGCTTTTGTGATGGGCGATTGAGA
GGCCATGAGAAATTTGGCTCTTGCCAGCAAGGTGTAGCAGCTACTTTTACTAAAGACTTTCATTACATTGTATTTGGAGCCCCGGGTACT
TATAACTGGAAAGGGATTGTTCGTGTAGAGCAAAAGAATAACACTTTTTTTGACATGAACATCTTTGAAGATGGGCCTTATGAAGTTGGT
GGAGAGACTGAGCATGATGAAAGTCTCGTTCCTGTTCCTGCTAACAGTTACTTAGGCCTGCTGTTTTTGACCAGCGTTTCCTATACAGAT
CCTGATCAGTTTGTTTATAAAACACGGCCTCCCCGGGAGCAGCCTGACACATTCCCTGATGTGATGATGAATAGCTACCTAGGTTTTTCT
TTGGACTCAGGGAAAGGTATTGTTTCTAAAGATGAGATCACTTTTGTATCTGGTGCTCCCAGAGCCAATCACAGTGGAGCCGTGGTTTTG
CTGAAGAGAGACATGAAGTCTGCACATCTCCTCCCTGAGCACATATTCGATGGAGAAGGTCTGGCCTCTTCATTTGGCTATGATGTGGCG
GTGGTGGACCTCAACAAGGATGGGTGGCAAGATATAGTTATTGGAGCCCCACAGTATTTTGATAGAGATGGAGAAGTTGGAGGTGCAGTG
TATGTCTACATGAACCAGCAAGGCAGATGGAATAATGTGAAGCCAATTCGTCTTAATGGAACCAAAGATTCTATGTTTGGCATTGCAGTA
AAAAATATTGGAGATATTAATCAAGATGGCTACCCAGATATTGCAGTTGGAGCTCCGTATGATGACTTGGGAAAGGTTTTTATCTATCAT
GGATCTGCAAATGGAATAAATACCAAACCAACACAGGTTCTCAAGGGTATATCACCTTATTTTGGATATTCAATTGCTGGAAACATGGAC
CTTGATCGAAATTCCTACCCTGATGTTGCTGTTGGTTCCCTCTCAGATTCAGTAACTATTTTCAGATCCCGGCCTGTGATTAATATTCAG
AAAACCATCACAGTAACTCCTAACAGAATTGACCTCCGCCAGAAAACAGCGTGTGGGGCGCCTAGTGGGATATGCCTCCAGGTTAAATCC
TGTTTTGAATATACTGCTAACCCCGCTGGTTATAATCCTTCAATATCAATTGTGGGCACACTTGAAGCTGAAAAAGAAAGAAGAAAATCT
GGGCTATCCTCAAGAGTTCAGTTTCGAAACCAAGGTTCTGAGCCCAAATATACTCAAGAACTAACTCTGAAGAGGCAGAAACAGAAAGTG
TGCATGGAGGAAACCCTGTGGCTACAGGATAATATCAGAGATAAACTGCGTCCCATTCCCATAACTGCCTCAGTGGAGATCCAAGAGCCA
AGCTCTCGTAGGCGAGTGAATTCACTTCCAGAAGTTCTTCCAATTCTGAATTCAGATGAACCCAAGACAGCTCATATTGATGTTCACTTC
TTAAAAGAGGGATGTGGAGACGACAATGTATGTAACAGCAACCTTAAACTAGAATATAAATTTTGCACCCGAGAAGGAAATCAAGACAAA
TTTTCTTATTTACCAATTCAAAAAGGTGTACCAGAACTAGTTCTAAAAGATCAGAAGGATATTGCTTTAGAAATAACAGTGACAAACAGC
CCTTCCAACCCAAGGAATCCCACAAAAGATGGCGATGACGCCCATGAGGCTAAACTGATTGCAACGTTTCCAGACACTTTAACCTATTCT
GCATATAGAGAACTGAGGGCTTTCCCTGAGAAACAGTTGAGTTGTGTTGCCAACCAGAATGGCTCGCAAGCTGACTGTGAGCTCGGAAAT
CCTTTTAAAAGAAATTCAAATGTCACTTTTTATTTGGTTTTAAGTACAACTGAAGTCACCTTTGACACCCCAGATCTGGATATTAATCTG
AAGTTAGAAACAACAAGCAATCAAGATAATTTGGCTCCAATTACAGCTAAAGCAAAAGTGGTTATTGAACTGCTTTTATCGGTCTCGGGA
GTTGCTAAACCTTCCCAGGTGTATTTTGGAGGTACAGTTGTTGGCGAGCAAGCTATGAAATCTGAAGATGAAGTGGGAAGTTTAATAGAG
TATGAATTCAGGGTAATAAACTTAGGTAAACCTCTTACAAACCTCGGCACAGCAACCTTGAACATTCAGTGGCCAAAAGAAATTAGCAAT
GGGAAATGGTTGCTTTATTTGGTGAAAGTAGAATCCAAAGGATTGGAAAAGGTAACTTGTGAGCCACAAAAGGAGATAAACTCCCTGAAC
CTAACGGAGTCTCACAACTCAAGAAAGAAACGGGAAATTACTGAAAAACAGATAGATGATAACAGAAAATTTTCTTTATTTGCTGAAAGA
AAATACCAGACTCTTAACTGTAGCGTGAACGTGAACTGTGTGAACATCAGATGCCCGCTGCGGGGGCTGGACAGCAAGGCGTCTCTTATT
TTGCGCTCGAGGTTATGGAACAGCACATTTCTAGAGGAATATTCCAAACTGAACTACTTGGACATTCTCATGCGAGCCTTCATTGATGTG
ACTGCTGCTGCCGAAAATATCAGGCTGCCAAATGCAGGCACTCAGAAACTGCCAAGCAAGTTCAAGAAGTTCTATGCGGAGTTTGAAAGT
TTAATGGACCCTTCAAGGAACCACAGGGCCTACAGGCTGACAGTAGCTAAGCTGGAACCTCCTCTCATCCCCTTCATGCCTTTGCTCATT
AAAGATATGACATTTACTCATGAGGGGAACAAGACGTTCATTGACAATCTAGTAAACTTTGAAAAAATGCGCATGATTGCAAATACGGCC
AGAACAGTGAGATACTACAGGAGCCAACCCTTCAATCCTGATGCAGCTCAAGCTAATAAGAACCATCAGGATGTCCGGAGTTATGTACGG

>In-frame_ITGA6_ENST00000264106_chr2_173356251_+_RAPGEF4_ENST00000397081_chr2_173898642_+_3492nt
ATGGCCGCCGCCGGGCAGCTGTGCTTGCTCTACCTGTCGGCGGGGCTCCTGTCCCGGCTCGGCGCAGCCTTCAACTTGGACACTCGGGAG
GACAACGTGATCCGGAAATATGGAGACCCCGGGAGCCTCTTCGGCTTCTCGCTGGCCATGCACTGGCAACTGCAGCCCGAGGACAAGCGG
CTGTTGCTCGTGGGGGCCCCGCGGGCAGAAGCGCTTCCACTGCAGAGAGCCAACAGAACGGGAGGGCTGTACAGCTGCGACATCACCGCC
CGGGGGCCATGCACGCGGATCGAGTTTGATAACGATGCTGACCCCACGTCAGAAAGCAAGGAAGATCAGTGGATGGGGGTCACCGTCCAG
AGCCAAGGTCCAGGGGGCAAGGTCGTGACATGTGCTCACCGATATGAAAAAAGGCAGCATGTTAATACGAAGCAGGAATCCCGAGACATC
TTTGGGCGGTGTTATGTCCTGAGTCAGAATCTCAGGATTGAAGACGATATGGATGGGGGAGATTGGAGCTTTTGTGATGGGCGATTGAGA
GGCCATGAGAAATTTGGCTCTTGCCAGCAAGGTGTAGCAGCTACTTTTACTAAAGACTTTCATTACATTGTATTTGGAGCCCCGGGTACT
TATAACTGGAAAGGGATTGTTCGTGTAGAGCAAAAGAATAACACTTTTTTTGACATGAACATCTTTGAAGATGGGCCTTATGAAGTTGGT
GGAGAGACTGAGCATGATGAAAGTCTCGTTCCTGTTCCTGCTAACAGTTACTTAGGCCTGCTGTTTTTGACCAGCGTTTCCTATACAGAT
CCTGATCAGTTTGTTTATAAAACACGGCCTCCCCGGGAGCAGCCTGACACATTCCCTGATGTGATGATGAATAGCTACCTAGGTTTTTCT
TTGGACTCAGGGAAAGGTATTGTTTCTAAAGATGAGATCACTTTTGTATCTGGTGCTCCCAGAGCCAATCACAGTGGAGCCGTGGTTTTG
CTGAAGAGAGACATGAAGTCTGCACATCTCCTCCCTGAGCACATATTCGATGGAGAAGGTCTGGCCTCTTCATTTGGCTATGATGTGGCG
GTGGTGGACCTCAACAAGGATGGGTGGCAAGATATAGTTATTGGAGCCCCACAGTATTTTGATAGAGATGGAGAAGTTGGAGGTGCAGTG
TATGTCTACATGAACCAGCAAGGCAGATGGAATAATGTGAAGCCAATTCGTCTTAATGGAACCAAAGATTCTATGTTTGGCATTGCAGTA
AAAAATATTGGAGATATTAATCAAGATGGCTACCCAGATATTGCAGTTGGAGCTCCGTATGATGACTTGGGAAAGGTTTTTATCTATCAT
GGATCTGCAAATGGAATAAATACCAAACCAACACAGGTTCTCAAGGGTATATCACCTTATTTTGGATATTCAATTGCTGGAAACATGGAC
CTTGATCGAAATTCCTACCCTGATGTTGCTGTTGGTTCCCTCTCAGATTCAGTAACTATTTTCAGATCCCGGCCTGTGATTAATATTCAG
AAAACCATCACAGTAACTCCTAACAGAATTGACCTCCGCCAGAAAACAGCGTGTGGGGCGCCTAGTGGGATATGCCTCCAGGTTAAATCC
TGTTTTGAATATACTGCTAACCCCGCTGGTTATAATCCTTCAATATCAATTGTGGGCACACTTGAAGCTGAAAAAGAAAGAAGAAAATCT
GGGCTATCCTCAAGAGTTCAGTTTCGAAACCAAGGTTCTGAGCCCAAATATACTCAAGAACTAACTCTGAAGAGGCAGAAACAGAAAGTG
TGCATGGAGGAAACCCTGTGGCTACAGGATAATATCAGAGATAAACTGCGTCCCATTCCCATAACTGCCTCAGTGGAGATCCAAGAGCCA
AGCTCTCGTAGGCGAGTGAATTCACTTCCAGAAGTTCTTCCAATTCTGAATTCAGATGAACCCAAGACAGCTCATATTGATGTTCACTTC
TTAAAAGAGGGATGTGGAGACGACAATGTATGTAACAGCAACCTTAAACTAGAATATAAATTTTGCACCCGAGAAGGAAATCAAGACAAA
TTTTCTTATTTACCAATTCAAAAAGGTGTACCAGAACTAGTTCTAAAAGATCAGAAGGATATTGCTTTAGAAATAACAGTGACAAACAGC
CCTTCCAACCCAAGGAATCCCACAAAAGATGGCGATGACGCCCATGAGGCTAAACTGATTGCAACGTTTCCAGACACTTTAACCTATTCT
GCATATAGAGAACTGAGGGCTTTCCCTGAGAAACAGTTGAGTTGTGTTGCCAACCAGAATGGCTCGCAAGCTGACTGTGAGCTCGGAAAT
CCTTTTAAAAGAAATTCAAATGTCACTTTTTATTTGGTTTTAAGTACAACTGAAGTCACCTTTGACACCCCAGATCTGGATATTAATCTG
AAGTTAGAAACAACAAGCAATCAAGATAATTTGGCTCCAATTACAGCTAAAGCAAAAGTGGTTATTGAACTGCTTTTATCGGTCTCGGGA
GTTGCTAAACCTTCCCAGGTGTATTTTGGAGGTACAGTTGTTGGCGAGCAAGCTATGAAATCTGAAGATGAAGTGGGAAGTTTAATAGAG
TATGAATTCAGGGTAATAAACTTAGGTAAACCTCTTACAAACCTCGGCACAGCAACCTTGAACATTCAGTGGCCAAAAGAAATTAGCAAT
GGGAAATGGTTGCTTTATTTGGTGAAAGTAGAATCCAAAGGATTGGAAAAGGTAACTTGTGAGCCACAAAAGGAGATAAACTCCCTGAAC
CTAACGGAGTCTCACAACTCAAGAAAGAAACGGGAAATTACTGAAAAACAGATAGATGATAACAGAAAATTTTCTTTATTTGCTGAAAGA
AAATACCAGACTCTTAACTGTAGCGTGAACGTGAACTGTGTGAACATCAGATGCCCGCTGCGGGGGCTGGACAGCAAGGCGTCTCTTATT
TTGCGCTCGAGGTTATGGAACAGCACATTTCTAGAGGAATATTCCAAACTGAACTACTTGGACATTCTCATGCGAGCCTTCATTGATGTG
ACTGCTGCTGCCGAAAATATCAGGCTGCCAAATGCAGGCACTCAGAAACTGCCAAGCAAGTTCAAGAAGTTCTATGCGGAGTTTGAAAGT
TTAATGGACCCTTCAAGGAACCACAGGGCCTACAGGCTGACAGTAGCTAAGCTGGAACCTCCTCTCATCCCCTTCATGCCTTTGCTCATT
AAAGATATGACATTTACTCATGAGGGGAACAAGACGTTCATTGACAATCTAGTAAACTTTGAAAAAATGCGCATGATTGCAAATACGGCC
AGAACAGTGAGATACTACAGGAGCCAACCCTTCAATCCTGATGCAGCTCAAGCTAATAAGAACCATCAGGATGTCCGGAGTTATGTACGG

>In-frame_ITGA6_ENST00000375221_chr2_173356251_+_RAPGEF4_ENST00000264111_chr2_173898642_+_3492nt
ATGGCCGCCGCCGGGCAGCTGTGCTTGCTCTACCTGTCGGCGGGGCTCCTGTCCCGGCTCGGCGCAGCCTTCAACTTGGACACTCGGGAG
GACAACGTGATCCGGAAATATGGAGACCCCGGGAGCCTCTTCGGCTTCTCGCTGGCCATGCACTGGCAACTGCAGCCCGAGGACAAGCGG
CTGTTGCTCGTGGGGGCCCCGCGGGCAGAAGCGCTTCCACTGCAGAGAGCCAACAGAACGGGAGGGCTGTACAGCTGCGACATCACCGCC
CGGGGGCCATGCACGCGGATCGAGTTTGATAACGATGCTGACCCCACGTCAGAAAGCAAGGAAGATCAGTGGATGGGGGTCACCGTCCAG
AGCCAAGGTCCAGGGGGCAAGGTCGTGACATGTGCTCACCGATATGAAAAAAGGCAGCATGTTAATACGAAGCAGGAATCCCGAGACATC
TTTGGGCGGTGTTATGTCCTGAGTCAGAATCTCAGGATTGAAGACGATATGGATGGGGGAGATTGGAGCTTTTGTGATGGGCGATTGAGA
GGCCATGAGAAATTTGGCTCTTGCCAGCAAGGTGTAGCAGCTACTTTTACTAAAGACTTTCATTACATTGTATTTGGAGCCCCGGGTACT
TATAACTGGAAAGGGATTGTTCGTGTAGAGCAAAAGAATAACACTTTTTTTGACATGAACATCTTTGAAGATGGGCCTTATGAAGTTGGT
GGAGAGACTGAGCATGATGAAAGTCTCGTTCCTGTTCCTGCTAACAGTTACTTAGGCCTGCTGTTTTTGACCAGCGTTTCCTATACAGAT
CCTGATCAGTTTGTTTATAAAACACGGCCTCCCCGGGAGCAGCCTGACACATTCCCTGATGTGATGATGAATAGCTACCTAGGTTTTTCT
TTGGACTCAGGGAAAGGTATTGTTTCTAAAGATGAGATCACTTTTGTATCTGGTGCTCCCAGAGCCAATCACAGTGGAGCCGTGGTTTTG
CTGAAGAGAGACATGAAGTCTGCACATCTCCTCCCTGAGCACATATTCGATGGAGAAGGTCTGGCCTCTTCATTTGGCTATGATGTGGCG
GTGGTGGACCTCAACAAGGATGGGTGGCAAGATATAGTTATTGGAGCCCCACAGTATTTTGATAGAGATGGAGAAGTTGGAGGTGCAGTG
TATGTCTACATGAACCAGCAAGGCAGATGGAATAATGTGAAGCCAATTCGTCTTAATGGAACCAAAGATTCTATGTTTGGCATTGCAGTA
AAAAATATTGGAGATATTAATCAAGATGGCTACCCAGATATTGCAGTTGGAGCTCCGTATGATGACTTGGGAAAGGTTTTTATCTATCAT
GGATCTGCAAATGGAATAAATACCAAACCAACACAGGTTCTCAAGGGTATATCACCTTATTTTGGATATTCAATTGCTGGAAACATGGAC
CTTGATCGAAATTCCTACCCTGATGTTGCTGTTGGTTCCCTCTCAGATTCAGTAACTATTTTCAGATCCCGGCCTGTGATTAATATTCAG
AAAACCATCACAGTAACTCCTAACAGAATTGACCTCCGCCAGAAAACAGCGTGTGGGGCGCCTAGTGGGATATGCCTCCAGGTTAAATCC
TGTTTTGAATATACTGCTAACCCCGCTGGTTATAATCCTTCAATATCAATTGTGGGCACACTTGAAGCTGAAAAAGAAAGAAGAAAATCT
GGGCTATCCTCAAGAGTTCAGTTTCGAAACCAAGGTTCTGAGCCCAAATATACTCAAGAACTAACTCTGAAGAGGCAGAAACAGAAAGTG
TGCATGGAGGAAACCCTGTGGCTACAGGATAATATCAGAGATAAACTGCGTCCCATTCCCATAACTGCCTCAGTGGAGATCCAAGAGCCA
AGCTCTCGTAGGCGAGTGAATTCACTTCCAGAAGTTCTTCCAATTCTGAATTCAGATGAACCCAAGACAGCTCATATTGATGTTCACTTC
TTAAAAGAGGGATGTGGAGACGACAATGTATGTAACAGCAACCTTAAACTAGAATATAAATTTTGCACCCGAGAAGGAAATCAAGACAAA
TTTTCTTATTTACCAATTCAAAAAGGTGTACCAGAACTAGTTCTAAAAGATCAGAAGGATATTGCTTTAGAAATAACAGTGACAAACAGC
CCTTCCAACCCAAGGAATCCCACAAAAGATGGCGATGACGCCCATGAGGCTAAACTGATTGCAACGTTTCCAGACACTTTAACCTATTCT
GCATATAGAGAACTGAGGGCTTTCCCTGAGAAACAGTTGAGTTGTGTTGCCAACCAGAATGGCTCGCAAGCTGACTGTGAGCTCGGAAAT
CCTTTTAAAAGAAATTCAAATGTCACTTTTTATTTGGTTTTAAGTACAACTGAAGTCACCTTTGACACCCCAGATCTGGATATTAATCTG
AAGTTAGAAACAACAAGCAATCAAGATAATTTGGCTCCAATTACAGCTAAAGCAAAAGTGGTTATTGAACTGCTTTTATCGGTCTCGGGA
GTTGCTAAACCTTCCCAGGTGTATTTTGGAGGTACAGTTGTTGGCGAGCAAGCTATGAAATCTGAAGATGAAGTGGGAAGTTTAATAGAG
TATGAATTCAGGGTAATAAACTTAGGTAAACCTCTTACAAACCTCGGCACAGCAACCTTGAACATTCAGTGGCCAAAAGAAATTAGCAAT
GGGAAATGGTTGCTTTATTTGGTGAAAGTAGAATCCAAAGGATTGGAAAAGGTAACTTGTGAGCCACAAAAGGAGATAAACTCCCTGAAC
CTAACGGAGTCTCACAACTCAAGAAAGAAACGGGAAATTACTGAAAAACAGATAGATGATAACAGAAAATTTTCTTTATTTGCTGAAAGA
AAATACCAGACTCTTAACTGTAGCGTGAACGTGAACTGTGTGAACATCAGATGCCCGCTGCGGGGGCTGGACAGCAAGGCGTCTCTTATT
TTGCGCTCGAGGTTATGGAACAGCACATTTCTAGAGGAATATTCCAAACTGAACTACTTGGACATTCTCATGCGAGCCTTCATTGATGTG
ACTGCTGCTGCCGAAAATATCAGGCTGCCAAATGCAGGCACTCAGAAACTGCCAAGCAAGTTCAAGAAGTTCTATGCGGAGTTTGAAAGT
TTAATGGACCCTTCAAGGAACCACAGGGCCTACAGGCTGACAGTAGCTAAGCTGGAACCTCCTCTCATCCCCTTCATGCCTTTGCTCATT
AAAGATATGACATTTACTCATGAGGGGAACAAGACGTTCATTGACAATCTAGTAAACTTTGAAAAAATGCGCATGATTGCAAATACGGCC
AGAACAGTGAGATACTACAGGAGCCAACCCTTCAATCCTGATGCAGCTCAAGCTAATAAGAACCATCAGGATGTCCGGAGTTATGTACGG

