FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 17519

FusionGeneSummary for INPP5D_GIGYF2

check button Fusion gene summary
Fusion gene informationFusion gene name: INPP5D_GIGYF2
Fusion gene ID: 17519
HgeneTgene
Gene symbol

INPP5D

GIGYF2

Gene ID

3635

26058

Gene nameinositol polyphosphate-5-phosphatase DGRB10 interacting GYF protein 2
SynonymsSHIP|SHIP-1|SHIP1|SIP-145|hp51CN|p150ShipGYF2|PARK11|PERQ2|PERQ3|TNRC15
Cytomap

2q37.1

2q37.1

Type of geneprotein-codingprotein-coding
Descriptionphosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1SH2 domain-containing inositol 5'-phosphatase 1inositol polyphosphate-5-phosphatase, 145kDinositol polyphosphate-5-phosphatase, 145kDasignaling inositol polyphosphate 5 phosphatase SIP-145signalGRB10-interacting GYF protein 2PERQ amino acid rich, with GYF domain 3PERQ amino acid-rich with GYF domain-containing protein 2Parkinson disease (autosomal recessive, early onset) 11trinucleotide repeat-containing gene 15 protein
Modification date2018051920180522
UniProtAcc

Q92835

Q6Y7W6

Ensembl transtripts involved in fusion geneENST00000538935, ENST00000359570, 
ENST00000450745, ENST00000455936, 
ENST00000474278, 
ENST00000373566, 
ENST00000373563, ENST00000409480, 
ENST00000409547, ENST00000409196, 
ENST00000409451, ENST00000482666, 
ENST00000452341, 
Fusion gene scores* DoF score2 X 2 X 2=810 X 12 X 4=480
# samples 213
** MAII scorelog2(2/8*10)=1.32192809488736log2(13/480*10)=-1.88452278258006
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: INPP5D [Title/Abstract] AND GIGYF2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneGIGYF2

GO:0016441

posttranscriptional gene silencing

27157137

TgeneGIGYF2

GO:0061157

mRNA destabilization

27157137


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSTADTCGA-CG-4449-01AINPP5Dchr2

233944108

+GIGYF2chr2

233681581

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000538935ENST00000373566INPP5Dchr2