>In-frame_ITGA6_ENST00000375221_chr2_173356251_+_RAPGEF4_ENST00000397081_chr2_173898642_+_3492nt
ATGGCCGCCGCCGGGCAGCTGTGCTTGCTCTACCTGTCGGCGGGGCTCCTGTCCCGGCTCGGCGCAGCCTTCAACTTGGACACTCGGGAG
GACAACGTGATCCGGAAATATGGAGACCCCGGGAGCCTCTTCGGCTTCTCGCTGGCCATGCACTGGCAACTGCAGCCCGAGGACAAGCGG
CTGTTGCTCGTGGGGGCCCCGCGGGCAGAAGCGCTTCCACTGCAGAGAGCCAACAGAACGGGAGGGCTGTACAGCTGCGACATCACCGCC
CGGGGGCCATGCACGCGGATCGAGTTTGATAACGATGCTGACCCCACGTCAGAAAGCAAGGAAGATCAGTGGATGGGGGTCACCGTCCAG
AGCCAAGGTCCAGGGGGCAAGGTCGTGACATGTGCTCACCGATATGAAAAAAGGCAGCATGTTAATACGAAGCAGGAATCCCGAGACATC
TTTGGGCGGTGTTATGTCCTGAGTCAGAATCTCAGGATTGAAGACGATATGGATGGGGGAGATTGGAGCTTTTGTGATGGGCGATTGAGA
GGCCATGAGAAATTTGGCTCTTGCCAGCAAGGTGTAGCAGCTACTTTTACTAAAGACTTTCATTACATTGTATTTGGAGCCCCGGGTACT
TATAACTGGAAAGGGATTGTTCGTGTAGAGCAAAAGAATAACACTTTTTTTGACATGAACATCTTTGAAGATGGGCCTTATGAAGTTGGT
GGAGAGACTGAGCATGATGAAAGTCTCGTTCCTGTTCCTGCTAACAGTTACTTAGGCCTGCTGTTTTTGACCAGCGTTTCCTATACAGAT
CCTGATCAGTTTGTTTATAAAACACGGCCTCCCCGGGAGCAGCCTGACACATTCCCTGATGTGATGATGAATAGCTACCTAGGTTTTTCT
TTGGACTCAGGGAAAGGTATTGTTTCTAAAGATGAGATCACTTTTGTATCTGGTGCTCCCAGAGCCAATCACAGTGGAGCCGTGGTTTTG
CTGAAGAGAGACATGAAGTCTGCACATCTCCTCCCTGAGCACATATTCGATGGAGAAGGTCTGGCCTCTTCATTTGGCTATGATGTGGCG
GTGGTGGACCTCAACAAGGATGGGTGGCAAGATATAGTTATTGGAGCCCCACAGTATTTTGATAGAGATGGAGAAGTTGGAGGTGCAGTG
TATGTCTACATGAACCAGCAAGGCAGATGGAATAATGTGAAGCCAATTCGTCTTAATGGAACCAAAGATTCTATGTTTGGCATTGCAGTA
AAAAATATTGGAGATATTAATCAAGATGGCTACCCAGATATTGCAGTTGGAGCTCCGTATGATGACTTGGGAAAGGTTTTTATCTATCAT
GGATCTGCAAATGGAATAAATACCAAACCAACACAGGTTCTCAAGGGTATATCACCTTATTTTGGATATTCAATTGCTGGAAACATGGAC
CTTGATCGAAATTCCTACCCTGATGTTGCTGTTGGTTCCCTCTCAGATTCAGTAACTATTTTCAGATCCCGGCCTGTGATTAATATTCAG
AAAACCATCACAGTAACTCCTAACAGAATTGACCTCCGCCAGAAAACAGCGTGTGGGGCGCCTAGTGGGATATGCCTCCAGGTTAAATCC
TGTTTTGAATATACTGCTAACCCCGCTGGTTATAATCCTTCAATATCAATTGTGGGCACACTTGAAGCTGAAAAAGAAAGAAGAAAATCT
GGGCTATCCTCAAGAGTTCAGTTTCGAAACCAAGGTTCTGAGCCCAAATATACTCAAGAACTAACTCTGAAGAGGCAGAAACAGAAAGTG
TGCATGGAGGAAACCCTGTGGCTACAGGATAATATCAGAGATAAACTGCGTCCCATTCCCATAACTGCCTCAGTGGAGATCCAAGAGCCA
AGCTCTCGTAGGCGAGTGAATTCACTTCCAGAAGTTCTTCCAATTCTGAATTCAGATGAACCCAAGACAGCTCATATTGATGTTCACTTC
TTAAAAGAGGGATGTGGAGACGACAATGTATGTAACAGCAACCTTAAACTAGAATATAAATTTTGCACCCGAGAAGGAAATCAAGACAAA
TTTTCTTATTTACCAATTCAAAAAGGTGTACCAGAACTAGTTCTAAAAGATCAGAAGGATATTGCTTTAGAAATAACAGTGACAAACAGC
CCTTCCAACCCAAGGAATCCCACAAAAGATGGCGATGACGCCCATGAGGCTAAACTGATTGCAACGTTTCCAGACACTTTAACCTATTCT
GCATATAGAGAACTGAGGGCTTTCCCTGAGAAACAGTTGAGTTGTGTTGCCAACCAGAATGGCTCGCAAGCTGACTGTGAGCTCGGAAAT
CCTTTTAAAAGAAATTCAAATGTCACTTTTTATTTGGTTTTAAGTACAACTGAAGTCACCTTTGACACCCCAGATCTGGATATTAATCTG
AAGTTAGAAACAACAAGCAATCAAGATAATTTGGCTCCAATTACAGCTAAAGCAAAAGTGGTTATTGAACTGCTTTTATCGGTCTCGGGA
GTTGCTAAACCTTCCCAGGTGTATTTTGGAGGTACAGTTGTTGGCGAGCAAGCTATGAAATCTGAAGATGAAGTGGGAAGTTTAATAGAG
TATGAATTCAGGGTAATAAACTTAGGTAAACCTCTTACAAACCTCGGCACAGCAACCTTGAACATTCAGTGGCCAAAAGAAATTAGCAAT
GGGAAATGGTTGCTTTATTTGGTGAAAGTAGAATCCAAAGGATTGGAAAAGGTAACTTGTGAGCCACAAAAGGAGATAAACTCCCTGAAC
CTAACGGAGTCTCACAACTCAAGAAAGAAACGGGAAATTACTGAAAAACAGATAGATGATAACAGAAAATTTTCTTTATTTGCTGAAAGA
AAATACCAGACTCTTAACTGTAGCGTGAACGTGAACTGTGTGAACATCAGATGCCCGCTGCGGGGGCTGGACAGCAAGGCGTCTCTTATT
TTGCGCTCGAGGTTATGGAACAGCACATTTCTAGAGGAATATTCCAAACTGAACTACTTGGACATTCTCATGCGAGCCTTCATTGATGTG
ACTGCTGCTGCCGAAAATATCAGGCTGCCAAATGCAGGCACTCAGAAACTGCCAAGCAAGTTCAAGAAGTTCTATGCGGAGTTTGAAAGT
TTAATGGACCCTTCAAGGAACCACAGGGCCTACAGGCTGACAGTAGCTAAGCTGGAACCTCCTCTCATCCCCTTCATGCCTTTGCTCATT
AAAGATATGACATTTACTCATGAGGGGAACAAGACGTTCATTGACAATCTAGTAAACTTTGAAAAAATGCGCATGATTGCAAATACGGCC
AGAACAGTGAGATACTACAGGAGCCAACCCTTCAATCCTGATGCAGCTCAAGCTAATAAGAACCATCAGGATGTCCGGAGTTATGTACGG

>In-frame_ITGA6_ENST00000409080_chr2_173356251_+_RAPGEF4_ENST00000264111_chr2_173898642_+_3375nt
ATGGCCGCCGCCGGGCAGCTGTGCTTGCTCTACCTGTCGGCGGGGCTCCTGTCCCGGCTCGGCGCAGCCTTCAACTTGGACACTCGGGAG
GACAACGTGATCCGGAAATATGGAGACCCCGGGAGCCTCTTCGGCTTCTCGCTGGCCATGCACTGGCAACTGCAGCCCGAGGACAAGCGG
CTGTTGCTCGTGGGGGCCCCGCGGGCAGAAGCGCTTCCACTGCAGAGAGCCAACAGAACGGGAGGGCTGTACAGCTGCGACATCACCGCC
CGGGGGCCATGCACGCGGATCGAGTTTGATAACGATGCTGACCCCACGTCAGAAAGCAAGGAAGATCAGTGGATGGGGGTCACCGTCCAG
AGCCAAGGTCCAGGGGGCAAGGTCGTGACATGTGCTCACCGATATGAAAAAAGGCAGCATGTTAATACGAAGCAGGAATCCCGAGACATC
TTTGGGCGGTGTTATGTCCTGAGTCAGAATCTCAGGATTGAAGACGATATGGATGGGGGAGATTGGAGCTTTTGTGATGGGCGATTGAGA
GGCCATGAGAAATTTGGCTCTTGCCAGCAAGGTGTAGCAGCTACTTTTACTAAAGACTTTCATTACATTGTATTTGGAGCCCCGGGTACT
TATAACTGGAAAGGGATTGTTCGTGTAGAGCAAAAGAATAACACTTTTTTTGACATGAACATCTTTGAAGATGGGCCTTATGAAGTTGGT
GGAGAGACTGAGCATGATGAAAGTCTCGTTCCTGTTCCTGCTAACAGTTACTTAGGTTTTTCTTTGGACTCAGGGAAAGGTATTGTTTCT
AAAGATGAGATCACTTTTGTATCTGGTGCTCCCAGAGCCAATCACAGTGGAGCCGTGGTTTTGCTGAAGAGAGACATGAAGTCTGCACAT
CTCCTCCCTGAGCACATATTCGATGGAGAAGGTCTGGCCTCTTCATTTGGCTATGATGTGGCGGTGGTGGACCTCAACAAGGATGGGTGG
CAAGATATAGTTATTGGAGCCCCACAGTATTTTGATAGAGATGGAGAAGTTGGAGGTGCAGTGTATGTCTACATGAACCAGCAAGGCAGA
TGGAATAATGTGAAGCCAATTCGTCTTAATGGAACCAAAGATTCTATGTTTGGCATTGCAGTAAAAAATATTGGAGATATTAATCAAGAT
GGCTACCCAGATATTGCAGTTGGAGCTCCGTATGATGACTTGGGAAAGGTTTTTATCTATCATGGATCTGCAAATGGAATAAATACCAAA
CCAACACAGGTTCTCAAGGGTATATCACCTTATTTTGGATATTCAATTGCTGGAAACATGGACCTTGATCGAAATTCCTACCCTGATGTT
GCTGTTGGTTCCCTCTCAGATTCAGTAACTATTTTCAGATCCCGGCCTGTGATTAATATTCAGAAAACCATCACAGTAACTCCTAACAGA
ATTGACCTCCGCCAGAAAACAGCGTGTGGGGCGCCTAGTGGGATATGCCTCCAGGTTAAATCCTGTTTTGAATATACTGCTAACCCCGCT
GGTTATAATCCTTCAATATCAATTGTGGGCACACTTGAAGCTGAAAAAGAAAGAAGAAAATCTGGGCTATCCTCAAGAGTTCAGTTTCGA
AACCAAGGTTCTGAGCCCAAATATACTCAAGAACTAACTCTGAAGAGGCAGAAACAGAAAGTGTGCATGGAGGAAACCCTGTGGCTACAG
GATAATATCAGAGATAAACTGCGTCCCATTCCCATAACTGCCTCAGTGGAGATCCAAGAGCCAAGCTCTCGTAGGCGAGTGAATTCACTT
CCAGAAGTTCTTCCAATTCTGAATTCAGATGAACCCAAGACAGCTCATATTGATGTTCACTTCTTAAAAGAGGGATGTGGAGACGACAAT
GTATGTAACAGCAACCTTAAACTAGAATATAAATTTTGCACCCGAGAAGGAAATCAAGACAAATTTTCTTATTTACCAATTCAAAAAGGT
GTACCAGAACTAGTTCTAAAAGATCAGAAGGATATTGCTTTAGAAATAACAGTGACAAACAGCCCTTCCAACCCAAGGAATCCCACAAAA
GATGGCGATGACGCCCATGAGGCTAAACTGATTGCAACGTTTCCAGACACTTTAACCTATTCTGCATATAGAGAACTGAGGGCTTTCCCT
GAGAAACAGTTGAGTTGTGTTGCCAACCAGAATGGCTCGCAAGCTGACTGTGAGCTCGGAAATCCTTTTAAAAGAAATTCAAATGTCACT
TTTTATTTGGTTTTAAGTACAACTGAAGTCACCTTTGACACCCCAGATCTGGATATTAATCTGAAGTTAGAAACAACAAGCAATCAAGAT
AATTTGGCTCCAATTACAGCTAAAGCAAAAGTGGTTATTGAACTGCTTTTATCGGTCTCGGGAGTTGCTAAACCTTCCCAGGTGTATTTT
GGAGGTACAGTTGTTGGCGAGCAAGCTATGAAATCTGAAGATGAAGTGGGAAGTTTAATAGAGTATGAATTCAGGGTAATAAACTTAGGT
AAACCTCTTACAAACCTCGGCACAGCAACCTTGAACATTCAGTGGCCAAAAGAAATTAGCAATGGGAAATGGTTGCTTTATTTGGTGAAA
GTAGAATCCAAAGGATTGGAAAAGGTAACTTGTGAGCCACAAAAGGAGATAAACTCCCTGAACCTAACGGAGTCTCACAACTCAAGAAAG
AAACGGGAAATTACTGAAAAACAGATAGATGATAACAGAAAATTTTCTTTATTTGCTGAAAGAAAATACCAGACTCTTAACTGTAGCGTG
AACGTGAACTGTGTGAACATCAGATGCCCGCTGCGGGGGCTGGACAGCAAGGCGTCTCTTATTTTGCGCTCGAGGTTATGGAACAGCACA
TTTCTAGAGGAATATTCCAAACTGAACTACTTGGACATTCTCATGCGAGCCTTCATTGATGTGACTGCTGCTGCCGAAAATATCAGGCTG
CCAAATGCAGGCACTCAGAAACTGCCAAGCAAGTTCAAGAAGTTCTATGCGGAGTTTGAAAGTTTAATGGACCCTTCAAGGAACCACAGG
GCCTACAGGCTGACAGTAGCTAAGCTGGAACCTCCTCTCATCCCCTTCATGCCTTTGCTCATTAAAGATATGACATTTACTCATGAGGGG
AACAAGACGTTCATTGACAATCTAGTAAACTTTGAAAAAATGCGCATGATTGCAAATACGGCCAGAACAGTGAGATACTACAGGAGCCAA
CCCTTCAATCCTGATGCAGCTCAAGCTAATAAGAACCATCAGGATGTCCGGAGTTATGTACGGCAATTAAATGTGATTGACAACCAGAGA

>In-frame_ITGA6_ENST00000409080_chr2_173356251_+_RAPGEF4_ENST00000397081_chr2_173898642_+_3375nt
ATGGCCGCCGCCGGGCAGCTGTGCTTGCTCTACCTGTCGGCGGGGCTCCTGTCCCGGCTCGGCGCAGCCTTCAACTTGGACACTCGGGAG
GACAACGTGATCCGGAAATATGGAGACCCCGGGAGCCTCTTCGGCTTCTCGCTGGCCATGCACTGGCAACTGCAGCCCGAGGACAAGCGG
CTGTTGCTCGTGGGGGCCCCGCGGGCAGAAGCGCTTCCACTGCAGAGAGCCAACAGAACGGGAGGGCTGTACAGCTGCGACATCACCGCC
CGGGGGCCATGCACGCGGATCGAGTTTGATAACGATGCTGACCCCACGTCAGAAAGCAAGGAAGATCAGTGGATGGGGGTCACCGTCCAG
AGCCAAGGTCCAGGGGGCAAGGTCGTGACATGTGCTCACCGATATGAAAAAAGGCAGCATGTTAATACGAAGCAGGAATCCCGAGACATC
TTTGGGCGGTGTTATGTCCTGAGTCAGAATCTCAGGATTGAAGACGATATGGATGGGGGAGATTGGAGCTTTTGTGATGGGCGATTGAGA
GGCCATGAGAAATTTGGCTCTTGCCAGCAAGGTGTAGCAGCTACTTTTACTAAAGACTTTCATTACATTGTATTTGGAGCCCCGGGTACT
TATAACTGGAAAGGGATTGTTCGTGTAGAGCAAAAGAATAACACTTTTTTTGACATGAACATCTTTGAAGATGGGCCTTATGAAGTTGGT
GGAGAGACTGAGCATGATGAAAGTCTCGTTCCTGTTCCTGCTAACAGTTACTTAGGTTTTTCTTTGGACTCAGGGAAAGGTATTGTTTCT
AAAGATGAGATCACTTTTGTATCTGGTGCTCCCAGAGCCAATCACAGTGGAGCCGTGGTTTTGCTGAAGAGAGACATGAAGTCTGCACAT
CTCCTCCCTGAGCACATATTCGATGGAGAAGGTCTGGCCTCTTCATTTGGCTATGATGTGGCGGTGGTGGACCTCAACAAGGATGGGTGG
CAAGATATAGTTATTGGAGCCCCACAGTATTTTGATAGAGATGGAGAAGTTGGAGGTGCAGTGTATGTCTACATGAACCAGCAAGGCAGA
TGGAATAATGTGAAGCCAATTCGTCTTAATGGAACCAAAGATTCTATGTTTGGCATTGCAGTAAAAAATATTGGAGATATTAATCAAGAT
GGCTACCCAGATATTGCAGTTGGAGCTCCGTATGATGACTTGGGAAAGGTTTTTATCTATCATGGATCTGCAAATGGAATAAATACCAAA
CCAACACAGGTTCTCAAGGGTATATCACCTTATTTTGGATATTCAATTGCTGGAAACATGGACCTTGATCGAAATTCCTACCCTGATGTT
GCTGTTGGTTCCCTCTCAGATTCAGTAACTATTTTCAGATCCCGGCCTGTGATTAATATTCAGAAAACCATCACAGTAACTCCTAACAGA
ATTGACCTCCGCCAGAAAACAGCGTGTGGGGCGCCTAGTGGGATATGCCTCCAGGTTAAATCCTGTTTTGAATATACTGCTAACCCCGCT
GGTTATAATCCTTCAATATCAATTGTGGGCACACTTGAAGCTGAAAAAGAAAGAAGAAAATCTGGGCTATCCTCAAGAGTTCAGTTTCGA
AACCAAGGTTCTGAGCCCAAATATACTCAAGAACTAACTCTGAAGAGGCAGAAACAGAAAGTGTGCATGGAGGAAACCCTGTGGCTACAG
GATAATATCAGAGATAAACTGCGTCCCATTCCCATAACTGCCTCAGTGGAGATCCAAGAGCCAAGCTCTCGTAGGCGAGTGAATTCACTT
CCAGAAGTTCTTCCAATTCTGAATTCAGATGAACCCAAGACAGCTCATATTGATGTTCACTTCTTAAAAGAGGGATGTGGAGACGACAAT
GTATGTAACAGCAACCTTAAACTAGAATATAAATTTTGCACCCGAGAAGGAAATCAAGACAAATTTTCTTATTTACCAATTCAAAAAGGT
GTACCAGAACTAGTTCTAAAAGATCAGAAGGATATTGCTTTAGAAATAACAGTGACAAACAGCCCTTCCAACCCAAGGAATCCCACAAAA
GATGGCGATGACGCCCATGAGGCTAAACTGATTGCAACGTTTCCAGACACTTTAACCTATTCTGCATATAGAGAACTGAGGGCTTTCCCT
GAGAAACAGTTGAGTTGTGTTGCCAACCAGAATGGCTCGCAAGCTGACTGTGAGCTCGGAAATCCTTTTAAAAGAAATTCAAATGTCACT
TTTTATTTGGTTTTAAGTACAACTGAAGTCACCTTTGACACCCCAGATCTGGATATTAATCTGAAGTTAGAAACAACAAGCAATCAAGAT
AATTTGGCTCCAATTACAGCTAAAGCAAAAGTGGTTATTGAACTGCTTTTATCGGTCTCGGGAGTTGCTAAACCTTCCCAGGTGTATTTT
GGAGGTACAGTTGTTGGCGAGCAAGCTATGAAATCTGAAGATGAAGTGGGAAGTTTAATAGAGTATGAATTCAGGGTAATAAACTTAGGT
AAACCTCTTACAAACCTCGGCACAGCAACCTTGAACATTCAGTGGCCAAAAGAAATTAGCAATGGGAAATGGTTGCTTTATTTGGTGAAA
GTAGAATCCAAAGGATTGGAAAAGGTAACTTGTGAGCCACAAAAGGAGATAAACTCCCTGAACCTAACGGAGTCTCACAACTCAAGAAAG
AAACGGGAAATTACTGAAAAACAGATAGATGATAACAGAAAATTTTCTTTATTTGCTGAAAGAAAATACCAGACTCTTAACTGTAGCGTG
AACGTGAACTGTGTGAACATCAGATGCCCGCTGCGGGGGCTGGACAGCAAGGCGTCTCTTATTTTGCGCTCGAGGTTATGGAACAGCACA
TTTCTAGAGGAATATTCCAAACTGAACTACTTGGACATTCTCATGCGAGCCTTCATTGATGTGACTGCTGCTGCCGAAAATATCAGGCTG
CCAAATGCAGGCACTCAGAAACTGCCAAGCAAGTTCAAGAAGTTCTATGCGGAGTTTGAAAGTTTAATGGACCCTTCAAGGAACCACAGG
GCCTACAGGCTGACAGTAGCTAAGCTGGAACCTCCTCTCATCCCCTTCATGCCTTTGCTCATTAAAGATATGACATTTACTCATGAGGGG
AACAAGACGTTCATTGACAATCTAGTAAACTTTGAAAAAATGCGCATGATTGCAAATACGGCCAGAACAGTGAGATACTACAGGAGCCAA
CCCTTCAATCCTGATGCAGCTCAAGCTAATAAGAACCATCAGGATGTCCGGAGTTATGTACGGCAATTAAATGTGATTGACAACCAGAGA


* Fusion transcript sequences (Full-length transcript).
>In-frame_ITGA6_ENST00000409532_chr2_173356251_+_RAPGEF4_ENST00000264111_chr2_173898642_+_4349nt
ACGTCGTGGCTTCCGGGCAGGTACCGGGCAGCTGGAGACGCCAGAGCCGGCGGGTTGCTCGTGGGGGCCCCGCGGGCAGAAGCGCTTCCA
CTGCAGAGAGCCAACAGAACGGGAGGGCTGTACAGCTGCGACATCACCGCCCGGGGGCCATGCACGCGGATCGAGTTTGATAACGATGCT
GACCCCACGTCAGAAAGCAAGGAAGATCAGTGGATGGGGGTCACCGTCCAGAGCCAAGGTCCAGGGGGCAAGGTCGTGACATGTGCTCAC
CGATATGAAAAAAGGCAGCATGTTAATACGAAGCAGGAATCCCGAGACATCTTTGGGCGGTGTTATGTCCTGAGTCAGAATCTCAGGATT
GAAGACGATATGGATGGGGGAGATTGGAGCTTTTGTGATGGGCGATTGAGAGGCCATGAGAAATTTGGCTCTTGCCAGCAAGGTGTAGCA
GCTACTTTTACTAAAGACTTTCATTACATTGTATTTGGAGCCCCGGGTACTTATAACTGGAAAGGCCTGCTGTTTTTGACCAGCGTTTCC
TATACAGATCCTGATCAGTTTGTTTATAAAACACGGCCTCCCCGGGAGCAGCCTGACACATTCCCTGATGTGATGATGAATAGCTACCTA
GGTTTTTCTTTGGACTCAGGGAAAGGTATTGTTTCTAAAGATGAGATCACTTTTGTATCTGGTGCTCCCAGAGCCAATCACAGTGGAGCC
GTGGTTTTGCTGAAGAGAGACATGAAGTCTGCACATCTCCTCCCTGAGCACATATTCGATGGAGAAGGTCTGGCCTCTTCATTTGGCTAT
GATGTGGCGGTGGTGGACCTCAACAAGGATGGGTGGCAAGATATAGTTATTGGAGCCCCACAGTATTTTGATAGAGATGGAGAAGTTGGA
GGTGCAGTGTATGTCTACATGAACCAGCAAGGCAGATGGAATAATGTGAAGCCAATTCGTCTTAATGGAACCAAAGATTCTATGTTTGGC
ATTGCAGTAAAAAATATTGGAGATATTAATCAAGATGGCTACCCAGATATTGCAGTTGGAGCTCCGTATGATGACTTGGGAAAGGTTTTT
ATCTATCATGGATCTGCAAATGGAATAAATACCAAACCAACACAGGTTCTCAAGGGTATATCACCTTATTTTGGATATTCAATTGCTGGA
AACATGGACCTTGATCGAAATTCCTACCCTGATGTTGCTGTTGGTTCCCTCTCAGATTCAGTAACTATTTTCAGATCCCGGCCTGTGATT
AATATTCAGAAAACCATCACAGTAACTCCTAACAGAATTGACCTCCGCCAGAAAACAGCGTGTGGGGCGCCTAGTGGGATATGCCTCCAG
GTTAAATCCTGTTTTGAATATACTGCTAACCCCGCTGGTTATAATCCTTCAATATCAATTGTGGGCACACTTGAAGCTGAAAAAGAAAGA
AGAAAATCTGGGCTATCCTCAAGAGTTCAGTTTCGAAACCAAGGTTCTGAGCCCAAATATACTCAAGAACTAACTCTGAAGAGGCAGAAA
CAGAAAGTGTGCATGGAGGAAACCCTGTGGCTACAGGATAATATCAGAGATAAACTGCGTCCCATTCCCATAACTGCCTCAGTGGAGATC
CAAGAGCCAAGCTCTCGTAGGCGAGTGAATTCACTTCCAGAAGTTCTTCCAATTCTGAATTCAGATGAACCCAAGACAGCTCATATTGAT
GTTCACTTCTTAAAAGAGGGATGTGGAGACGACAATGTATGTAACAGCAACCTTAAACTAGAATATAAATTTTGCACCCGAGAAGGAAAT
CAAGACAAATTTTCTTATTTACCAATTCAAAAAGGTGTACCAGAACTAGTTCTAAAAGATCAGAAGGATATTGCTTTAGAAATAACAGTG
ACAAACAGCCCTTCCAACCCAAGGAATCCCACAAAAGATGGCGATGACGCCCATGAGGCTAAACTGATTGCAACGTTTCCAGACACTTTA
ACCTATTCTGCATATAGAGAACTGAGGGCTTTCCCTGAGAAACAGTTGAGTTGTGTTGCCAACCAGAATGGCTCGCAAGCTGACTGTGAG
CTCGGAAATCCTTTTAAAAGAAATTCAAATGTCACTTTTTATTTGGTTTTAAGTACAACTGAAGTCACCTTTGACACCCCAGATCTGGAT
ATTAATCTGAAGTTAGAAACAACAAGCAATCAAGATAATTTGGCTCCAATTACAGCTAAAGCAAAAGTGGTTATTGAACTGCTTTTATCG
GTCTCGGGAGTTGCTAAACCTTCCCAGGTGTATTTTGGAGGTACAGTTGTTGGCGAGCAAGCTATGAAATCTGAAGATGAAGTGGGAAGT
TTAATAGAGTATGAATTCAGGGTAATAAACTTAGGTAAACCTCTTACAAACCTCGGCACAGCAACCTTGAACATTCAGTGGCCAAAAGAA
ATTAGCAATGGGAAATGGTTGCTTTATTTGGTGAAAGTAGAATCCAAAGGATTGGAAAAGGTAACTTGTGAGCCACAAAAGGAGATAAAC
TCCCTGAACCTAACGGAGTCTCACAACTCAAGAAAGAAACGGGAAATTACTGAAAAACAGATAGATGATAACAGAAAATTTTCTTTATTT
GCTGAAAGAAAATACCAGACTCTTAACTGTAGCGTGAACGTGAACTGTGTGAACATCAGATGCCCGCTGCGGGGGCTGGACAGCAAGGCG
TCTCTTATTTTGCGCTCGAGGTTATGGAACAGCACATTTCTAGAGGAATATTCCAAACTGAACTACTTGGACATTCTCATGCGAGCCTTC
ATTGATGTGACTGCTGCTGCCGAAAATATCAGGCTGCCAAATGCAGGCACTCAGAAACTGCCAAGCAAGTTCAAGAAGTTCTATGCGGAG
TTTGAAAGTTTAATGGACCCTTCAAGGAACCACAGGGCCTACAGGCTGACAGTAGCTAAGCTGGAACCTCCTCTCATCCCCTTCATGCCT
TTGCTCATTAAAGATATGACATTTACTCATGAGGGGAACAAGACGTTCATTGACAATCTAGTAAACTTTGAAAAAATGCGCATGATTGCA
AATACGGCCAGAACAGTGAGATACTACAGGAGCCAACCCTTCAATCCTGATGCAGCTCAAGCTAATAAGAACCATCAGGATGTCCGGAGT
TATGTACGGCAATTAAATGTGATTGACAACCAGAGAACTTTATCACAGATGTCACACAGATTAGAGCCTCGTCGACCATAGACATTTCAA
ATGCCCAAAGCAACAGTTTGTCTCCAGTCCACAATCTTTCAAAAATGCCATTTATGCTACTACTGACTGTATTGCCACTAGAGAATTCTA
CAAAACAAGCAAAAACACATCCTGAGACACCTCAGGGCTGCATTCAGCTTACCAGCTACCTAGCAAGAGAAGGAATTATTTGACATGCCT
AAAGCTTACACACTCTAGCTTAGGAATCCCCAGTTTGTGGCTACCCTGTTTCATTTCCACTTGTGCCATCTTCTTTGCTGAAGTGTTGAA
TAAGGCCCACGTGAAGAGTTTGGTAGAAATAGCCTTGTCAAGAGAACTAGCAAGCCCCTGACATTTTTTTCTAAGAGTGTTTATGGGATG
AGATGTGCTACAAATGGGATAGATTTGGATAAAATTTTAACTCAACATCTTGATTTGGAGCCTGGGGTTTCGGGAAGGTGTTGAGGAATC
TATAGAAGTCCAAATTATAGGTTGTATTCTTCCATCTTCATTGTCTTACCTCTGAAGGAATAGAACCTGACCACATTATTATGAAACATT
ATGGCTGTTTATGTAATTTAGGGAGGACTGGTCTGTAATTTCTGAATGTATATAGAATAATATTTATGTTTACAATGTAACTTTTCAAAA
TTTACAAATCAGGATTATATACATAAGAATTCCACTAAGAAATGCCAAGATTCTTAAATTTGCCAGCGTTAAAGTAGAAAATAACATTTC
AGAAGAGCACAATATGCATAAAACATTTTTCAAAATTGAAATATTTTCCTGGGCATTAAAAACCTTTACTATTGGCTACAAATTTATTGT
ACCTGATGAAAACATATTTTCTGGACTTAAATGTTATTACAAATATCTTAATTTTCAGTAATTGTTTTGCACTTTCAAAGATTGTAAATA
GTTCATTCAATCAATGGTATGGAGTTATTTATTTGCTACATAATAGATACTGTGCCAAATAATTACTTTTTATTTATTTTATTTAGTACG
TAATTTTGAAGTACATTTTTTCCTGTTTTCACAATTAGACTACATTTAATGTGTAGGAATTGTATGTATGTATATCTTCTGTAAATAACA

>In-frame_ITGA6_ENST00000409532_chr2_173356251_+_RAPGEF4_ENST00000397081_chr2_173898642_+_4351nt
ACGTCGTGGCTTCCGGGCAGGTACCGGGCAGCTGGAGACGCCAGAGCCGGCGGGTTGCTCGTGGGGGCCCCGCGGGCAGAAGCGCTTCCA
CTGCAGAGAGCCAACAGAACGGGAGGGCTGTACAGCTGCGACATCACCGCCCGGGGGCCATGCACGCGGATCGAGTTTGATAACGATGCT
GACCCCACGTCAGAAAGCAAGGAAGATCAGTGGATGGGGGTCACCGTCCAGAGCCAAGGTCCAGGGGGCAAGGTCGTGACATGTGCTCAC
CGATATGAAAAAAGGCAGCATGTTAATACGAAGCAGGAATCCCGAGACATCTTTGGGCGGTGTTATGTCCTGAGTCAGAATCTCAGGATT
GAAGACGATATGGATGGGGGAGATTGGAGCTTTTGTGATGGGCGATTGAGAGGCCATGAGAAATTTGGCTCTTGCCAGCAAGGTGTAGCA
GCTACTTTTACTAAAGACTTTCATTACATTGTATTTGGAGCCCCGGGTACTTATAACTGGAAAGGCCTGCTGTTTTTGACCAGCGTTTCC
TATACAGATCCTGATCAGTTTGTTTATAAAACACGGCCTCCCCGGGAGCAGCCTGACACATTCCCTGATGTGATGATGAATAGCTACCTA
GGTTTTTCTTTGGACTCAGGGAAAGGTATTGTTTCTAAAGATGAGATCACTTTTGTATCTGGTGCTCCCAGAGCCAATCACAGTGGAGCC
GTGGTTTTGCTGAAGAGAGACATGAAGTCTGCACATCTCCTCCCTGAGCACATATTCGATGGAGAAGGTCTGGCCTCTTCATTTGGCTAT
GATGTGGCGGTGGTGGACCTCAACAAGGATGGGTGGCAAGATATAGTTATTGGAGCCCCACAGTATTTTGATAGAGATGGAGAAGTTGGA
GGTGCAGTGTATGTCTACATGAACCAGCAAGGCAGATGGAATAATGTGAAGCCAATTCGTCTTAATGGAACCAAAGATTCTATGTTTGGC
ATTGCAGTAAAAAATATTGGAGATATTAATCAAGATGGCTACCCAGATATTGCAGTTGGAGCTCCGTATGATGACTTGGGAAAGGTTTTT
ATCTATCATGGATCTGCAAATGGAATAAATACCAAACCAACACAGGTTCTCAAGGGTATATCACCTTATTTTGGATATTCAATTGCTGGA
AACATGGACCTTGATCGAAATTCCTACCCTGATGTTGCTGTTGGTTCCCTCTCAGATTCAGTAACTATTTTCAGATCCCGGCCTGTGATT
AATATTCAGAAAACCATCACAGTAACTCCTAACAGAATTGACCTCCGCCAGAAAACAGCGTGTGGGGCGCCTAGTGGGATATGCCTCCAG
GTTAAATCCTGTTTTGAATATACTGCTAACCCCGCTGGTTATAATCCTTCAATATCAATTGTGGGCACACTTGAAGCTGAAAAAGAAAGA
AGAAAATCTGGGCTATCCTCAAGAGTTCAGTTTCGAAACCAAGGTTCTGAGCCCAAATATACTCAAGAACTAACTCTGAAGAGGCAGAAA
CAGAAAGTGTGCATGGAGGAAACCCTGTGGCTACAGGATAATATCAGAGATAAACTGCGTCCCATTCCCATAACTGCCTCAGTGGAGATC
CAAGAGCCAAGCTCTCGTAGGCGAGTGAATTCACTTCCAGAAGTTCTTCCAATTCTGAATTCAGATGAACCCAAGACAGCTCATATTGAT
GTTCACTTCTTAAAAGAGGGATGTGGAGACGACAATGTATGTAACAGCAACCTTAAACTAGAATATAAATTTTGCACCCGAGAAGGAAAT
CAAGACAAATTTTCTTATTTACCAATTCAAAAAGGTGTACCAGAACTAGTTCTAAAAGATCAGAAGGATATTGCTTTAGAAATAACAGTG
ACAAACAGCCCTTCCAACCCAAGGAATCCCACAAAAGATGGCGATGACGCCCATGAGGCTAAACTGATTGCAACGTTTCCAGACACTTTA
ACCTATTCTGCATATAGAGAACTGAGGGCTTTCCCTGAGAAACAGTTGAGTTGTGTTGCCAACCAGAATGGCTCGCAAGCTGACTGTGAG
CTCGGAAATCCTTTTAAAAGAAATTCAAATGTCACTTTTTATTTGGTTTTAAGTACAACTGAAGTCACCTTTGACACCCCAGATCTGGAT
ATTAATCTGAAGTTAGAAACAACAAGCAATCAAGATAATTTGGCTCCAATTACAGCTAAAGCAAAAGTGGTTATTGAACTGCTTTTATCG
GTCTCGGGAGTTGCTAAACCTTCCCAGGTGTATTTTGGAGGTACAGTTGTTGGCGAGCAAGCTATGAAATCTGAAGATGAAGTGGGAAGT
TTAATAGAGTATGAATTCAGGGTAATAAACTTAGGTAAACCTCTTACAAACCTCGGCACAGCAACCTTGAACATTCAGTGGCCAAAAGAA
ATTAGCAATGGGAAATGGTTGCTTTATTTGGTGAAAGTAGAATCCAAAGGATTGGAAAAGGTAACTTGTGAGCCACAAAAGGAGATAAAC
TCCCTGAACCTAACGGAGTCTCACAACTCAAGAAAGAAACGGGAAATTACTGAAAAACAGATAGATGATAACAGAAAATTTTCTTTATTT
GCTGAAAGAAAATACCAGACTCTTAACTGTAGCGTGAACGTGAACTGTGTGAACATCAGATGCCCGCTGCGGGGGCTGGACAGCAAGGCG
TCTCTTATTTTGCGCTCGAGGTTATGGAACAGCACATTTCTAGAGGAATATTCCAAACTGAACTACTTGGACATTCTCATGCGAGCCTTC
ATTGATGTGACTGCTGCTGCCGAAAATATCAGGCTGCCAAATGCAGGCACTCAGAAACTGCCAAGCAAGTTCAAGAAGTTCTATGCGGAG
TTTGAAAGTTTAATGGACCCTTCAAGGAACCACAGGGCCTACAGGCTGACAGTAGCTAAGCTGGAACCTCCTCTCATCCCCTTCATGCCT
TTGCTCATTAAAGATATGACATTTACTCATGAGGGGAACAAGACGTTCATTGACAATCTAGTAAACTTTGAAAAAATGCGCATGATTGCA
AATACGGCCAGAACAGTGAGATACTACAGGAGCCAACCCTTCAATCCTGATGCAGCTCAAGCTAATAAGAACCATCAGGATGTCCGGAGT
TATGTACGGCAATTAAATGTGATTGACAACCAGAGAACTTTATCACAGATGTCACACAGATTAGAGCCTCGTCGACCATAGACATTTCAA
ATGCCCAAAGCAACAGTTTGTCTCCAGTCCACAATCTTTCAAAAATGCCATTTATGCTACTACTGACTGTATTGCCACTAGAGAATTCTA
CAAAACAAGCAAAAACACATCCTGAGACACCTCAGGGCTGCATTCAGCTTACCAGCTACCTAGCAAGAGAAGGAATTATTTGACATGCCT
AAAGCTTACACACTCTAGCTTAGGAATCCCCAGTTTGTGGCTACCCTGTTTCATTTCCACTTGTGCCATCTTCTTTGCTGAAGTGTTGAA
TAAGGCCCACGTGAAGAGTTTGGTAGAAATAGCCTTGTCAAGAGAACTAGCAAGCCCCTGACATTTTTTTCTAAGAGTGTTTATGGGATG
AGATGTGCTACAAATGGGATAGATTTGGATAAAATTTTAACTCAACATCTTGATTTGGAGCCTGGGGTTTCGGGAAGGTGTTGAGGAATC
TATAGAAGTCCAAATTATAGGTTGTATTCTTCCATCTTCATTGTCTTACCTCTGAAGGAATAGAACCTGACCACATTATTATGAAACATT
ATGGCTGTTTATGTAATTTAGGGAGGACTGGTCTGTAATTTCTGAATGTATATAGAATAATATTTATGTTTACAATGTAACTTTTCAAAA
TTTACAAATCAGGATTATATACATAAGAATTCCACTAAGAAATGCCAAGATTCTTAAATTTGCCAGCGTTAAAGTAGAAAATAACATTTC
AGAAGAGCACAATATGCATAAAACATTTTTCAAAATTGAAATATTTTCCTGGGCATTAAAAACCTTTACTATTGGCTACAAATTTATTGT
ACCTGATGAAAACATATTTTCTGGACTTAAATGTTATTACAAATATCTTAATTTTCAGTAATTGTTTTGCACTTTCAAAGATTGTAAATA
GTTCATTCAATCAATGGTATGGAGTTATTTATTTGCTACATAATAGATACTGTGCCAAATAATTACTTTTTATTTATTTTATTTAGTACG
TAATTTTGAAGTACATTTTTTCCTGTTTTCACAATTAGACTACATTTAATGTGTAGGAATTGTATGTATGTATATCTTCTGTAAATAACA