233944108

+GIGYF2chr2

233681581

+
In-frameENST00000538935ENST00000373563INPP5Dchr2

233944108

+GIGYF2chr2

233681581

+
In-frameENST00000538935ENST00000409480INPP5Dchr2

233944108

+GIGYF2chr2

233681581

+
In-frameENST00000538935ENST00000409547INPP5Dchr2

233944108

+GIGYF2chr2

233681581

+
In-frameENST00000538935ENST00000409196INPP5Dchr2

233944108

+GIGYF2chr2

233681581

+
In-frameENST00000538935ENST00000409451INPP5Dchr2

233944108

+GIGYF2chr2

233681581

+
5CDS-intronENST00000538935ENST00000482666INPP5Dchr2

233944108

+GIGYF2chr2

233681581

+
5CDS-intronENST00000538935ENST00000452341INPP5Dchr2

233944108

+GIGYF2chr2

233681581

+
In-frameENST00000359570ENST00000373566INPP5Dchr2

233944108

+GIGYF2chr2

233681581

+
In-frameENST00000359570ENST00000373563INPP5Dchr2

233944108

+GIGYF2chr2

233681581

+
In-frameENST00000359570ENST00000409480INPP5Dchr2

233944108

+GIGYF2chr2

233681581

+
In-frameENST00000359570ENST00000409547INPP5Dchr2

233944108

+GIGYF2chr2

233681581

+
In-frameENST00000359570ENST00000409196INPP5Dchr2

233944108

+GIGYF2chr2

233681581

+
In-frameENST00000359570ENST00000409451INPP5Dchr2

233944108

+GIGYF2chr2

233681581

+
5CDS-intronENST00000359570ENST00000482666INPP5Dchr2

233944108

+GIGYF2chr2

233681581

+
5CDS-intronENST00000359570ENST00000452341INPP5Dchr2

233944108

+GIGYF2chr2

233681581

+
intron-3CDSENST00000450745ENST00000373566INPP5Dchr2

233944108

+GIGYF2chr2

233681581

+
intron-3CDSENST00000450745ENST00000373563INPP5Dchr2

233944108

+GIGYF2chr2

233681581

+
intron-3CDSENST00000450745ENST00000409480INPP5Dchr2

233944108

+GIGYF2chr2

233681581

+
intron-3CDSENST00000450745ENST00000409547INPP5Dchr2

233944108

+GIGYF2chr2

233681581

+
intron-3CDSENST00000450745ENST00000409196INPP5Dchr2

233944108

+GIGYF2chr2

233681581

+
intron-3CDSENST00000450745ENST00000409451INPP5Dchr2

233944108

+GIGYF2chr2

233681581

+
intron-intronENST00000450745ENST00000482666INPP5Dchr2

233944108

+GIGYF2chr2

233681581

+
intron-intronENST00000450745ENST00000452341INPP5Dchr2

233944108

+GIGYF2chr2

233681581

+
intron-3CDSENST00000455936ENST00000373566INPP5Dchr2

233944108

+GIGYF2chr2

233681581

+
intron-3CDSENST00000455936ENST00000373563INPP5Dchr2

233944108

+GIGYF2chr2

233681581

+
intron-3CDSENST00000455936ENST00000409480INPP5Dchr2

233944108

+GIGYF2chr2

233681581

+
intron-3CDSENST00000455936ENST00000409547INPP5Dchr2

233944108

+GIGYF2chr2

233681581

+
intron-3CDSENST00000455936ENST00000409196INPP5Dchr2

233944108

+GIGYF2chr2

233681581

+
intron-3CDSENST00000455936ENST00000409451INPP5Dchr2

233944108

+GIGYF2chr2

233681581

+
intron-intronENST00000455936ENST00000482666INPP5Dchr2

233944108

+GIGYF2chr2

233681581

+
intron-intronENST00000455936ENST00000452341INPP5Dchr2

233944108

+GIGYF2chr2

233681581

+
intron-3CDSENST00000474278ENST00000373566INPP5Dchr2

233944108

+GIGYF2chr2

233681581

+
intron-3CDSENST00000474278ENST00000373563INPP5Dchr2

233944108

+GIGYF2chr2

233681581

+
intron-3CDSENST00000474278ENST00000409480INPP5Dchr2

233944108

+GIGYF2chr2

233681581

+
intron-3CDSENST00000474278ENST00000409547INPP5Dchr2

233944108

+GIGYF2chr2

233681581

+
intron-3CDSENST00000474278ENST00000409196INPP5Dchr2

233944108

+GIGYF2chr2

233681581

+
intron-3CDSENST00000474278ENST00000409451INPP5Dchr2

233944108

+GIGYF2chr2

233681581

+
intron-intronENST00000474278ENST00000482666INPP5Dchr2

233944108

+GIGYF2chr2

233681581

+
intron-intronENST00000474278ENST00000452341INPP5Dchr2

233944108

+GIGYF2chr2

233681581

+

Top

FusionProtFeatures for INPP5D_GIGYF2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
INPP5D

Q92835

GIGYF2

Q6Y7W6

Phosphatidylinositol (PtdIns) phosphatase thatspecifically hydrolyzes the 5-phosphate of phosphatidylinositol-3,4,5-trisphosphate (PtdIns(3,4,5)P3) to produce PtdIns(3,4)P2,thereby negatively regulating the PI3K (phosphoinositide 3-kinase)pathways. Acts as a negative regulator of B-cell antigen receptorsignaling. Mediates signaling from the FC-gamma-RIIB receptor(FCGR2B), playing a central role in terminating signaltransduction from activating immune/hematopoietic cell receptorsystems. Acts as a negative regulator of myeloid cellproliferation/survival and chemotaxis, mast cell degranulation,immune cells homeostasis, integrin alpha-IIb/beta-3 signaling inplatelets and JNK signaling in B-cells. Regulates proliferation ofosteoclast precursors, macrophage programming, phagocytosis andactivation and is required for endotoxin tolerance. Involved inthe control of cell-cell junctions, CD32a signaling in neutrophilsand modulation of EGF-induced phospholipase C activity. Keyregulator of neutrophil migration, by governing the formation ofthe leading edge and polarization required for chemotaxis.Modulates FCGR3/CD16-mediated cytotoxicity in NK cells. Mediatesthe activin/TGF-beta-induced apoptosis through its Smad-dependentexpression. May also hydrolyze PtdIns(1,3,4,5)P4, and could thusaffect the levels of the higher inositol polyphosphates likeInsP6. {ECO:0000269|PubMed:12421919, ECO:0000269|PubMed:16682172}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneGIGYF2chr2:233944108chr2:233681581ENST00000373563+18291198_12527361300Compositional biasNote=Gln-rich
TgeneGIGYF2chr2:233944108chr2:233681581ENST00000373563+1829738_8887361300Compositional biasNote=Glu-rich
TgeneGIGYF2chr2:233944108chr2:233681581ENST00000409451+20311198_12527571321Compositional biasNote=Gln-rich
TgeneGIGYF2chr2:233944108chr2:233681581ENST00000409547+20311198_12527361300Compositional biasNote=Gln-rich
TgeneGIGYF2chr2:233944108chr2:233681581ENST00000409547+2031738_8887361300Compositional biasNote=Glu-rich