>In-frame_ITGA6_ENST00000264107_chr2_173356251_+_RAPGEF4_ENST00000264111_chr2_173898642_+_4727nt
TTGATAAAACGCCTGCGAGTCTCCAGAGAACAACGGGCTCATTCAGCGGTCGCGAGCTGCCCGCGAGGGGGAGCGGCCGGACGGAGAGCG
CGACCCGTCCCGGGGGTGGGGCCGGGCGCAGCGGCGAGAGGAGGCGAAGGTGGCTGCGGTAGCAGCAGCGCGGCAGCCTCGGACCCAGCC
CGGAGCGCAGGGCGGCCGCTGCAGGTCCCCGCTCCCCTCCCCGTGCGTCCGCCCATGGCCGCCGCCGGGCAGCTGTGCTTGCTCTACCTG
TCGGCGGGGCTCCTGTCCCGGCTCGGCGCAGCCTTCAACTTGGACACTCGGGAGGACAACGTGATCCGGAAATATGGAGACCCCGGGAGC
CTCTTCGGCTTCTCGCTGGCCATGCACTGGCAACTGCAGCCCGAGGACAAGCGGCTGTTGCTCGTGGGGGCCCCGCGGGCAGAAGCGCTT
CCACTGCAGAGAGCCAACAGAACGGGAGGGCTGTACAGCTGCGACATCACCGCCCGGGGGCCATGCACGCGGATCGAGTTTGATAACGAT
GCTGACCCCACGTCAGAAAGCAAGGAAGATCAGTGGATGGGGGTCACCGTCCAGAGCCAAGGTCCAGGGGGCAAGGTCGTGACATGTGCT
CACCGATATGAAAAAAGGCAGCATGTTAATACGAAGCAGGAATCCCGAGACATCTTTGGGCGGTGTTATGTCCTGAGTCAGAATCTCAGG
ATTGAAGACGATATGGATGGGGGAGATTGGAGCTTTTGTGATGGGCGATTGAGAGGCCATGAGAAATTTGGCTCTTGCCAGCAAGGTGTA
GCAGCTACTTTTACTAAAGACTTTCATTACATTGTATTTGGAGCCCCGGGTACTTATAACTGGAAAGGGATTGTTCGTGTAGAGCAAAAG
AATAACACTTTTTTTGACATGAACATCTTTGAAGATGGGCCTTATGAAGTTGGTGGAGAGACTGAGCATGATGAAAGTCTCGTTCCTGTT
CCTGCTAACAGTTACTTAGGTTTTTCTTTGGACTCAGGGAAAGGTATTGTTTCTAAAGATGAGATCACTTTTGTATCTGGTGCTCCCAGA
GCCAATCACAGTGGAGCCGTGGTTTTGCTGAAGAGAGACATGAAGTCTGCACATCTCCTCCCTGAGCACATATTCGATGGAGAAGGTCTG
GCCTCTTCATTTGGCTATGATGTGGCGGTGGTGGACCTCAACAAGGATGGGTGGCAAGATATAGTTATTGGAGCCCCACAGTATTTTGAT
AGAGATGGAGAAGTTGGAGGTGCAGTGTATGTCTACATGAACCAGCAAGGCAGATGGAATAATGTGAAGCCAATTCGTCTTAATGGAACC
AAAGATTCTATGTTTGGCATTGCAGTAAAAAATATTGGAGATATTAATCAAGATGGCTACCCAGATATTGCAGTTGGAGCTCCGTATGAT
GACTTGGGAAAGGTTTTTATCTATCATGGATCTGCAAATGGAATAAATACCAAACCAACACAGGTTCTCAAGGGTATATCACCTTATTTT
GGATATTCAATTGCTGGAAACATGGACCTTGATCGAAATTCCTACCCTGATGTTGCTGTTGGTTCCCTCTCAGATTCAGTAACTATTTTC
AGATCCCGGCCTGTGATTAATATTCAGAAAACCATCACAGTAACTCCTAACAGAATTGACCTCCGCCAGAAAACAGCGTGTGGGGCGCCT
AGTGGGATATGCCTCCAGGTTAAATCCTGTTTTGAATATACTGCTAACCCCGCTGGTTATAATCCTTCAATATCAATTGTGGGCACACTT
GAAGCTGAAAAAGAAAGAAGAAAATCTGGGCTATCCTCAAGAGTTCAGTTTCGAAACCAAGGTTCTGAGCCCAAATATACTCAAGAACTA
ACTCTGAAGAGGCAGAAACAGAAAGTGTGCATGGAGGAAACCCTGTGGCTACAGGATAATATCAGAGATAAACTGCGTCCCATTCCCATA
ACTGCCTCAGTGGAGATCCAAGAGCCAAGCTCTCGTAGGCGAGTGAATTCACTTCCAGAAGTTCTTCCAATTCTGAATTCAGATGAACCC
AAGACAGCTCATATTGATGTTCACTTCTTAAAAGAGGGATGTGGAGACGACAATGTATGTAACAGCAACCTTAAACTAGAATATAAATTT
TGCACCCGAGAAGGAAATCAAGACAAATTTTCTTATTTACCAATTCAAAAAGGTGTACCAGAACTAGTTCTAAAAGATCAGAAGGATATT
GCTTTAGAAATAACAGTGACAAACAGCCCTTCCAACCCAAGGAATCCCACAAAAGATGGCGATGACGCCCATGAGGCTAAACTGATTGCA
ACGTTTCCAGACACTTTAACCTATTCTGCATATAGAGAACTGAGGGCTTTCCCTGAGAAACAGTTGAGTTGTGTTGCCAACCAGAATGGC
TCGCAAGCTGACTGTGAGCTCGGAAATCCTTTTAAAAGAAATTCAAATGTCACTTTTTATTTGGTTTTAAGTACAACTGAAGTCACCTTT
GACACCCCAGATCTGGATATTAATCTGAAGTTAGAAACAACAAGCAATCAAGATAATTTGGCTCCAATTACAGCTAAAGCAAAAGTGGTT
ATTGAACTGCTTTTATCGGTCTCGGGAGTTGCTAAACCTTCCCAGGTGTATTTTGGAGGTACAGTTGTTGGCGAGCAAGCTATGAAATCT
GAAGATGAAGTGGGAAGTTTAATAGAGTATGAATTCAGGGTAATAAACTTAGGTAAACCTCTTACAAACCTCGGCACAGCAACCTTGAAC
ATTCAGTGGCCAAAAGAAATTAGCAATGGGAAATGGTTGCTTTATTTGGTGAAAGTAGAATCCAAAGGATTGGAAAAGGTAACTTGTGAG
CCACAAAAGGAGATAAACTCCCTGAACCTAACGGAGTCTCACAACTCAAGAAAGAAACGGGAAATTACTGAAAAACAGATAGATGATAAC
AGAAAATTTTCTTTATTTGCTGAAAGAAAATACCAGACTCTTAACTGTAGCGTGAACGTGAACTGTGTGAACATCAGATGCCCGCTGCGG
GGGCTGGACAGCAAGGCGTCTCTTATTTTGCGCTCGAGGTTATGGAACAGCACATTTCTAGAGGAATATTCCAAACTGAACTACTTGGAC
ATTCTCATGCGAGCCTTCATTGATGTGACTGCTGCTGCCGAAAATATCAGGCTGCCAAATGCAGGCACTCAGAAACTGCCAAGCAAGTTC
AAGAAGTTCTATGCGGAGTTTGAAAGTTTAATGGACCCTTCAAGGAACCACAGGGCCTACAGGCTGACAGTAGCTAAGCTGGAACCTCCT
CTCATCCCCTTCATGCCTTTGCTCATTAAAGATATGACATTTACTCATGAGGGGAACAAGACGTTCATTGACAATCTAGTAAACTTTGAA
AAAATGCGCATGATTGCAAATACGGCCAGAACAGTGAGATACTACAGGAGCCAACCCTTCAATCCTGATGCAGCTCAAGCTAATAAGAAC
CATCAGGATGTCCGGAGTTATGTACGGCAATTAAATGTGATTGACAACCAGAGAACTTTATCACAGATGTCACACAGATTAGAGCCTCGT
CGACCATAGACATTTCAAATGCCCAAAGCAACAGTTTGTCTCCAGTCCACAATCTTTCAAAAATGCCATTTATGCTACTACTGACTGTAT
TGCCACTAGAGAATTCTACAAAACAAGCAAAAACACATCCTGAGACACCTCAGGGCTGCATTCAGCTTACCAGCTACCTAGCAAGAGAAG
GAATTATTTGACATGCCTAAAGCTTACACACTCTAGCTTAGGAATCCCCAGTTTGTGGCTACCCTGTTTCATTTCCACTTGTGCCATCTT
CTTTGCTGAAGTGTTGAATAAGGCCCACGTGAAGAGTTTGGTAGAAATAGCCTTGTCAAGAGAACTAGCAAGCCCCTGACATTTTTTTCT
AAGAGTGTTTATGGGATGAGATGTGCTACAAATGGGATAGATTTGGATAAAATTTTAACTCAACATCTTGATTTGGAGCCTGGGGTTTCG
GGAAGGTGTTGAGGAATCTATAGAAGTCCAAATTATAGGTTGTATTCTTCCATCTTCATTGTCTTACCTCTGAAGGAATAGAACCTGACC
ACATTATTATGAAACATTATGGCTGTTTATGTAATTTAGGGAGGACTGGTCTGTAATTTCTGAATGTATATAGAATAATATTTATGTTTA
CAATGTAACTTTTCAAAATTTACAAATCAGGATTATATACATAAGAATTCCACTAAGAAATGCCAAGATTCTTAAATTTGCCAGCGTTAA
AGTAGAAAATAACATTTCAGAAGAGCACAATATGCATAAAACATTTTTCAAAATTGAAATATTTTCCTGGGCATTAAAAACCTTTACTAT
TGGCTACAAATTTATTGTACCTGATGAAAACATATTTTCTGGACTTAAATGTTATTACAAATATCTTAATTTTCAGTAATTGTTTTGCAC
TTTCAAAGATTGTAAATAGTTCATTCAATCAATGGTATGGAGTTATTTATTTGCTACATAATAGATACTGTGCCAAATAATTACTTTTTA
TTTATTTTATTTAGTACGTAATTTTGAAGTACATTTTTTCCTGTTTTCACAATTAGACTACATTTAATGTGTAGGAATTGTATGTATGTA

>In-frame_ITGA6_ENST00000264107_chr2_173356251_+_RAPGEF4_ENST00000397081_chr2_173898642_+_4729nt
TTGATAAAACGCCTGCGAGTCTCCAGAGAACAACGGGCTCATTCAGCGGTCGCGAGCTGCCCGCGAGGGGGAGCGGCCGGACGGAGAGCG
CGACCCGTCCCGGGGGTGGGGCCGGGCGCAGCGGCGAGAGGAGGCGAAGGTGGCTGCGGTAGCAGCAGCGCGGCAGCCTCGGACCCAGCC
CGGAGCGCAGGGCGGCCGCTGCAGGTCCCCGCTCCCCTCCCCGTGCGTCCGCCCATGGCCGCCGCCGGGCAGCTGTGCTTGCTCTACCTG
TCGGCGGGGCTCCTGTCCCGGCTCGGCGCAGCCTTCAACTTGGACACTCGGGAGGACAACGTGATCCGGAAATATGGAGACCCCGGGAGC
CTCTTCGGCTTCTCGCTGGCCATGCACTGGCAACTGCAGCCCGAGGACAAGCGGCTGTTGCTCGTGGGGGCCCCGCGGGCAGAAGCGCTT
CCACTGCAGAGAGCCAACAGAACGGGAGGGCTGTACAGCTGCGACATCACCGCCCGGGGGCCATGCACGCGGATCGAGTTTGATAACGAT
GCTGACCCCACGTCAGAAAGCAAGGAAGATCAGTGGATGGGGGTCACCGTCCAGAGCCAAGGTCCAGGGGGCAAGGTCGTGACATGTGCT
CACCGATATGAAAAAAGGCAGCATGTTAATACGAAGCAGGAATCCCGAGACATCTTTGGGCGGTGTTATGTCCTGAGTCAGAATCTCAGG
ATTGAAGACGATATGGATGGGGGAGATTGGAGCTTTTGTGATGGGCGATTGAGAGGCCATGAGAAATTTGGCTCTTGCCAGCAAGGTGTA
GCAGCTACTTTTACTAAAGACTTTCATTACATTGTATTTGGAGCCCCGGGTACTTATAACTGGAAAGGGATTGTTCGTGTAGAGCAAAAG
AATAACACTTTTTTTGACATGAACATCTTTGAAGATGGGCCTTATGAAGTTGGTGGAGAGACTGAGCATGATGAAAGTCTCGTTCCTGTT
CCTGCTAACAGTTACTTAGGTTTTTCTTTGGACTCAGGGAAAGGTATTGTTTCTAAAGATGAGATCACTTTTGTATCTGGTGCTCCCAGA
GCCAATCACAGTGGAGCCGTGGTTTTGCTGAAGAGAGACATGAAGTCTGCACATCTCCTCCCTGAGCACATATTCGATGGAGAAGGTCTG
GCCTCTTCATTTGGCTATGATGTGGCGGTGGTGGACCTCAACAAGGATGGGTGGCAAGATATAGTTATTGGAGCCCCACAGTATTTTGAT
AGAGATGGAGAAGTTGGAGGTGCAGTGTATGTCTACATGAACCAGCAAGGCAGATGGAATAATGTGAAGCCAATTCGTCTTAATGGAACC
AAAGATTCTATGTTTGGCATTGCAGTAAAAAATATTGGAGATATTAATCAAGATGGCTACCCAGATATTGCAGTTGGAGCTCCGTATGAT
GACTTGGGAAAGGTTTTTATCTATCATGGATCTGCAAATGGAATAAATACCAAACCAACACAGGTTCTCAAGGGTATATCACCTTATTTT
GGATATTCAATTGCTGGAAACATGGACCTTGATCGAAATTCCTACCCTGATGTTGCTGTTGGTTCCCTCTCAGATTCAGTAACTATTTTC
AGATCCCGGCCTGTGATTAATATTCAGAAAACCATCACAGTAACTCCTAACAGAATTGACCTCCGCCAGAAAACAGCGTGTGGGGCGCCT
AGTGGGATATGCCTCCAGGTTAAATCCTGTTTTGAATATACTGCTAACCCCGCTGGTTATAATCCTTCAATATCAATTGTGGGCACACTT
GAAGCTGAAAAAGAAAGAAGAAAATCTGGGCTATCCTCAAGAGTTCAGTTTCGAAACCAAGGTTCTGAGCCCAAATATACTCAAGAACTA
ACTCTGAAGAGGCAGAAACAGAAAGTGTGCATGGAGGAAACCCTGTGGCTACAGGATAATATCAGAGATAAACTGCGTCCCATTCCCATA
ACTGCCTCAGTGGAGATCCAAGAGCCAAGCTCTCGTAGGCGAGTGAATTCACTTCCAGAAGTTCTTCCAATTCTGAATTCAGATGAACCC
AAGACAGCTCATATTGATGTTCACTTCTTAAAAGAGGGATGTGGAGACGACAATGTATGTAACAGCAACCTTAAACTAGAATATAAATTT
TGCACCCGAGAAGGAAATCAAGACAAATTTTCTTATTTACCAATTCAAAAAGGTGTACCAGAACTAGTTCTAAAAGATCAGAAGGATATT
GCTTTAGAAATAACAGTGACAAACAGCCCTTCCAACCCAAGGAATCCCACAAAAGATGGCGATGACGCCCATGAGGCTAAACTGATTGCA
ACGTTTCCAGACACTTTAACCTATTCTGCATATAGAGAACTGAGGGCTTTCCCTGAGAAACAGTTGAGTTGTGTTGCCAACCAGAATGGC
TCGCAAGCTGACTGTGAGCTCGGAAATCCTTTTAAAAGAAATTCAAATGTCACTTTTTATTTGGTTTTAAGTACAACTGAAGTCACCTTT
GACACCCCAGATCTGGATATTAATCTGAAGTTAGAAACAACAAGCAATCAAGATAATTTGGCTCCAATTACAGCTAAAGCAAAAGTGGTT
ATTGAACTGCTTTTATCGGTCTCGGGAGTTGCTAAACCTTCCCAGGTGTATTTTGGAGGTACAGTTGTTGGCGAGCAAGCTATGAAATCT
GAAGATGAAGTGGGAAGTTTAATAGAGTATGAATTCAGGGTAATAAACTTAGGTAAACCTCTTACAAACCTCGGCACAGCAACCTTGAAC
ATTCAGTGGCCAAAAGAAATTAGCAATGGGAAATGGTTGCTTTATTTGGTGAAAGTAGAATCCAAAGGATTGGAAAAGGTAACTTGTGAG
CCACAAAAGGAGATAAACTCCCTGAACCTAACGGAGTCTCACAACTCAAGAAAGAAACGGGAAATTACTGAAAAACAGATAGATGATAAC
AGAAAATTTTCTTTATTTGCTGAAAGAAAATACCAGACTCTTAACTGTAGCGTGAACGTGAACTGTGTGAACATCAGATGCCCGCTGCGG
GGGCTGGACAGCAAGGCGTCTCTTATTTTGCGCTCGAGGTTATGGAACAGCACATTTCTAGAGGAATATTCCAAACTGAACTACTTGGAC
ATTCTCATGCGAGCCTTCATTGATGTGACTGCTGCTGCCGAAAATATCAGGCTGCCAAATGCAGGCACTCAGAAACTGCCAAGCAAGTTC
AAGAAGTTCTATGCGGAGTTTGAAAGTTTAATGGACCCTTCAAGGAACCACAGGGCCTACAGGCTGACAGTAGCTAAGCTGGAACCTCCT
CTCATCCCCTTCATGCCTTTGCTCATTAAAGATATGACATTTACTCATGAGGGGAACAAGACGTTCATTGACAATCTAGTAAACTTTGAA
AAAATGCGCATGATTGCAAATACGGCCAGAACAGTGAGATACTACAGGAGCCAACCCTTCAATCCTGATGCAGCTCAAGCTAATAAGAAC
CATCAGGATGTCCGGAGTTATGTACGGCAATTAAATGTGATTGACAACCAGAGAACTTTATCACAGATGTCACACAGATTAGAGCCTCGT
CGACCATAGACATTTCAAATGCCCAAAGCAACAGTTTGTCTCCAGTCCACAATCTTTCAAAAATGCCATTTATGCTACTACTGACTGTAT
TGCCACTAGAGAATTCTACAAAACAAGCAAAAACACATCCTGAGACACCTCAGGGCTGCATTCAGCTTACCAGCTACCTAGCAAGAGAAG
GAATTATTTGACATGCCTAAAGCTTACACACTCTAGCTTAGGAATCCCCAGTTTGTGGCTACCCTGTTTCATTTCCACTTGTGCCATCTT
CTTTGCTGAAGTGTTGAATAAGGCCCACGTGAAGAGTTTGGTAGAAATAGCCTTGTCAAGAGAACTAGCAAGCCCCTGACATTTTTTTCT
AAGAGTGTTTATGGGATGAGATGTGCTACAAATGGGATAGATTTGGATAAAATTTTAACTCAACATCTTGATTTGGAGCCTGGGGTTTCG
GGAAGGTGTTGAGGAATCTATAGAAGTCCAAATTATAGGTTGTATTCTTCCATCTTCATTGTCTTACCTCTGAAGGAATAGAACCTGACC
ACATTATTATGAAACATTATGGCTGTTTATGTAATTTAGGGAGGACTGGTCTGTAATTTCTGAATGTATATAGAATAATATTTATGTTTA
CAATGTAACTTTTCAAAATTTACAAATCAGGATTATATACATAAGAATTCCACTAAGAAATGCCAAGATTCTTAAATTTGCCAGCGTTAA
AGTAGAAAATAACATTTCAGAAGAGCACAATATGCATAAAACATTTTTCAAAATTGAAATATTTTCCTGGGCATTAAAAACCTTTACTAT
TGGCTACAAATTTATTGTACCTGATGAAAACATATTTTCTGGACTTAAATGTTATTACAAATATCTTAATTTTCAGTAATTGTTTTGCAC
TTTCAAAGATTGTAAATAGTTCATTCAATCAATGGTATGGAGTTATTTATTTGCTACATAATAGATACTGTGCCAAATAATTACTTTTTA
TTTATTTTATTTAGTACGTAATTTTGAAGTACATTTTTTCCTGTTTTCACAATTAGACTACATTTAATGTGTAGGAATTGTATGTATGTA

>In-frame_ITGA6_ENST00000343713_chr2_173356251_+_RAPGEF4_ENST00000264111_chr2_173898642_+_4681nt
AACGGGCTCATTCAGCGGTCGCGAGCTGCCCGCGAGGGGGAGCGGCCGGACGGAGAGCGCGACCCGTCCCGGGGGTGGGGCCGGGCGCAG
CGGCGAGAGGAGGCGAAGGTGGCTGCGGTAGCAGCAGCGCGGCAGCCTCGGACCCAGCCCGGAGCGCAGGGCGGCCGCTGCAGGTCCCCG
CTCCCCTCCCCGTGCGTCCGCCCATGGCCGCCGCCGGGCAGCTGTGCTTGCTCTACCTGTCGGCGGGGCTCCTGTCCCGGCTCGGCGCAG
CCTTCAACTTGGACACTCGGGAGGACAACGTGATCCGGAAATATGGAGACCCCGGGAGCCTCTTCGGCTTCTCGCTGGCCATGCACTGGC
AACTGCAGCCCGAGGACAAGCGGCTGTTGCTCGTGGGGGCCCCGCGGGCAGAAGCGCTTCCACTGCAGAGAGCCAACAGAACGGGAGGGC
TGTACAGCTGCGACATCACCGCCCGGGGGCCATGCACGCGGATCGAGTTTGATAACGATGCTGACCCCACGTCAGAAAGCAAGGAAGATC
AGTGGATGGGGGTCACCGTCCAGAGCCAAGGTCCAGGGGGCAAGGTCGTGACATGTGCTCACCGATATGAAAAAAGGCAGCATGTTAATA
CGAAGCAGGAATCCCGAGACATCTTTGGGCGGTGTTATGTCCTGAGTCAGAATCTCAGGATTGAAGACGATATGGATGGGGGAGATTGGA
GCTTTTGTGATGGGCGATTGAGAGGCCATGAGAAATTTGGCTCTTGCCAGCAAGGTGTAGCAGCTACTTTTACTAAAGACTTTCATTACA
TTGTATTTGGAGCCCCGGGTACTTATAACTGGAAAGGCCTGCTGTTTTTGACCAGCGTTTCCTATACAGATCCTGATCAGTTTGTTTATA
AAACACGGCCTCCCCGGGAGCAGCCTGACACATTCCCTGATGTGATGATGAATAGCTACCTAGGTTTTTCTTTGGACTCAGGGAAAGGTA
TTGTTTCTAAAGATGAGATCACTTTTGTATCTGGTGCTCCCAGAGCCAATCACAGTGGAGCCGTGGTTTTGCTGAAGAGAGACATGAAGT
CTGCACATCTCCTCCCTGAGCACATATTCGATGGAGAAGGTCTGGCCTCTTCATTTGGCTATGATGTGGCGGTGGTGGACCTCAACAAGG
ATGGGTGGCAAGATATAGTTATTGGAGCCCCACAGTATTTTGATAGAGATGGAGAAGTTGGAGGTGCAGTGTATGTCTACATGAACCAGC
AAGGCAGATGGAATAATGTGAAGCCAATTCGTCTTAATGGAACCAAAGATTCTATGTTTGGCATTGCAGTAAAAAATATTGGAGATATTA
ATCAAGATGGCTACCCAGATATTGCAGTTGGAGCTCCGTATGATGACTTGGGAAAGGTTTTTATCTATCATGGATCTGCAAATGGAATAA
ATACCAAACCAACACAGGTTCTCAAGGGTATATCACCTTATTTTGGATATTCAATTGCTGGAAACATGGACCTTGATCGAAATTCCTACC
CTGATGTTGCTGTTGGTTCCCTCTCAGATTCAGTAACTATTTTCAGATCCCGGCCTGTGATTAATATTCAGAAAACCATCACAGTAACTC
CTAACAGAATTGACCTCCGCCAGAAAACAGCGTGTGGGGCGCCTAGTGGGATATGCCTCCAGGTTAAATCCTGTTTTGAATATACTGCTA
ACCCCGCTGGTTATAATCCTTCAATATCAATTGTGGGCACACTTGAAGCTGAAAAAGAAAGAAGAAAATCTGGGCTATCCTCAAGAGTTC
AGTTTCGAAACCAAGGTTCTGAGCCCAAATATACTCAAGAACTAACTCTGAAGAGGCAGAAACAGAAAGTGTGCATGGAGGAAACCCTGT
GGCTACAGGATAATATCAGAGATAAACTGCGTCCCATTCCCATAACTGCCTCAGTGGAGATCCAAGAGCCAAGCTCTCGTAGGCGAGTGA
ATTCACTTCCAGAAGTTCTTCCAATTCTGAATTCAGATGAACCCAAGACAGCTCATATTGATGTTCACTTCTTAAAAGAGGGATGTGGAG
ACGACAATGTATGTAACAGCAACCTTAAACTAGAATATAAATTTTGCACCCGAGAAGGAAATCAAGACAAATTTTCTTATTTACCAATTC
AAAAAGGTGTACCAGAACTAGTTCTAAAAGATCAGAAGGATATTGCTTTAGAAATAACAGTGACAAACAGCCCTTCCAACCCAAGGAATC
CCACAAAAGATGGCGATGACGCCCATGAGGCTAAACTGATTGCAACGTTTCCAGACACTTTAACCTATTCTGCATATAGAGAACTGAGGG
CTTTCCCTGAGAAACAGTTGAGTTGTGTTGCCAACCAGAATGGCTCGCAAGCTGACTGTGAGCTCGGAAATCCTTTTAAAAGAAATTCAA
ATGTCACTTTTTATTTGGTTTTAAGTACAACTGAAGTCACCTTTGACACCCCAGATCTGGATATTAATCTGAAGTTAGAAACAACAAGCA
ATCAAGATAATTTGGCTCCAATTACAGCTAAAGCAAAAGTGGTTATTGAACTGCTTTTATCGGTCTCGGGAGTTGCTAAACCTTCCCAGG
TGTATTTTGGAGGTACAGTTGTTGGCGAGCAAGCTATGAAATCTGAAGATGAAGTGGGAAGTTTAATAGAGTATGAATTCAGGGTAATAA
ACTTAGGTAAACCTCTTACAAACCTCGGCACAGCAACCTTGAACATTCAGTGGCCAAAAGAAATTAGCAATGGGAAATGGTTGCTTTATT
TGGTGAAAGTAGAATCCAAAGGATTGGAAAAGGTAACTTGTGAGCCACAAAAGGAGATAAACTCCCTGAACCTAACGGAGTCTCACAACT
CAAGAAAGAAACGGGAAATTACTGAAAAACAGATAGATGATAACAGAAAATTTTCTTTATTTGCTGAAAGAAAATACCAGACTCTTAACT
GTAGCGTGAACGTGAACTGTGTGAACATCAGATGCCCGCTGCGGGGGCTGGACAGCAAGGCGTCTCTTATTTTGCGCTCGAGGTTATGGA
ACAGCACATTTCTAGAGGAATATTCCAAACTGAACTACTTGGACATTCTCATGCGAGCCTTCATTGATGTGACTGCTGCTGCCGAAAATA
TCAGGCTGCCAAATGCAGGCACTCAGAAACTGCCAAGCAAGTTCAAGAAGTTCTATGCGGAGTTTGAAAGTTTAATGGACCCTTCAAGGA
ACCACAGGGCCTACAGGCTGACAGTAGCTAAGCTGGAACCTCCTCTCATCCCCTTCATGCCTTTGCTCATTAAAGATATGACATTTACTC
ATGAGGGGAACAAGACGTTCATTGACAATCTAGTAAACTTTGAAAAAATGCGCATGATTGCAAATACGGCCAGAACAGTGAGATACTACA
GGAGCCAACCCTTCAATCCTGATGCAGCTCAAGCTAATAAGAACCATCAGGATGTCCGGAGTTATGTACGGCAATTAAATGTGATTGACA
ACCAGAGAACTTTATCACAGATGTCACACAGATTAGAGCCTCGTCGACCATAGACATTTCAAATGCCCAAAGCAACAGTTTGTCTCCAGT
CCACAATCTTTCAAAAATGCCATTTATGCTACTACTGACTGTATTGCCACTAGAGAATTCTACAAAACAAGCAAAAACACATCCTGAGAC
ACCTCAGGGCTGCATTCAGCTTACCAGCTACCTAGCAAGAGAAGGAATTATTTGACATGCCTAAAGCTTACACACTCTAGCTTAGGAATC
CCCAGTTTGTGGCTACCCTGTTTCATTTCCACTTGTGCCATCTTCTTTGCTGAAGTGTTGAATAAGGCCCACGTGAAGAGTTTGGTAGAA
ATAGCCTTGTCAAGAGAACTAGCAAGCCCCTGACATTTTTTTCTAAGAGTGTTTATGGGATGAGATGTGCTACAAATGGGATAGATTTGG
ATAAAATTTTAACTCAACATCTTGATTTGGAGCCTGGGGTTTCGGGAAGGTGTTGAGGAATCTATAGAAGTCCAAATTATAGGTTGTATT
CTTCCATCTTCATTGTCTTACCTCTGAAGGAATAGAACCTGACCACATTATTATGAAACATTATGGCTGTTTATGTAATTTAGGGAGGAC
TGGTCTGTAATTTCTGAATGTATATAGAATAATATTTATGTTTACAATGTAACTTTTCAAAATTTACAAATCAGGATTATATACATAAGA
ATTCCACTAAGAAATGCCAAGATTCTTAAATTTGCCAGCGTTAAAGTAGAAAATAACATTTCAGAAGAGCACAATATGCATAAAACATTT
TTCAAAATTGAAATATTTTCCTGGGCATTAAAAACCTTTACTATTGGCTACAAATTTATTGTACCTGATGAAAACATATTTTCTGGACTT
AAATGTTATTACAAATATCTTAATTTTCAGTAATTGTTTTGCACTTTCAAAGATTGTAAATAGTTCATTCAATCAATGGTATGGAGTTAT
TTATTTGCTACATAATAGATACTGTGCCAAATAATTACTTTTTATTTATTTTATTTAGTACGTAATTTTGAAGTACATTTTTTCCTGTTT
TCACAATTAGACTACATTTAATGTGTAGGAATTGTATGTATGTATATCTTCTGTAAATAACATCTAGTATCTTCACTAAATATAATTGTC

>In-frame_ITGA6_ENST00000343713_chr2_173356251_+_RAPGEF4_ENST00000397081_chr2_173898642_+_4683nt
AACGGGCTCATTCAGCGGTCGCGAGCTGCCCGCGAGGGGGAGCGGCCGGACGGAGAGCGCGACCCGTCCCGGGGGTGGGGCCGGGCGCAG
CGGCGAGAGGAGGCGAAGGTGGCTGCGGTAGCAGCAGCGCGGCAGCCTCGGACCCAGCCCGGAGCGCAGGGCGGCCGCTGCAGGTCCCCG
CTCCCCTCCCCGTGCGTCCGCCCATGGCCGCCGCCGGGCAGCTGTGCTTGCTCTACCTGTCGGCGGGGCTCCTGTCCCGGCTCGGCGCAG
CCTTCAACTTGGACACTCGGGAGGACAACGTGATCCGGAAATATGGAGACCCCGGGAGCCTCTTCGGCTTCTCGCTGGCCATGCACTGGC
AACTGCAGCCCGAGGACAAGCGGCTGTTGCTCGTGGGGGCCCCGCGGGCAGAAGCGCTTCCACTGCAGAGAGCCAACAGAACGGGAGGGC
TGTACAGCTGCGACATCACCGCCCGGGGGCCATGCACGCGGATCGAGTTTGATAACGATGCTGACCCCACGTCAGAAAGCAAGGAAGATC
AGTGGATGGGGGTCACCGTCCAGAGCCAAGGTCCAGGGGGCAAGGTCGTGACATGTGCTCACCGATATGAAAAAAGGCAGCATGTTAATA
CGAAGCAGGAATCCCGAGACATCTTTGGGCGGTGTTATGTCCTGAGTCAGAATCTCAGGATTGAAGACGATATGGATGGGGGAGATTGGA
GCTTTTGTGATGGGCGATTGAGAGGCCATGAGAAATTTGGCTCTTGCCAGCAAGGTGTAGCAGCTACTTTTACTAAAGACTTTCATTACA
TTGTATTTGGAGCCCCGGGTACTTATAACTGGAAAGGCCTGCTGTTTTTGACCAGCGTTTCCTATACAGATCCTGATCAGTTTGTTTATA
AAACACGGCCTCCCCGGGAGCAGCCTGACACATTCCCTGATGTGATGATGAATAGCTACCTAGGTTTTTCTTTGGACTCAGGGAAAGGTA
TTGTTTCTAAAGATGAGATCACTTTTGTATCTGGTGCTCCCAGAGCCAATCACAGTGGAGCCGTGGTTTTGCTGAAGAGAGACATGAAGT
CTGCACATCTCCTCCCTGAGCACATATTCGATGGAGAAGGTCTGGCCTCTTCATTTGGCTATGATGTGGCGGTGGTGGACCTCAACAAGG
ATGGGTGGCAAGATATAGTTATTGGAGCCCCACAGTATTTTGATAGAGATGGAGAAGTTGGAGGTGCAGTGTATGTCTACATGAACCAGC
AAGGCAGATGGAATAATGTGAAGCCAATTCGTCTTAATGGAACCAAAGATTCTATGTTTGGCATTGCAGTAAAAAATATTGGAGATATTA
ATCAAGATGGCTACCCAGATATTGCAGTTGGAGCTCCGTATGATGACTTGGGAAAGGTTTTTATCTATCATGGATCTGCAAATGGAATAA
ATACCAAACCAACACAGGTTCTCAAGGGTATATCACCTTATTTTGGATATTCAATTGCTGGAAACATGGACCTTGATCGAAATTCCTACC
CTGATGTTGCTGTTGGTTCCCTCTCAGATTCAGTAACTATTTTCAGATCCCGGCCTGTGATTAATATTCAGAAAACCATCACAGTAACTC
CTAACAGAATTGACCTCCGCCAGAAAACAGCGTGTGGGGCGCCTAGTGGGATATGCCTCCAGGTTAAATCCTGTTTTGAATATACTGCTA
ACCCCGCTGGTTATAATCCTTCAATATCAATTGTGGGCACACTTGAAGCTGAAAAAGAAAGAAGAAAATCTGGGCTATCCTCAAGAGTTC
AGTTTCGAAACCAAGGTTCTGAGCCCAAATATACTCAAGAACTAACTCTGAAGAGGCAGAAACAGAAAGTGTGCATGGAGGAAACCCTGT
GGCTACAGGATAATATCAGAGATAAACTGCGTCCCATTCCCATAACTGCCTCAGTGGAGATCCAAGAGCCAAGCTCTCGTAGGCGAGTGA
ATTCACTTCCAGAAGTTCTTCCAATTCTGAATTCAGATGAACCCAAGACAGCTCATATTGATGTTCACTTCTTAAAAGAGGGATGTGGAG
ACGACAATGTATGTAACAGCAACCTTAAACTAGAATATAAATTTTGCACCCGAGAAGGAAATCAAGACAAATTTTCTTATTTACCAATTC
AAAAAGGTGTACCAGAACTAGTTCTAAAAGATCAGAAGGATATTGCTTTAGAAATAACAGTGACAAACAGCCCTTCCAACCCAAGGAATC
CCACAAAAGATGGCGATGACGCCCATGAGGCTAAACTGATTGCAACGTTTCCAGACACTTTAACCTATTCTGCATATAGAGAACTGAGGG
CTTTCCCTGAGAAACAGTTGAGTTGTGTTGCCAACCAGAATGGCTCGCAAGCTGACTGTGAGCTCGGAAATCCTTTTAAAAGAAATTCAA
ATGTCACTTTTTATTTGGTTTTAAGTACAACTGAAGTCACCTTTGACACCCCAGATCTGGATATTAATCTGAAGTTAGAAACAACAAGCA
ATCAAGATAATTTGGCTCCAATTACAGCTAAAGCAAAAGTGGTTATTGAACTGCTTTTATCGGTCTCGGGAGTTGCTAAACCTTCCCAGG
TGTATTTTGGAGGTACAGTTGTTGGCGAGCAAGCTATGAAATCTGAAGATGAAGTGGGAAGTTTAATAGAGTATGAATTCAGGGTAATAA
ACTTAGGTAAACCTCTTACAAACCTCGGCACAGCAACCTTGAACATTCAGTGGCCAAAAGAAATTAGCAATGGGAAATGGTTGCTTTATT
TGGTGAAAGTAGAATCCAAAGGATTGGAAAAGGTAACTTGTGAGCCACAAAAGGAGATAAACTCCCTGAACCTAACGGAGTCTCACAACT
CAAGAAAGAAACGGGAAATTACTGAAAAACAGATAGATGATAACAGAAAATTTTCTTTATTTGCTGAAAGAAAATACCAGACTCTTAACT
GTAGCGTGAACGTGAACTGTGTGAACATCAGATGCCCGCTGCGGGGGCTGGACAGCAAGGCGTCTCTTATTTTGCGCTCGAGGTTATGGA
ACAGCACATTTCTAGAGGAATATTCCAAACTGAACTACTTGGACATTCTCATGCGAGCCTTCATTGATGTGACTGCTGCTGCCGAAAATA
TCAGGCTGCCAAATGCAGGCACTCAGAAACTGCCAAGCAAGTTCAAGAAGTTCTATGCGGAGTTTGAAAGTTTAATGGACCCTTCAAGGA
ACCACAGGGCCTACAGGCTGACAGTAGCTAAGCTGGAACCTCCTCTCATCCCCTTCATGCCTTTGCTCATTAAAGATATGACATTTACTC
ATGAGGGGAACAAGACGTTCATTGACAATCTAGTAAACTTTGAAAAAATGCGCATGATTGCAAATACGGCCAGAACAGTGAGATACTACA
GGAGCCAACCCTTCAATCCTGATGCAGCTCAAGCTAATAAGAACCATCAGGATGTCCGGAGTTATGTACGGCAATTAAATGTGATTGACA
ACCAGAGAACTTTATCACAGATGTCACACAGATTAGAGCCTCGTCGACCATAGACATTTCAAATGCCCAAAGCAACAGTTTGTCTCCAGT
CCACAATCTTTCAAAAATGCCATTTATGCTACTACTGACTGTATTGCCACTAGAGAATTCTACAAAACAAGCAAAAACACATCCTGAGAC
ACCTCAGGGCTGCATTCAGCTTACCAGCTACCTAGCAAGAGAAGGAATTATTTGACATGCCTAAAGCTTACACACTCTAGCTTAGGAATC
CCCAGTTTGTGGCTACCCTGTTTCATTTCCACTTGTGCCATCTTCTTTGCTGAAGTGTTGAATAAGGCCCACGTGAAGAGTTTGGTAGAA
ATAGCCTTGTCAAGAGAACTAGCAAGCCCCTGACATTTTTTTCTAAGAGTGTTTATGGGATGAGATGTGCTACAAATGGGATAGATTTGG
ATAAAATTTTAACTCAACATCTTGATTTGGAGCCTGGGGTTTCGGGAAGGTGTTGAGGAATCTATAGAAGTCCAAATTATAGGTTGTATT
CTTCCATCTTCATTGTCTTACCTCTGAAGGAATAGAACCTGACCACATTATTATGAAACATTATGGCTGTTTATGTAATTTAGGGAGGAC
TGGTCTGTAATTTCTGAATGTATATAGAATAATATTTATGTTTACAATGTAACTTTTCAAAATTTACAAATCAGGATTATATACATAAGA
ATTCCACTAAGAAATGCCAAGATTCTTAAATTTGCCAGCGTTAAAGTAGAAAATAACATTTCAGAAGAGCACAATATGCATAAAACATTT
TTCAAAATTGAAATATTTTCCTGGGCATTAAAAACCTTTACTATTGGCTACAAATTTATTGTACCTGATGAAAACATATTTTCTGGACTT
AAATGTTATTACAAATATCTTAATTTTCAGTAATTGTTTTGCACTTTCAAAGATTGTAAATAGTTCATTCAATCAATGGTATGGAGTTAT
TTATTTGCTACATAATAGATACTGTGCCAAATAATTACTTTTTATTTATTTTATTTAGTACGTAATTTTGAAGTACATTTTTTCCTGTTT
TCACAATTAGACTACATTTAATGTGTAGGAATTGTATGTATGTATATCTTCTGTAAATAACATCTAGTATCTTCACTAAATATAATTGTC