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneINPP5Dchr2:233944108chr2:233681581ENST00000359570+229920_1148661178Compositional biasNote=Pro-rich
HgeneINPP5Dchr2:233944108chr2:233681581ENST00000359570+2295_101661178DomainSH2
HgeneINPP5Dchr2:233944108chr2:233681581ENST00000359570+2291019_1022661178MotifNote=NPXY motif 2
HgeneINPP5Dchr2:233944108chr2:233681581ENST00000359570+2291040_1051661178MotifNote=SH3-binding 3
HgeneINPP5Dchr2:233944108chr2:233681581ENST00000359570+229124_129661178MotifNote=SH3-binding 1
HgeneINPP5Dchr2:233944108chr2:233681581ENST00000359570+229912_915661178MotifNote=NPXY motif 1
HgeneINPP5Dchr2:233944108chr2:233681581ENST00000359570+229969_974661178MotifNote=SH3-binding 2
TgeneGIGYF2chr2:233944108chr2:233681581ENST00000373563+1829106_1117361300Compositional biasNote=Poly-Gly
TgeneGIGYF2chr2:233944108chr2:233681581ENST00000373563+1829118_2727361300Compositional biasNote=Arg-rich
TgeneGIGYF2chr2:233944108chr2:233681581ENST00000373563+1829436_4737361300Compositional biasNote=Pro-rich
TgeneGIGYF2chr2:233944108chr2:233681581ENST00000373563+1829607_10257361300Compositional biasNote=Gln-rich
TgeneGIGYF2chr2:233944108chr2:233681581ENST00000409451+2031106_1117571321Compositional biasNote=Poly-Gly
TgeneGIGYF2chr2:233944108chr2:233681581ENST00000409451+2031118_2727571321Compositional biasNote=Arg-rich
TgeneGIGYF2chr2:233944108chr2:233681581ENST00000409451+2031436_4737571321Compositional biasNote=Pro-rich
TgeneGIGYF2chr2:233944108chr2:233681581ENST00000409451+2031607_10257571321Compositional biasNote=Gln-rich
TgeneGIGYF2chr2:233944108chr2:233681581ENST00000409451+2031738_8887571321Compositional biasNote=Glu-rich
TgeneGIGYF2chr2:233944108chr2:233681581ENST00000409547+2031106_1117361300Compositional biasNote=Poly-Gly
TgeneGIGYF2chr2:233944108chr2:233681581ENST00000409547+2031118_2727361300Compositional biasNote=Arg-rich
TgeneGIGYF2chr2:233944108chr2:233681581ENST00000409547+2031436_4737361300Compositional biasNote=Pro-rich
TgeneGIGYF2chr2:233944108chr2:233681581ENST00000409547+2031607_10257361300Compositional biasNote=Gln-rich
TgeneGIGYF2chr2:233944108chr2:233681581ENST00000373563+1829533_5817361300DomainGYF
TgeneGIGYF2chr2:233944108chr2:233681581ENST00000409451+2031533_5817571321DomainGYF
TgeneGIGYF2chr2:233944108chr2:233681581ENST00000409547+2031533_5817361300DomainGYF
TgeneGIGYF2chr2:233944108chr2:233681581ENST00000373563+182940_507361300Motif4EHP-binding motif
TgeneGIGYF2chr2:233944108chr2:233681581ENST00000409451+203140_507571321Motif4EHP-binding motif
TgeneGIGYF2chr2:233944108chr2:233681581ENST00000409547+203140_507361300Motif4EHP-binding motif
TgeneGIGYF2chr2:233944108chr2:233681581ENST00000373563+1829547_5637361300RegionRequired for GRB10-binding
TgeneGIGYF2chr2:233944108chr2:233681581ENST00000409451+2031547_5637571321RegionRequired for GRB10-binding
TgeneGIGYF2chr2:233944108chr2:233681581ENST00000409547+2031547_5637361300RegionRequired for GRB10-binding