>In-frame_ITGA6_ENST00000264106_chr2_173356251_+_RAPGEF4_ENST00000264111_chr2_173898642_+_4813nt
AACGGGCTCATTCAGCGGTCGCGAGCTGCCCGCGAGGGGGAGCGGCCGGACGGAGAGCGCGACCCGTCCCGGGGGTGGGGCCGGGCGCAG
CGGCGAGAGGAGGCGAAGGTGGCTGCGGTAGCAGCAGCGCGGCAGCCTCGGACCCAGCCCGGAGCGCAGGGCGGCCGCTGCAGGTCCCCG
CTCCCCTCCCCGTGCGTCCGCCCATGGCCGCCGCCGGGCAGCTGTGCTTGCTCTACCTGTCGGCGGGGCTCCTGTCCCGGCTCGGCGCAG
CCTTCAACTTGGACACTCGGGAGGACAACGTGATCCGGAAATATGGAGACCCCGGGAGCCTCTTCGGCTTCTCGCTGGCCATGCACTGGC
AACTGCAGCCCGAGGACAAGCGGCTGTTGCTCGTGGGGGCCCCGCGGGCAGAAGCGCTTCCACTGCAGAGAGCCAACAGAACGGGAGGGC
TGTACAGCTGCGACATCACCGCCCGGGGGCCATGCACGCGGATCGAGTTTGATAACGATGCTGACCCCACGTCAGAAAGCAAGGAAGATC
AGTGGATGGGGGTCACCGTCCAGAGCCAAGGTCCAGGGGGCAAGGTCGTGACATGTGCTCACCGATATGAAAAAAGGCAGCATGTTAATA
CGAAGCAGGAATCCCGAGACATCTTTGGGCGGTGTTATGTCCTGAGTCAGAATCTCAGGATTGAAGACGATATGGATGGGGGAGATTGGA
GCTTTTGTGATGGGCGATTGAGAGGCCATGAGAAATTTGGCTCTTGCCAGCAAGGTGTAGCAGCTACTTTTACTAAAGACTTTCATTACA
TTGTATTTGGAGCCCCGGGTACTTATAACTGGAAAGGGATTGTTCGTGTAGAGCAAAAGAATAACACTTTTTTTGACATGAACATCTTTG
AAGATGGGCCTTATGAAGTTGGTGGAGAGACTGAGCATGATGAAAGTCTCGTTCCTGTTCCTGCTAACAGTTACTTAGGCCTGCTGTTTT
TGACCAGCGTTTCCTATACAGATCCTGATCAGTTTGTTTATAAAACACGGCCTCCCCGGGAGCAGCCTGACACATTCCCTGATGTGATGA
TGAATAGCTACCTAGGTTTTTCTTTGGACTCAGGGAAAGGTATTGTTTCTAAAGATGAGATCACTTTTGTATCTGGTGCTCCCAGAGCCA
ATCACAGTGGAGCCGTGGTTTTGCTGAAGAGAGACATGAAGTCTGCACATCTCCTCCCTGAGCACATATTCGATGGAGAAGGTCTGGCCT
CTTCATTTGGCTATGATGTGGCGGTGGTGGACCTCAACAAGGATGGGTGGCAAGATATAGTTATTGGAGCCCCACAGTATTTTGATAGAG
ATGGAGAAGTTGGAGGTGCAGTGTATGTCTACATGAACCAGCAAGGCAGATGGAATAATGTGAAGCCAATTCGTCTTAATGGAACCAAAG
ATTCTATGTTTGGCATTGCAGTAAAAAATATTGGAGATATTAATCAAGATGGCTACCCAGATATTGCAGTTGGAGCTCCGTATGATGACT
TGGGAAAGGTTTTTATCTATCATGGATCTGCAAATGGAATAAATACCAAACCAACACAGGTTCTCAAGGGTATATCACCTTATTTTGGAT
ATTCAATTGCTGGAAACATGGACCTTGATCGAAATTCCTACCCTGATGTTGCTGTTGGTTCCCTCTCAGATTCAGTAACTATTTTCAGAT
CCCGGCCTGTGATTAATATTCAGAAAACCATCACAGTAACTCCTAACAGAATTGACCTCCGCCAGAAAACAGCGTGTGGGGCGCCTAGTG
GGATATGCCTCCAGGTTAAATCCTGTTTTGAATATACTGCTAACCCCGCTGGTTATAATCCTTCAATATCAATTGTGGGCACACTTGAAG
CTGAAAAAGAAAGAAGAAAATCTGGGCTATCCTCAAGAGTTCAGTTTCGAAACCAAGGTTCTGAGCCCAAATATACTCAAGAACTAACTC
TGAAGAGGCAGAAACAGAAAGTGTGCATGGAGGAAACCCTGTGGCTACAGGATAATATCAGAGATAAACTGCGTCCCATTCCCATAACTG
CCTCAGTGGAGATCCAAGAGCCAAGCTCTCGTAGGCGAGTGAATTCACTTCCAGAAGTTCTTCCAATTCTGAATTCAGATGAACCCAAGA
CAGCTCATATTGATGTTCACTTCTTAAAAGAGGGATGTGGAGACGACAATGTATGTAACAGCAACCTTAAACTAGAATATAAATTTTGCA
CCCGAGAAGGAAATCAAGACAAATTTTCTTATTTACCAATTCAAAAAGGTGTACCAGAACTAGTTCTAAAAGATCAGAAGGATATTGCTT
TAGAAATAACAGTGACAAACAGCCCTTCCAACCCAAGGAATCCCACAAAAGATGGCGATGACGCCCATGAGGCTAAACTGATTGCAACGT
TTCCAGACACTTTAACCTATTCTGCATATAGAGAACTGAGGGCTTTCCCTGAGAAACAGTTGAGTTGTGTTGCCAACCAGAATGGCTCGC
AAGCTGACTGTGAGCTCGGAAATCCTTTTAAAAGAAATTCAAATGTCACTTTTTATTTGGTTTTAAGTACAACTGAAGTCACCTTTGACA
CCCCAGATCTGGATATTAATCTGAAGTTAGAAACAACAAGCAATCAAGATAATTTGGCTCCAATTACAGCTAAAGCAAAAGTGGTTATTG
AACTGCTTTTATCGGTCTCGGGAGTTGCTAAACCTTCCCAGGTGTATTTTGGAGGTACAGTTGTTGGCGAGCAAGCTATGAAATCTGAAG
ATGAAGTGGGAAGTTTAATAGAGTATGAATTCAGGGTAATAAACTTAGGTAAACCTCTTACAAACCTCGGCACAGCAACCTTGAACATTC
AGTGGCCAAAAGAAATTAGCAATGGGAAATGGTTGCTTTATTTGGTGAAAGTAGAATCCAAAGGATTGGAAAAGGTAACTTGTGAGCCAC
AAAAGGAGATAAACTCCCTGAACCTAACGGAGTCTCACAACTCAAGAAAGAAACGGGAAATTACTGAAAAACAGATAGATGATAACAGAA
AATTTTCTTTATTTGCTGAAAGAAAATACCAGACTCTTAACTGTAGCGTGAACGTGAACTGTGTGAACATCAGATGCCCGCTGCGGGGGC
TGGACAGCAAGGCGTCTCTTATTTTGCGCTCGAGGTTATGGAACAGCACATTTCTAGAGGAATATTCCAAACTGAACTACTTGGACATTC
TCATGCGAGCCTTCATTGATGTGACTGCTGCTGCCGAAAATATCAGGCTGCCAAATGCAGGCACTCAGAAACTGCCAAGCAAGTTCAAGA
AGTTCTATGCGGAGTTTGAAAGTTTAATGGACCCTTCAAGGAACCACAGGGCCTACAGGCTGACAGTAGCTAAGCTGGAACCTCCTCTCA
TCCCCTTCATGCCTTTGCTCATTAAAGATATGACATTTACTCATGAGGGGAACAAGACGTTCATTGACAATCTAGTAAACTTTGAAAAAA
TGCGCATGATTGCAAATACGGCCAGAACAGTGAGATACTACAGGAGCCAACCCTTCAATCCTGATGCAGCTCAAGCTAATAAGAACCATC
AGGATGTCCGGAGTTATGTACGGCAATTAAATGTGATTGACAACCAGAGAACTTTATCACAGATGTCACACAGATTAGAGCCTCGTCGAC
CATAGACATTTCAAATGCCCAAAGCAACAGTTTGTCTCCAGTCCACAATCTTTCAAAAATGCCATTTATGCTACTACTGACTGTATTGCC
ACTAGAGAATTCTACAAAACAAGCAAAAACACATCCTGAGACACCTCAGGGCTGCATTCAGCTTACCAGCTACCTAGCAAGAGAAGGAAT
TATTTGACATGCCTAAAGCTTACACACTCTAGCTTAGGAATCCCCAGTTTGTGGCTACCCTGTTTCATTTCCACTTGTGCCATCTTCTTT
GCTGAAGTGTTGAATAAGGCCCACGTGAAGAGTTTGGTAGAAATAGCCTTGTCAAGAGAACTAGCAAGCCCCTGACATTTTTTTCTAAGA
GTGTTTATGGGATGAGATGTGCTACAAATGGGATAGATTTGGATAAAATTTTAACTCAACATCTTGATTTGGAGCCTGGGGTTTCGGGAA
GGTGTTGAGGAATCTATAGAAGTCCAAATTATAGGTTGTATTCTTCCATCTTCATTGTCTTACCTCTGAAGGAATAGAACCTGACCACAT
TATTATGAAACATTATGGCTGTTTATGTAATTTAGGGAGGACTGGTCTGTAATTTCTGAATGTATATAGAATAATATTTATGTTTACAAT
GTAACTTTTCAAAATTTACAAATCAGGATTATATACATAAGAATTCCACTAAGAAATGCCAAGATTCTTAAATTTGCCAGCGTTAAAGTA
GAAAATAACATTTCAGAAGAGCACAATATGCATAAAACATTTTTCAAAATTGAAATATTTTCCTGGGCATTAAAAACCTTTACTATTGGC
TACAAATTTATTGTACCTGATGAAAACATATTTTCTGGACTTAAATGTTATTACAAATATCTTAATTTTCAGTAATTGTTTTGCACTTTC
AAAGATTGTAAATAGTTCATTCAATCAATGGTATGGAGTTATTTATTTGCTACATAATAGATACTGTGCCAAATAATTACTTTTTATTTA
TTTTATTTAGTACGTAATTTTGAAGTACATTTTTTCCTGTTTTCACAATTAGACTACATTTAATGTGTAGGAATTGTATGTATGTATATC

>In-frame_ITGA6_ENST00000264106_chr2_173356251_+_RAPGEF4_ENST00000397081_chr2_173898642_+_4815nt
AACGGGCTCATTCAGCGGTCGCGAGCTGCCCGCGAGGGGGAGCGGCCGGACGGAGAGCGCGACCCGTCCCGGGGGTGGGGCCGGGCGCAG
CGGCGAGAGGAGGCGAAGGTGGCTGCGGTAGCAGCAGCGCGGCAGCCTCGGACCCAGCCCGGAGCGCAGGGCGGCCGCTGCAGGTCCCCG
CTCCCCTCCCCGTGCGTCCGCCCATGGCCGCCGCCGGGCAGCTGTGCTTGCTCTACCTGTCGGCGGGGCTCCTGTCCCGGCTCGGCGCAG
CCTTCAACTTGGACACTCGGGAGGACAACGTGATCCGGAAATATGGAGACCCCGGGAGCCTCTTCGGCTTCTCGCTGGCCATGCACTGGC
AACTGCAGCCCGAGGACAAGCGGCTGTTGCTCGTGGGGGCCCCGCGGGCAGAAGCGCTTCCACTGCAGAGAGCCAACAGAACGGGAGGGC
TGTACAGCTGCGACATCACCGCCCGGGGGCCATGCACGCGGATCGAGTTTGATAACGATGCTGACCCCACGTCAGAAAGCAAGGAAGATC
AGTGGATGGGGGTCACCGTCCAGAGCCAAGGTCCAGGGGGCAAGGTCGTGACATGTGCTCACCGATATGAAAAAAGGCAGCATGTTAATA
CGAAGCAGGAATCCCGAGACATCTTTGGGCGGTGTTATGTCCTGAGTCAGAATCTCAGGATTGAAGACGATATGGATGGGGGAGATTGGA
GCTTTTGTGATGGGCGATTGAGAGGCCATGAGAAATTTGGCTCTTGCCAGCAAGGTGTAGCAGCTACTTTTACTAAAGACTTTCATTACA
TTGTATTTGGAGCCCCGGGTACTTATAACTGGAAAGGGATTGTTCGTGTAGAGCAAAAGAATAACACTTTTTTTGACATGAACATCTTTG
AAGATGGGCCTTATGAAGTTGGTGGAGAGACTGAGCATGATGAAAGTCTCGTTCCTGTTCCTGCTAACAGTTACTTAGGCCTGCTGTTTT
TGACCAGCGTTTCCTATACAGATCCTGATCAGTTTGTTTATAAAACACGGCCTCCCCGGGAGCAGCCTGACACATTCCCTGATGTGATGA
TGAATAGCTACCTAGGTTTTTCTTTGGACTCAGGGAAAGGTATTGTTTCTAAAGATGAGATCACTTTTGTATCTGGTGCTCCCAGAGCCA
ATCACAGTGGAGCCGTGGTTTTGCTGAAGAGAGACATGAAGTCTGCACATCTCCTCCCTGAGCACATATTCGATGGAGAAGGTCTGGCCT
CTTCATTTGGCTATGATGTGGCGGTGGTGGACCTCAACAAGGATGGGTGGCAAGATATAGTTATTGGAGCCCCACAGTATTTTGATAGAG
ATGGAGAAGTTGGAGGTGCAGTGTATGTCTACATGAACCAGCAAGGCAGATGGAATAATGTGAAGCCAATTCGTCTTAATGGAACCAAAG
ATTCTATGTTTGGCATTGCAGTAAAAAATATTGGAGATATTAATCAAGATGGCTACCCAGATATTGCAGTTGGAGCTCCGTATGATGACT
TGGGAAAGGTTTTTATCTATCATGGATCTGCAAATGGAATAAATACCAAACCAACACAGGTTCTCAAGGGTATATCACCTTATTTTGGAT
ATTCAATTGCTGGAAACATGGACCTTGATCGAAATTCCTACCCTGATGTTGCTGTTGGTTCCCTCTCAGATTCAGTAACTATTTTCAGAT
CCCGGCCTGTGATTAATATTCAGAAAACCATCACAGTAACTCCTAACAGAATTGACCTCCGCCAGAAAACAGCGTGTGGGGCGCCTAGTG
GGATATGCCTCCAGGTTAAATCCTGTTTTGAATATACTGCTAACCCCGCTGGTTATAATCCTTCAATATCAATTGTGGGCACACTTGAAG
CTGAAAAAGAAAGAAGAAAATCTGGGCTATCCTCAAGAGTTCAGTTTCGAAACCAAGGTTCTGAGCCCAAATATACTCAAGAACTAACTC
TGAAGAGGCAGAAACAGAAAGTGTGCATGGAGGAAACCCTGTGGCTACAGGATAATATCAGAGATAAACTGCGTCCCATTCCCATAACTG
CCTCAGTGGAGATCCAAGAGCCAAGCTCTCGTAGGCGAGTGAATTCACTTCCAGAAGTTCTTCCAATTCTGAATTCAGATGAACCCAAGA
CAGCTCATATTGATGTTCACTTCTTAAAAGAGGGATGTGGAGACGACAATGTATGTAACAGCAACCTTAAACTAGAATATAAATTTTGCA
CCCGAGAAGGAAATCAAGACAAATTTTCTTATTTACCAATTCAAAAAGGTGTACCAGAACTAGTTCTAAAAGATCAGAAGGATATTGCTT
TAGAAATAACAGTGACAAACAGCCCTTCCAACCCAAGGAATCCCACAAAAGATGGCGATGACGCCCATGAGGCTAAACTGATTGCAACGT
TTCCAGACACTTTAACCTATTCTGCATATAGAGAACTGAGGGCTTTCCCTGAGAAACAGTTGAGTTGTGTTGCCAACCAGAATGGCTCGC
AAGCTGACTGTGAGCTCGGAAATCCTTTTAAAAGAAATTCAAATGTCACTTTTTATTTGGTTTTAAGTACAACTGAAGTCACCTTTGACA
CCCCAGATCTGGATATTAATCTGAAGTTAGAAACAACAAGCAATCAAGATAATTTGGCTCCAATTACAGCTAAAGCAAAAGTGGTTATTG
AACTGCTTTTATCGGTCTCGGGAGTTGCTAAACCTTCCCAGGTGTATTTTGGAGGTACAGTTGTTGGCGAGCAAGCTATGAAATCTGAAG
ATGAAGTGGGAAGTTTAATAGAGTATGAATTCAGGGTAATAAACTTAGGTAAACCTCTTACAAACCTCGGCACAGCAACCTTGAACATTC
AGTGGCCAAAAGAAATTAGCAATGGGAAATGGTTGCTTTATTTGGTGAAAGTAGAATCCAAAGGATTGGAAAAGGTAACTTGTGAGCCAC
AAAAGGAGATAAACTCCCTGAACCTAACGGAGTCTCACAACTCAAGAAAGAAACGGGAAATTACTGAAAAACAGATAGATGATAACAGAA
AATTTTCTTTATTTGCTGAAAGAAAATACCAGACTCTTAACTGTAGCGTGAACGTGAACTGTGTGAACATCAGATGCCCGCTGCGGGGGC
TGGACAGCAAGGCGTCTCTTATTTTGCGCTCGAGGTTATGGAACAGCACATTTCTAGAGGAATATTCCAAACTGAACTACTTGGACATTC
TCATGCGAGCCTTCATTGATGTGACTGCTGCTGCCGAAAATATCAGGCTGCCAAATGCAGGCACTCAGAAACTGCCAAGCAAGTTCAAGA
AGTTCTATGCGGAGTTTGAAAGTTTAATGGACCCTTCAAGGAACCACAGGGCCTACAGGCTGACAGTAGCTAAGCTGGAACCTCCTCTCA
TCCCCTTCATGCCTTTGCTCATTAAAGATATGACATTTACTCATGAGGGGAACAAGACGTTCATTGACAATCTAGTAAACTTTGAAAAAA
TGCGCATGATTGCAAATACGGCCAGAACAGTGAGATACTACAGGAGCCAACCCTTCAATCCTGATGCAGCTCAAGCTAATAAGAACCATC
AGGATGTCCGGAGTTATGTACGGCAATTAAATGTGATTGACAACCAGAGAACTTTATCACAGATGTCACACAGATTAGAGCCTCGTCGAC
CATAGACATTTCAAATGCCCAAAGCAACAGTTTGTCTCCAGTCCACAATCTTTCAAAAATGCCATTTATGCTACTACTGACTGTATTGCC
ACTAGAGAATTCTACAAAACAAGCAAAAACACATCCTGAGACACCTCAGGGCTGCATTCAGCTTACCAGCTACCTAGCAAGAGAAGGAAT
TATTTGACATGCCTAAAGCTTACACACTCTAGCTTAGGAATCCCCAGTTTGTGGCTACCCTGTTTCATTTCCACTTGTGCCATCTTCTTT
GCTGAAGTGTTGAATAAGGCCCACGTGAAGAGTTTGGTAGAAATAGCCTTGTCAAGAGAACTAGCAAGCCCCTGACATTTTTTTCTAAGA
GTGTTTATGGGATGAGATGTGCTACAAATGGGATAGATTTGGATAAAATTTTAACTCAACATCTTGATTTGGAGCCTGGGGTTTCGGGAA
GGTGTTGAGGAATCTATAGAAGTCCAAATTATAGGTTGTATTCTTCCATCTTCATTGTCTTACCTCTGAAGGAATAGAACCTGACCACAT
TATTATGAAACATTATGGCTGTTTATGTAATTTAGGGAGGACTGGTCTGTAATTTCTGAATGTATATAGAATAATATTTATGTTTACAAT
GTAACTTTTCAAAATTTACAAATCAGGATTATATACATAAGAATTCCACTAAGAAATGCCAAGATTCTTAAATTTGCCAGCGTTAAAGTA
GAAAATAACATTTCAGAAGAGCACAATATGCATAAAACATTTTTCAAAATTGAAATATTTTCCTGGGCATTAAAAACCTTTACTATTGGC
TACAAATTTATTGTACCTGATGAAAACATATTTTCTGGACTTAAATGTTATTACAAATATCTTAATTTTCAGTAATTGTTTTGCACTTTC
AAAGATTGTAAATAGTTCATTCAATCAATGGTATGGAGTTATTTATTTGCTACATAATAGATACTGTGCCAAATAATTACTTTTTATTTA
TTTTATTTAGTACGTAATTTTGAAGTACATTTTTTCCTGTTTTCACAATTAGACTACATTTAATGTGTAGGAATTGTATGTATGTATATC

>In-frame_ITGA6_ENST00000375221_chr2_173356251_+_RAPGEF4_ENST00000264111_chr2_173898642_+_4813nt
AACGGGCTCATTCAGCGGTCGCGAGCTGCCCGCGAGGGGGAGCGGCCGGACGGAGAGCGCGACCCGTCCCGGGGGTGGGGCCGGGCGCAG
CGGCGAGAGGAGGCGAAGGTGGCTGCGGTAGCAGCAGCGCGGCAGCCTCGGACCCAGCCCGGAGCGCAGGGCGGCCGCTGCAGGTCCCCG
CTCCCCTCCCCGTGCGTCCGCCCATGGCCGCCGCCGGGCAGCTGTGCTTGCTCTACCTGTCGGCGGGGCTCCTGTCCCGGCTCGGCGCAG
CCTTCAACTTGGACACTCGGGAGGACAACGTGATCCGGAAATATGGAGACCCCGGGAGCCTCTTCGGCTTCTCGCTGGCCATGCACTGGC
AACTGCAGCCCGAGGACAAGCGGCTGTTGCTCGTGGGGGCCCCGCGGGCAGAAGCGCTTCCACTGCAGAGAGCCAACAGAACGGGAGGGC
TGTACAGCTGCGACATCACCGCCCGGGGGCCATGCACGCGGATCGAGTTTGATAACGATGCTGACCCCACGTCAGAAAGCAAGGAAGATC
AGTGGATGGGGGTCACCGTCCAGAGCCAAGGTCCAGGGGGCAAGGTCGTGACATGTGCTCACCGATATGAAAAAAGGCAGCATGTTAATA
CGAAGCAGGAATCCCGAGACATCTTTGGGCGGTGTTATGTCCTGAGTCAGAATCTCAGGATTGAAGACGATATGGATGGGGGAGATTGGA
GCTTTTGTGATGGGCGATTGAGAGGCCATGAGAAATTTGGCTCTTGCCAGCAAGGTGTAGCAGCTACTTTTACTAAAGACTTTCATTACA
TTGTATTTGGAGCCCCGGGTACTTATAACTGGAAAGGGATTGTTCGTGTAGAGCAAAAGAATAACACTTTTTTTGACATGAACATCTTTG
AAGATGGGCCTTATGAAGTTGGTGGAGAGACTGAGCATGATGAAAGTCTCGTTCCTGTTCCTGCTAACAGTTACTTAGGCCTGCTGTTTT
TGACCAGCGTTTCCTATACAGATCCTGATCAGTTTGTTTATAAAACACGGCCTCCCCGGGAGCAGCCTGACACATTCCCTGATGTGATGA
TGAATAGCTACCTAGGTTTTTCTTTGGACTCAGGGAAAGGTATTGTTTCTAAAGATGAGATCACTTTTGTATCTGGTGCTCCCAGAGCCA
ATCACAGTGGAGCCGTGGTTTTGCTGAAGAGAGACATGAAGTCTGCACATCTCCTCCCTGAGCACATATTCGATGGAGAAGGTCTGGCCT
CTTCATTTGGCTATGATGTGGCGGTGGTGGACCTCAACAAGGATGGGTGGCAAGATATAGTTATTGGAGCCCCACAGTATTTTGATAGAG
ATGGAGAAGTTGGAGGTGCAGTGTATGTCTACATGAACCAGCAAGGCAGATGGAATAATGTGAAGCCAATTCGTCTTAATGGAACCAAAG
ATTCTATGTTTGGCATTGCAGTAAAAAATATTGGAGATATTAATCAAGATGGCTACCCAGATATTGCAGTTGGAGCTCCGTATGATGACT
TGGGAAAGGTTTTTATCTATCATGGATCTGCAAATGGAATAAATACCAAACCAACACAGGTTCTCAAGGGTATATCACCTTATTTTGGAT
ATTCAATTGCTGGAAACATGGACCTTGATCGAAATTCCTACCCTGATGTTGCTGTTGGTTCCCTCTCAGATTCAGTAACTATTTTCAGAT
CCCGGCCTGTGATTAATATTCAGAAAACCATCACAGTAACTCCTAACAGAATTGACCTCCGCCAGAAAACAGCGTGTGGGGCGCCTAGTG
GGATATGCCTCCAGGTTAAATCCTGTTTTGAATATACTGCTAACCCCGCTGGTTATAATCCTTCAATATCAATTGTGGGCACACTTGAAG
CTGAAAAAGAAAGAAGAAAATCTGGGCTATCCTCAAGAGTTCAGTTTCGAAACCAAGGTTCTGAGCCCAAATATACTCAAGAACTAACTC
TGAAGAGGCAGAAACAGAAAGTGTGCATGGAGGAAACCCTGTGGCTACAGGATAATATCAGAGATAAACTGCGTCCCATTCCCATAACTG
CCTCAGTGGAGATCCAAGAGCCAAGCTCTCGTAGGCGAGTGAATTCACTTCCAGAAGTTCTTCCAATTCTGAATTCAGATGAACCCAAGA
CAGCTCATATTGATGTTCACTTCTTAAAAGAGGGATGTGGAGACGACAATGTATGTAACAGCAACCTTAAACTAGAATATAAATTTTGCA
CCCGAGAAGGAAATCAAGACAAATTTTCTTATTTACCAATTCAAAAAGGTGTACCAGAACTAGTTCTAAAAGATCAGAAGGATATTGCTT
TAGAAATAACAGTGACAAACAGCCCTTCCAACCCAAGGAATCCCACAAAAGATGGCGATGACGCCCATGAGGCTAAACTGATTGCAACGT
TTCCAGACACTTTAACCTATTCTGCATATAGAGAACTGAGGGCTTTCCCTGAGAAACAGTTGAGTTGTGTTGCCAACCAGAATGGCTCGC
AAGCTGACTGTGAGCTCGGAAATCCTTTTAAAAGAAATTCAAATGTCACTTTTTATTTGGTTTTAAGTACAACTGAAGTCACCTTTGACA
CCCCAGATCTGGATATTAATCTGAAGTTAGAAACAACAAGCAATCAAGATAATTTGGCTCCAATTACAGCTAAAGCAAAAGTGGTTATTG
AACTGCTTTTATCGGTCTCGGGAGTTGCTAAACCTTCCCAGGTGTATTTTGGAGGTACAGTTGTTGGCGAGCAAGCTATGAAATCTGAAG
ATGAAGTGGGAAGTTTAATAGAGTATGAATTCAGGGTAATAAACTTAGGTAAACCTCTTACAAACCTCGGCACAGCAACCTTGAACATTC
AGTGGCCAAAAGAAATTAGCAATGGGAAATGGTTGCTTTATTTGGTGAAAGTAGAATCCAAAGGATTGGAAAAGGTAACTTGTGAGCCAC
AAAAGGAGATAAACTCCCTGAACCTAACGGAGTCTCACAACTCAAGAAAGAAACGGGAAATTACTGAAAAACAGATAGATGATAACAGAA
AATTTTCTTTATTTGCTGAAAGAAAATACCAGACTCTTAACTGTAGCGTGAACGTGAACTGTGTGAACATCAGATGCCCGCTGCGGGGGC
TGGACAGCAAGGCGTCTCTTATTTTGCGCTCGAGGTTATGGAACAGCACATTTCTAGAGGAATATTCCAAACTGAACTACTTGGACATTC
TCATGCGAGCCTTCATTGATGTGACTGCTGCTGCCGAAAATATCAGGCTGCCAAATGCAGGCACTCAGAAACTGCCAAGCAAGTTCAAGA
AGTTCTATGCGGAGTTTGAAAGTTTAATGGACCCTTCAAGGAACCACAGGGCCTACAGGCTGACAGTAGCTAAGCTGGAACCTCCTCTCA
TCCCCTTCATGCCTTTGCTCATTAAAGATATGACATTTACTCATGAGGGGAACAAGACGTTCATTGACAATCTAGTAAACTTTGAAAAAA
TGCGCATGATTGCAAATACGGCCAGAACAGTGAGATACTACAGGAGCCAACCCTTCAATCCTGATGCAGCTCAAGCTAATAAGAACCATC
AGGATGTCCGGAGTTATGTACGGCAATTAAATGTGATTGACAACCAGAGAACTTTATCACAGATGTCACACAGATTAGAGCCTCGTCGAC
CATAGACATTTCAAATGCCCAAAGCAACAGTTTGTCTCCAGTCCACAATCTTTCAAAAATGCCATTTATGCTACTACTGACTGTATTGCC
ACTAGAGAATTCTACAAAACAAGCAAAAACACATCCTGAGACACCTCAGGGCTGCATTCAGCTTACCAGCTACCTAGCAAGAGAAGGAAT
TATTTGACATGCCTAAAGCTTACACACTCTAGCTTAGGAATCCCCAGTTTGTGGCTACCCTGTTTCATTTCCACTTGTGCCATCTTCTTT
GCTGAAGTGTTGAATAAGGCCCACGTGAAGAGTTTGGTAGAAATAGCCTTGTCAAGAGAACTAGCAAGCCCCTGACATTTTTTTCTAAGA
GTGTTTATGGGATGAGATGTGCTACAAATGGGATAGATTTGGATAAAATTTTAACTCAACATCTTGATTTGGAGCCTGGGGTTTCGGGAA
GGTGTTGAGGAATCTATAGAAGTCCAAATTATAGGTTGTATTCTTCCATCTTCATTGTCTTACCTCTGAAGGAATAGAACCTGACCACAT
TATTATGAAACATTATGGCTGTTTATGTAATTTAGGGAGGACTGGTCTGTAATTTCTGAATGTATATAGAATAATATTTATGTTTACAAT
GTAACTTTTCAAAATTTACAAATCAGGATTATATACATAAGAATTCCACTAAGAAATGCCAAGATTCTTAAATTTGCCAGCGTTAAAGTA
GAAAATAACATTTCAGAAGAGCACAATATGCATAAAACATTTTTCAAAATTGAAATATTTTCCTGGGCATTAAAAACCTTTACTATTGGC
TACAAATTTATTGTACCTGATGAAAACATATTTTCTGGACTTAAATGTTATTACAAATATCTTAATTTTCAGTAATTGTTTTGCACTTTC
AAAGATTGTAAATAGTTCATTCAATCAATGGTATGGAGTTATTTATTTGCTACATAATAGATACTGTGCCAAATAATTACTTTTTATTTA
TTTTATTTAGTACGTAATTTTGAAGTACATTTTTTCCTGTTTTCACAATTAGACTACATTTAATGTGTAGGAATTGTATGTATGTATATC

>In-frame_ITGA6_ENST00000375221_chr2_173356251_+_RAPGEF4_ENST00000397081_chr2_173898642_+_4815nt
AACGGGCTCATTCAGCGGTCGCGAGCTGCCCGCGAGGGGGAGCGGCCGGACGGAGAGCGCGACCCGTCCCGGGGGTGGGGCCGGGCGCAG
CGGCGAGAGGAGGCGAAGGTGGCTGCGGTAGCAGCAGCGCGGCAGCCTCGGACCCAGCCCGGAGCGCAGGGCGGCCGCTGCAGGTCCCCG
CTCCCCTCCCCGTGCGTCCGCCCATGGCCGCCGCCGGGCAGCTGTGCTTGCTCTACCTGTCGGCGGGGCTCCTGTCCCGGCTCGGCGCAG
CCTTCAACTTGGACACTCGGGAGGACAACGTGATCCGGAAATATGGAGACCCCGGGAGCCTCTTCGGCTTCTCGCTGGCCATGCACTGGC
AACTGCAGCCCGAGGACAAGCGGCTGTTGCTCGTGGGGGCCCCGCGGGCAGAAGCGCTTCCACTGCAGAGAGCCAACAGAACGGGAGGGC
TGTACAGCTGCGACATCACCGCCCGGGGGCCATGCACGCGGATCGAGTTTGATAACGATGCTGACCCCACGTCAGAAAGCAAGGAAGATC
AGTGGATGGGGGTCACCGTCCAGAGCCAAGGTCCAGGGGGCAAGGTCGTGACATGTGCTCACCGATATGAAAAAAGGCAGCATGTTAATA
CGAAGCAGGAATCCCGAGACATCTTTGGGCGGTGTTATGTCCTGAGTCAGAATCTCAGGATTGAAGACGATATGGATGGGGGAGATTGGA
GCTTTTGTGATGGGCGATTGAGAGGCCATGAGAAATTTGGCTCTTGCCAGCAAGGTGTAGCAGCTACTTTTACTAAAGACTTTCATTACA
TTGTATTTGGAGCCCCGGGTACTTATAACTGGAAAGGGATTGTTCGTGTAGAGCAAAAGAATAACACTTTTTTTGACATGAACATCTTTG
AAGATGGGCCTTATGAAGTTGGTGGAGAGACTGAGCATGATGAAAGTCTCGTTCCTGTTCCTGCTAACAGTTACTTAGGCCTGCTGTTTT
TGACCAGCGTTTCCTATACAGATCCTGATCAGTTTGTTTATAAAACACGGCCTCCCCGGGAGCAGCCTGACACATTCCCTGATGTGATGA
TGAATAGCTACCTAGGTTTTTCTTTGGACTCAGGGAAAGGTATTGTTTCTAAAGATGAGATCACTTTTGTATCTGGTGCTCCCAGAGCCA
ATCACAGTGGAGCCGTGGTTTTGCTGAAGAGAGACATGAAGTCTGCACATCTCCTCCCTGAGCACATATTCGATGGAGAAGGTCTGGCCT
CTTCATTTGGCTATGATGTGGCGGTGGTGGACCTCAACAAGGATGGGTGGCAAGATATAGTTATTGGAGCCCCACAGTATTTTGATAGAG
ATGGAGAAGTTGGAGGTGCAGTGTATGTCTACATGAACCAGCAAGGCAGATGGAATAATGTGAAGCCAATTCGTCTTAATGGAACCAAAG
ATTCTATGTTTGGCATTGCAGTAAAAAATATTGGAGATATTAATCAAGATGGCTACCCAGATATTGCAGTTGGAGCTCCGTATGATGACT
TGGGAAAGGTTTTTATCTATCATGGATCTGCAAATGGAATAAATACCAAACCAACACAGGTTCTCAAGGGTATATCACCTTATTTTGGAT
ATTCAATTGCTGGAAACATGGACCTTGATCGAAATTCCTACCCTGATGTTGCTGTTGGTTCCCTCTCAGATTCAGTAACTATTTTCAGAT
CCCGGCCTGTGATTAATATTCAGAAAACCATCACAGTAACTCCTAACAGAATTGACCTCCGCCAGAAAACAGCGTGTGGGGCGCCTAGTG
GGATATGCCTCCAGGTTAAATCCTGTTTTGAATATACTGCTAACCCCGCTGGTTATAATCCTTCAATATCAATTGTGGGCACACTTGAAG
CTGAAAAAGAAAGAAGAAAATCTGGGCTATCCTCAAGAGTTCAGTTTCGAAACCAAGGTTCTGAGCCCAAATATACTCAAGAACTAACTC
TGAAGAGGCAGAAACAGAAAGTGTGCATGGAGGAAACCCTGTGGCTACAGGATAATATCAGAGATAAACTGCGTCCCATTCCCATAACTG
CCTCAGTGGAGATCCAAGAGCCAAGCTCTCGTAGGCGAGTGAATTCACTTCCAGAAGTTCTTCCAATTCTGAATTCAGATGAACCCAAGA
CAGCTCATATTGATGTTCACTTCTTAAAAGAGGGATGTGGAGACGACAATGTATGTAACAGCAACCTTAAACTAGAATATAAATTTTGCA
CCCGAGAAGGAAATCAAGACAAATTTTCTTATTTACCAATTCAAAAAGGTGTACCAGAACTAGTTCTAAAAGATCAGAAGGATATTGCTT
TAGAAATAACAGTGACAAACAGCCCTTCCAACCCAAGGAATCCCACAAAAGATGGCGATGACGCCCATGAGGCTAAACTGATTGCAACGT
TTCCAGACACTTTAACCTATTCTGCATATAGAGAACTGAGGGCTTTCCCTGAGAAACAGTTGAGTTGTGTTGCCAACCAGAATGGCTCGC
AAGCTGACTGTGAGCTCGGAAATCCTTTTAAAAGAAATTCAAATGTCACTTTTTATTTGGTTTTAAGTACAACTGAAGTCACCTTTGACA
CCCCAGATCTGGATATTAATCTGAAGTTAGAAACAACAAGCAATCAAGATAATTTGGCTCCAATTACAGCTAAAGCAAAAGTGGTTATTG
AACTGCTTTTATCGGTCTCGGGAGTTGCTAAACCTTCCCAGGTGTATTTTGGAGGTACAGTTGTTGGCGAGCAAGCTATGAAATCTGAAG
ATGAAGTGGGAAGTTTAATAGAGTATGAATTCAGGGTAATAAACTTAGGTAAACCTCTTACAAACCTCGGCACAGCAACCTTGAACATTC
AGTGGCCAAAAGAAATTAGCAATGGGAAATGGTTGCTTTATTTGGTGAAAGTAGAATCCAAAGGATTGGAAAAGGTAACTTGTGAGCCAC
AAAAGGAGATAAACTCCCTGAACCTAACGGAGTCTCACAACTCAAGAAAGAAACGGGAAATTACTGAAAAACAGATAGATGATAACAGAA
AATTTTCTTTATTTGCTGAAAGAAAATACCAGACTCTTAACTGTAGCGTGAACGTGAACTGTGTGAACATCAGATGCCCGCTGCGGGGGC
TGGACAGCAAGGCGTCTCTTATTTTGCGCTCGAGGTTATGGAACAGCACATTTCTAGAGGAATATTCCAAACTGAACTACTTGGACATTC
TCATGCGAGCCTTCATTGATGTGACTGCTGCTGCCGAAAATATCAGGCTGCCAAATGCAGGCACTCAGAAACTGCCAAGCAAGTTCAAGA
AGTTCTATGCGGAGTTTGAAAGTTTAATGGACCCTTCAAGGAACCACAGGGCCTACAGGCTGACAGTAGCTAAGCTGGAACCTCCTCTCA
TCCCCTTCATGCCTTTGCTCATTAAAGATATGACATTTACTCATGAGGGGAACAAGACGTTCATTGACAATCTAGTAAACTTTGAAAAAA
TGCGCATGATTGCAAATACGGCCAGAACAGTGAGATACTACAGGAGCCAACCCTTCAATCCTGATGCAGCTCAAGCTAATAAGAACCATC
AGGATGTCCGGAGTTATGTACGGCAATTAAATGTGATTGACAACCAGAGAACTTTATCACAGATGTCACACAGATTAGAGCCTCGTCGAC
CATAGACATTTCAAATGCCCAAAGCAACAGTTTGTCTCCAGTCCACAATCTTTCAAAAATGCCATTTATGCTACTACTGACTGTATTGCC
ACTAGAGAATTCTACAAAACAAGCAAAAACACATCCTGAGACACCTCAGGGCTGCATTCAGCTTACCAGCTACCTAGCAAGAGAAGGAAT
TATTTGACATGCCTAAAGCTTACACACTCTAGCTTAGGAATCCCCAGTTTGTGGCTACCCTGTTTCATTTCCACTTGTGCCATCTTCTTT
GCTGAAGTGTTGAATAAGGCCCACGTGAAGAGTTTGGTAGAAATAGCCTTGTCAAGAGAACTAGCAAGCCCCTGACATTTTTTTCTAAGA
GTGTTTATGGGATGAGATGTGCTACAAATGGGATAGATTTGGATAAAATTTTAACTCAACATCTTGATTTGGAGCCTGGGGTTTCGGGAA
GGTGTTGAGGAATCTATAGAAGTCCAAATTATAGGTTGTATTCTTCCATCTTCATTGTCTTACCTCTGAAGGAATAGAACCTGACCACAT
TATTATGAAACATTATGGCTGTTTATGTAATTTAGGGAGGACTGGTCTGTAATTTCTGAATGTATATAGAATAATATTTATGTTTACAAT
GTAACTTTTCAAAATTTACAAATCAGGATTATATACATAAGAATTCCACTAAGAAATGCCAAGATTCTTAAATTTGCCAGCGTTAAAGTA
GAAAATAACATTTCAGAAGAGCACAATATGCATAAAACATTTTTCAAAATTGAAATATTTTCCTGGGCATTAAAAACCTTTACTATTGGC
TACAAATTTATTGTACCTGATGAAAACATATTTTCTGGACTTAAATGTTATTACAAATATCTTAATTTTCAGTAATTGTTTTGCACTTTC
AAAGATTGTAAATAGTTCATTCAATCAATGGTATGGAGTTATTTATTTGCTACATAATAGATACTGTGCCAAATAATTACTTTTTATTTA
TTTTATTTAGTACGTAATTTTGAAGTACATTTTTTCCTGTTTTCACAATTAGACTACATTTAATGTGTAGGAATTGTATGTATGTATATC

>In-frame_ITGA6_ENST00000409080_chr2_173356251_+_RAPGEF4_ENST00000264111_chr2_173898642_+_4493nt
ATGGCCGCCGCCGGGCAGCTGTGCTTGCTCTACCTGTCGGCGGGGCTCCTGTCCCGGCTCGGCGCAGCCTTCAACTTGGACACTCGGGAG
GACAACGTGATCCGGAAATATGGAGACCCCGGGAGCCTCTTCGGCTTCTCGCTGGCCATGCACTGGCAACTGCAGCCCGAGGACAAGCGG
CTGTTGCTCGTGGGGGCCCCGCGGGCAGAAGCGCTTCCACTGCAGAGAGCCAACAGAACGGGAGGGCTGTACAGCTGCGACATCACCGCC
CGGGGGCCATGCACGCGGATCGAGTTTGATAACGATGCTGACCCCACGTCAGAAAGCAAGGAAGATCAGTGGATGGGGGTCACCGTCCAG
AGCCAAGGTCCAGGGGGCAAGGTCGTGACATGTGCTCACCGATATGAAAAAAGGCAGCATGTTAATACGAAGCAGGAATCCCGAGACATC
TTTGGGCGGTGTTATGTCCTGAGTCAGAATCTCAGGATTGAAGACGATATGGATGGGGGAGATTGGAGCTTTTGTGATGGGCGATTGAGA
GGCCATGAGAAATTTGGCTCTTGCCAGCAAGGTGTAGCAGCTACTTTTACTAAAGACTTTCATTACATTGTATTTGGAGCCCCGGGTACT
TATAACTGGAAAGGGATTGTTCGTGTAGAGCAAAAGAATAACACTTTTTTTGACATGAACATCTTTGAAGATGGGCCTTATGAAGTTGGT
GGAGAGACTGAGCATGATGAAAGTCTCGTTCCTGTTCCTGCTAACAGTTACTTAGGTTTTTCTTTGGACTCAGGGAAAGGTATTGTTTCT
AAAGATGAGATCACTTTTGTATCTGGTGCTCCCAGAGCCAATCACAGTGGAGCCGTGGTTTTGCTGAAGAGAGACATGAAGTCTGCACAT
CTCCTCCCTGAGCACATATTCGATGGAGAAGGTCTGGCCTCTTCATTTGGCTATGATGTGGCGGTGGTGGACCTCAACAAGGATGGGTGG
CAAGATATAGTTATTGGAGCCCCACAGTATTTTGATAGAGATGGAGAAGTTGGAGGTGCAGTGTATGTCTACATGAACCAGCAAGGCAGA
TGGAATAATGTGAAGCCAATTCGTCTTAATGGAACCAAAGATTCTATGTTTGGCATTGCAGTAAAAAATATTGGAGATATTAATCAAGAT
GGCTACCCAGATATTGCAGTTGGAGCTCCGTATGATGACTTGGGAAAGGTTTTTATCTATCATGGATCTGCAAATGGAATAAATACCAAA
CCAACACAGGTTCTCAAGGGTATATCACCTTATTTTGGATATTCAATTGCTGGAAACATGGACCTTGATCGAAATTCCTACCCTGATGTT
GCTGTTGGTTCCCTCTCAGATTCAGTAACTATTTTCAGATCCCGGCCTGTGATTAATATTCAGAAAACCATCACAGTAACTCCTAACAGA
ATTGACCTCCGCCAGAAAACAGCGTGTGGGGCGCCTAGTGGGATATGCCTCCAGGTTAAATCCTGTTTTGAATATACTGCTAACCCCGCT
GGTTATAATCCTTCAATATCAATTGTGGGCACACTTGAAGCTGAAAAAGAAAGAAGAAAATCTGGGCTATCCTCAAGAGTTCAGTTTCGA
AACCAAGGTTCTGAGCCCAAATATACTCAAGAACTAACTCTGAAGAGGCAGAAACAGAAAGTGTGCATGGAGGAAACCCTGTGGCTACAG
GATAATATCAGAGATAAACTGCGTCCCATTCCCATAACTGCCTCAGTGGAGATCCAAGAGCCAAGCTCTCGTAGGCGAGTGAATTCACTT
CCAGAAGTTCTTCCAATTCTGAATTCAGATGAACCCAAGACAGCTCATATTGATGTTCACTTCTTAAAAGAGGGATGTGGAGACGACAAT
GTATGTAACAGCAACCTTAAACTAGAATATAAATTTTGCACCCGAGAAGGAAATCAAGACAAATTTTCTTATTTACCAATTCAAAAAGGT
GTACCAGAACTAGTTCTAAAAGATCAGAAGGATATTGCTTTAGAAATAACAGTGACAAACAGCCCTTCCAACCCAAGGAATCCCACAAAA
GATGGCGATGACGCCCATGAGGCTAAACTGATTGCAACGTTTCCAGACACTTTAACCTATTCTGCATATAGAGAACTGAGGGCTTTCCCT
GAGAAACAGTTGAGTTGTGTTGCCAACCAGAATGGCTCGCAAGCTGACTGTGAGCTCGGAAATCCTTTTAAAAGAAATTCAAATGTCACT
TTTTATTTGGTTTTAAGTACAACTGAAGTCACCTTTGACACCCCAGATCTGGATATTAATCTGAAGTTAGAAACAACAAGCAATCAAGAT
AATTTGGCTCCAATTACAGCTAAAGCAAAAGTGGTTATTGAACTGCTTTTATCGGTCTCGGGAGTTGCTAAACCTTCCCAGGTGTATTTT
GGAGGTACAGTTGTTGGCGAGCAAGCTATGAAATCTGAAGATGAAGTGGGAAGTTTAATAGAGTATGAATTCAGGGTAATAAACTTAGGT
AAACCTCTTACAAACCTCGGCACAGCAACCTTGAACATTCAGTGGCCAAAAGAAATTAGCAATGGGAAATGGTTGCTTTATTTGGTGAAA
GTAGAATCCAAAGGATTGGAAAAGGTAACTTGTGAGCCACAAAAGGAGATAAACTCCCTGAACCTAACGGAGTCTCACAACTCAAGAAAG
AAACGGGAAATTACTGAAAAACAGATAGATGATAACAGAAAATTTTCTTTATTTGCTGAAAGAAAATACCAGACTCTTAACTGTAGCGTG
AACGTGAACTGTGTGAACATCAGATGCCCGCTGCGGGGGCTGGACAGCAAGGCGTCTCTTATTTTGCGCTCGAGGTTATGGAACAGCACA
TTTCTAGAGGAATATTCCAAACTGAACTACTTGGACATTCTCATGCGAGCCTTCATTGATGTGACTGCTGCTGCCGAAAATATCAGGCTG
CCAAATGCAGGCACTCAGAAACTGCCAAGCAAGTTCAAGAAGTTCTATGCGGAGTTTGAAAGTTTAATGGACCCTTCAAGGAACCACAGG
GCCTACAGGCTGACAGTAGCTAAGCTGGAACCTCCTCTCATCCCCTTCATGCCTTTGCTCATTAAAGATATGACATTTACTCATGAGGGG
AACAAGACGTTCATTGACAATCTAGTAAACTTTGAAAAAATGCGCATGATTGCAAATACGGCCAGAACAGTGAGATACTACAGGAGCCAA
CCCTTCAATCCTGATGCAGCTCAAGCTAATAAGAACCATCAGGATGTCCGGAGTTATGTACGGCAATTAAATGTGATTGACAACCAGAGA
ACTTTATCACAGATGTCACACAGATTAGAGCCTCGTCGACCATAGACATTTCAAATGCCCAAAGCAACAGTTTGTCTCCAGTCCACAATC
TTTCAAAAATGCCATTTATGCTACTACTGACTGTATTGCCACTAGAGAATTCTACAAAACAAGCAAAAACACATCCTGAGACACCTCAGG
GCTGCATTCAGCTTACCAGCTACCTAGCAAGAGAAGGAATTATTTGACATGCCTAAAGCTTACACACTCTAGCTTAGGAATCCCCAGTTT
GTGGCTACCCTGTTTCATTTCCACTTGTGCCATCTTCTTTGCTGAAGTGTTGAATAAGGCCCACGTGAAGAGTTTGGTAGAAATAGCCTT
GTCAAGAGAACTAGCAAGCCCCTGACATTTTTTTCTAAGAGTGTTTATGGGATGAGATGTGCTACAAATGGGATAGATTTGGATAAAATT
TTAACTCAACATCTTGATTTGGAGCCTGGGGTTTCGGGAAGGTGTTGAGGAATCTATAGAAGTCCAAATTATAGGTTGTATTCTTCCATC
TTCATTGTCTTACCTCTGAAGGAATAGAACCTGACCACATTATTATGAAACATTATGGCTGTTTATGTAATTTAGGGAGGACTGGTCTGT
AATTTCTGAATGTATATAGAATAATATTTATGTTTACAATGTAACTTTTCAAAATTTACAAATCAGGATTATATACATAAGAATTCCACT
AAGAAATGCCAAGATTCTTAAATTTGCCAGCGTTAAAGTAGAAAATAACATTTCAGAAGAGCACAATATGCATAAAACATTTTTCAAAAT
TGAAATATTTTCCTGGGCATTAAAAACCTTTACTATTGGCTACAAATTTATTGTACCTGATGAAAACATATTTTCTGGACTTAAATGTTA
TTACAAATATCTTAATTTTCAGTAATTGTTTTGCACTTTCAAAGATTGTAAATAGTTCATTCAATCAATGGTATGGAGTTATTTATTTGC
TACATAATAGATACTGTGCCAAATAATTACTTTTTATTTATTTTATTTAGTACGTAATTTTGAAGTACATTTTTTCCTGTTTTCACAATT

>In-frame_ITGA6_ENST00000409080_chr2_173356251_+_RAPGEF4_ENST00000397081_chr2_173898642_+_4495nt
ATGGCCGCCGCCGGGCAGCTGTGCTTGCTCTACCTGTCGGCGGGGCTCCTGTCCCGGCTCGGCGCAGCCTTCAACTTGGACACTCGGGAG
GACAACGTGATCCGGAAATATGGAGACCCCGGGAGCCTCTTCGGCTTCTCGCTGGCCATGCACTGGCAACTGCAGCCCGAGGACAAGCGG
CTGTTGCTCGTGGGGGCCCCGCGGGCAGAAGCGCTTCCACTGCAGAGAGCCAACAGAACGGGAGGGCTGTACAGCTGCGACATCACCGCC
CGGGGGCCATGCACGCGGATCGAGTTTGATAACGATGCTGACCCCACGTCAGAAAGCAAGGAAGATCAGTGGATGGGGGTCACCGTCCAG
AGCCAAGGTCCAGGGGGCAAGGTCGTGACATGTGCTCACCGATATGAAAAAAGGCAGCATGTTAATACGAAGCAGGAATCCCGAGACATC
TTTGGGCGGTGTTATGTCCTGAGTCAGAATCTCAGGATTGAAGACGATATGGATGGGGGAGATTGGAGCTTTTGTGATGGGCGATTGAGA
GGCCATGAGAAATTTGGCTCTTGCCAGCAAGGTGTAGCAGCTACTTTTACTAAAGACTTTCATTACATTGTATTTGGAGCCCCGGGTACT
TATAACTGGAAAGGGATTGTTCGTGTAGAGCAAAAGAATAACACTTTTTTTGACATGAACATCTTTGAAGATGGGCCTTATGAAGTTGGT
GGAGAGACTGAGCATGATGAAAGTCTCGTTCCTGTTCCTGCTAACAGTTACTTAGGTTTTTCTTTGGACTCAGGGAAAGGTATTGTTTCT
AAAGATGAGATCACTTTTGTATCTGGTGCTCCCAGAGCCAATCACAGTGGAGCCGTGGTTTTGCTGAAGAGAGACATGAAGTCTGCACAT
CTCCTCCCTGAGCACATATTCGATGGAGAAGGTCTGGCCTCTTCATTTGGCTATGATGTGGCGGTGGTGGACCTCAACAAGGATGGGTGG
CAAGATATAGTTATTGGAGCCCCACAGTATTTTGATAGAGATGGAGAAGTTGGAGGTGCAGTGTATGTCTACATGAACCAGCAAGGCAGA
TGGAATAATGTGAAGCCAATTCGTCTTAATGGAACCAAAGATTCTATGTTTGGCATTGCAGTAAAAAATATTGGAGATATTAATCAAGAT
GGCTACCCAGATATTGCAGTTGGAGCTCCGTATGATGACTTGGGAAAGGTTTTTATCTATCATGGATCTGCAAATGGAATAAATACCAAA
CCAACACAGGTTCTCAAGGGTATATCACCTTATTTTGGATATTCAATTGCTGGAAACATGGACCTTGATCGAAATTCCTACCCTGATGTT
GCTGTTGGTTCCCTCTCAGATTCAGTAACTATTTTCAGATCCCGGCCTGTGATTAATATTCAGAAAACCATCACAGTAACTCCTAACAGA
ATTGACCTCCGCCAGAAAACAGCGTGTGGGGCGCCTAGTGGGATATGCCTCCAGGTTAAATCCTGTTTTGAATATACTGCTAACCCCGCT
GGTTATAATCCTTCAATATCAATTGTGGGCACACTTGAAGCTGAAAAAGAAAGAAGAAAATCTGGGCTATCCTCAAGAGTTCAGTTTCGA
AACCAAGGTTCTGAGCCCAAATATACTCAAGAACTAACTCTGAAGAGGCAGAAACAGAAAGTGTGCATGGAGGAAACCCTGTGGCTACAG
GATAATATCAGAGATAAACTGCGTCCCATTCCCATAACTGCCTCAGTGGAGATCCAAGAGCCAAGCTCTCGTAGGCGAGTGAATTCACTT
CCAGAAGTTCTTCCAATTCTGAATTCAGATGAACCCAAGACAGCTCATATTGATGTTCACTTCTTAAAAGAGGGATGTGGAGACGACAAT
GTATGTAACAGCAACCTTAAACTAGAATATAAATTTTGCACCCGAGAAGGAAATCAAGACAAATTTTCTTATTTACCAATTCAAAAAGGT
GTACCAGAACTAGTTCTAAAAGATCAGAAGGATATTGCTTTAGAAATAACAGTGACAAACAGCCCTTCCAACCCAAGGAATCCCACAAAA
GATGGCGATGACGCCCATGAGGCTAAACTGATTGCAACGTTTCCAGACACTTTAACCTATTCTGCATATAGAGAACTGAGGGCTTTCCCT
GAGAAACAGTTGAGTTGTGTTGCCAACCAGAATGGCTCGCAAGCTGACTGTGAGCTCGGAAATCCTTTTAAAAGAAATTCAAATGTCACT
TTTTATTTGGTTTTAAGTACAACTGAAGTCACCTTTGACACCCCAGATCTGGATATTAATCTGAAGTTAGAAACAACAAGCAATCAAGAT
AATTTGGCTCCAATTACAGCTAAAGCAAAAGTGGTTATTGAACTGCTTTTATCGGTCTCGGGAGTTGCTAAACCTTCCCAGGTGTATTTT
GGAGGTACAGTTGTTGGCGAGCAAGCTATGAAATCTGAAGATGAAGTGGGAAGTTTAATAGAGTATGAATTCAGGGTAATAAACTTAGGT
AAACCTCTTACAAACCTCGGCACAGCAACCTTGAACATTCAGTGGCCAAAAGAAATTAGCAATGGGAAATGGTTGCTTTATTTGGTGAAA
GTAGAATCCAAAGGATTGGAAAAGGTAACTTGTGAGCCACAAAAGGAGATAAACTCCCTGAACCTAACGGAGTCTCACAACTCAAGAAAG
AAACGGGAAATTACTGAAAAACAGATAGATGATAACAGAAAATTTTCTTTATTTGCTGAAAGAAAATACCAGACTCTTAACTGTAGCGTG
AACGTGAACTGTGTGAACATCAGATGCCCGCTGCGGGGGCTGGACAGCAAGGCGTCTCTTATTTTGCGCTCGAGGTTATGGAACAGCACA
TTTCTAGAGGAATATTCCAAACTGAACTACTTGGACATTCTCATGCGAGCCTTCATTGATGTGACTGCTGCTGCCGAAAATATCAGGCTG
CCAAATGCAGGCACTCAGAAACTGCCAAGCAAGTTCAAGAAGTTCTATGCGGAGTTTGAAAGTTTAATGGACCCTTCAAGGAACCACAGG
GCCTACAGGCTGACAGTAGCTAAGCTGGAACCTCCTCTCATCCCCTTCATGCCTTTGCTCATTAAAGATATGACATTTACTCATGAGGGG
AACAAGACGTTCATTGACAATCTAGTAAACTTTGAAAAAATGCGCATGATTGCAAATACGGCCAGAACAGTGAGATACTACAGGAGCCAA
CCCTTCAATCCTGATGCAGCTCAAGCTAATAAGAACCATCAGGATGTCCGGAGTTATGTACGGCAATTAAATGTGATTGACAACCAGAGA
ACTTTATCACAGATGTCACACAGATTAGAGCCTCGTCGACCATAGACATTTCAAATGCCCAAAGCAACAGTTTGTCTCCAGTCCACAATC
TTTCAAAAATGCCATTTATGCTACTACTGACTGTATTGCCACTAGAGAATTCTACAAAACAAGCAAAAACACATCCTGAGACACCTCAGG
GCTGCATTCAGCTTACCAGCTACCTAGCAAGAGAAGGAATTATTTGACATGCCTAAAGCTTACACACTCTAGCTTAGGAATCCCCAGTTT
GTGGCTACCCTGTTTCATTTCCACTTGTGCCATCTTCTTTGCTGAAGTGTTGAATAAGGCCCACGTGAAGAGTTTGGTAGAAATAGCCTT
GTCAAGAGAACTAGCAAGCCCCTGACATTTTTTTCTAAGAGTGTTTATGGGATGAGATGTGCTACAAATGGGATAGATTTGGATAAAATT
TTAACTCAACATCTTGATTTGGAGCCTGGGGTTTCGGGAAGGTGTTGAGGAATCTATAGAAGTCCAAATTATAGGTTGTATTCTTCCATC
TTCATTGTCTTACCTCTGAAGGAATAGAACCTGACCACATTATTATGAAACATTATGGCTGTTTATGTAATTTAGGGAGGACTGGTCTGT
AATTTCTGAATGTATATAGAATAATATTTATGTTTACAATGTAACTTTTCAAAATTTACAAATCAGGATTATATACATAAGAATTCCACT
AAGAAATGCCAAGATTCTTAAATTTGCCAGCGTTAAAGTAGAAAATAACATTTCAGAAGAGCACAATATGCATAAAACATTTTTCAAAAT
TGAAATATTTTCCTGGGCATTAAAAACCTTTACTATTGGCTACAAATTTATTGTACCTGATGAAAACATATTTTCTGGACTTAAATGTTA
TTACAAATATCTTAATTTTCAGTAATTGTTTTGCACTTTCAAAGATTGTAAATAGTTCATTCAATCAATGGTATGGAGTTATTTATTTGC
TACATAATAGATACTGTGCCAAATAATTACTTTTTATTTATTTTATTTAGTACGTAATTTTGAAGTACATTTTTTCCTGTTTTCACAATT


Top

FusionGenePPI for ITGA6_RAPGEF4


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ITGA6GIPC1, TSPAN4, ITGB1, CD36, RABIF, BIN1, CALM1, APP, PDIA3, MOV10, NXF1, LGALS8, MCOLN3, HLA-C, B4GALT4, HLA-E, BTNL8, CANT1, PTCH1, PICK1, PON2, LGALS3BP, TMEM17, CDH1, CTDSPL, TSPAN11, PCDHGA5, TMPRSS11B, TMED6, HLA-DRB1, GML, PCDHB16, PCDH20, TRIM25RAPGEF4ABCC8, RIMS2, RAP2A, RAP1A, ATXN1, BZRAP1, SWAP70, TRAF2, ZC3H11A, C16orf45, FBXL13


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneITGA6chr2:173356251chr2:173898642ENST00000264106+24261077_108310351131HPS5
HgeneITGA6chr2:173356251chr2:173898642ENST00000264107+23261077_10839961648HPS5
HgeneITGA6chr2:173356251chr2:173898642ENST00000343713+23261077_10839911728HPS5
HgeneITGA6chr2:173356251chr2:173898642ENST00000375221+24271077_108310351772HPS5
HgeneITGA6chr2:173356251chr2:173898642ENST00000409080+23251077_10839961092HPS5
HgeneITGA6chr2:173356251chr2:173898642ENST00000409532+23261077_10838771085HPS5


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ITGA6_RAPGEF4


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for ITGA6_RAPGEF4


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneITGA6C0003873Rheumatoid Arthritis1CTD_human