Top

FusionGeneSequence for INPP5D_GIGYF2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_INPP5D_ENST00000538935_chr2_233944108_+_GIGYF2_ENST00000373566_chr2_233681581_+_630aa
MVPCWNHGNITRSKAEELLSRTGKDGSFLVRASESISRAYALCVLYRNCVYTYRILPNEDDKFTVQLEQERREAEMRAKREEEERKRQEE
LRRQQEEILRRQQEEERKRREEEELARRKQEEALRRQREQEIALRRQREEEERQQQEEALRRLEERRREEEERRKQEELLRKQEEEAAKW
AREEEEAQRRLEENRLRMEEEAARLRHEEEERKRKELEVQRQKELMRQRQQQQEALRRLQQQQQQQQLAQMKLPSSSTWGQQSNTTACQS
QATLSLAEIQKLEEERERQLREEQRRQQRELMKALQQQQQQQQQKLSGWGNVSKPSGTTKSLLEIQQEEARQMQKQQQQQQQHQQPNRAR
NNTHSNLHTSIGNSVWGSINTGPPNQWASDLVSSIWSNADTKNSNMGFWDDAVKEVGPRNSTNKNKNNASLSKSVGVSNRQNKKVEEEEK
LLKLFQGVNKAQDGFTQWCEQMLHALNTANNLDVPTFVSFLKEVESPYEVHDYIRAYLGDTSEAKEFAKQFLERRAKQKANQQRQQQQLP
QQQQQQPPQQPPQQPQQQDSVWGMNHSTLHSVFQTNQSNNQQSNFEAVQSGKKKKKQKMVRADPSLLGFSVNASSERLNMGEIETLDDYX

>In-frame_INPP5D_ENST00000538935_chr2_233944108_+_GIGYF2_ENST00000373563_chr2_233681581_+_630aa
MVPCWNHGNITRSKAEELLSRTGKDGSFLVRASESISRAYALCVLYRNCVYTYRILPNEDDKFTVQLEQERREAEMRAKREEEERKRQEE
LRRQQEEILRRQQEEERKRREEEELARRKQEEALRRQREQEIALRRQREEEERQQQEEALRRLEERRREEEERRKQEELLRKQEEEAAKW
AREEEEAQRRLEENRLRMEEEAARLRHEEEERKRKELEVQRQKELMRQRQQQQEALRRLQQQQQQQQLAQMKLPSSSTWGQQSNTTACQS
QATLSLAEIQKLEEERERQLREEQRRQQRELMKALQQQQQQQQQKLSGWGNVSKPSGTTKSLLEIQQEEARQMQKQQQQQQQHQQPNRAR
NNTHSNLHTSIGNSVWGSINTGPPNQWASDLVSSIWSNADTKNSNMGFWDDAVKEVGPRNSTNKNKNNASLSKSVGVSNRQNKKVEEEEK
LLKLFQGVNKAQDGFTQWCEQMLHALNTANNLDVPTFVSFLKEVESPYEVHDYIRAYLGDTSEAKEFAKQFLERRAKQKANQQRQQQQLP
QQQQQQPPQQPPQQPQQQDSVWGMNHSTLHSVFQTNQSNNQQSNFEAVQSGKKKKKQKMVRADPSLLGFSVNASSERLNMGEIETLDDYX

>In-frame_INPP5D_ENST00000538935_chr2_233944108_+_GIGYF2_ENST00000409480_chr2_233681581_+_630aa
MVPCWNHGNITRSKAEELLSRTGKDGSFLVRASESISRAYALCVLYRNCVYTYRILPNEDDKFTVQLEQERREAEMRAKREEEERKRQEE
LRRQQEEILRRQQEEERKRREEEELARRKQEEALRRQREQEIALRRQREEEERQQQEEALRRLEERRREEEERRKQEELLRKQEEEAAKW
AREEEEAQRRLEENRLRMEEEAARLRHEEEERKRKELEVQRQKELMRQRQQQQEALRRLQQQQQQQQLAQMKLPSSSTWGQQSNTTACQS
QATLSLAEIQKLEEERERQLREEQRRQQRELMKALQQQQQQQQQKLSGWGNVSKPSGTTKSLLEIQQEEARQMQKQQQQQQQHQQPNRAR
NNTHSNLHTSIGNSVWGSINTGPPNQWASDLVSSIWSNADTKNSNMGFWDDAVKEVGPRNSTNKNKNNASLSKSVGVSNRQNKKVEEEEK
LLKLFQGVNKAQDGFTQWCEQMLHALNTANNLDVPTFVSFLKEVESPYEVHDYIRAYLGDTSEAKEFAKQFLERRAKQKANQQRQQQQLP
QQQQQQPPQQPPQQPQQQDSVWGMNHSTLHSVFQTNQSNNQQSNFEAVQSGKKKKKQKMVRADPSLLGFSVNASSERLNMGEIETLDDYX

>In-frame_INPP5D_ENST00000538935_chr2_233944108_+_GIGYF2_ENST00000409547_chr2_233681581_+_630aa
MVPCWNHGNITRSKAEELLSRTGKDGSFLVRASESISRAYALCVLYRNCVYTYRILPNEDDKFTVQLEQERREAEMRAKREEEERKRQEE
LRRQQEEILRRQQEEERKRREEEELARRKQEEALRRQREQEIALRRQREEEERQQQEEALRRLEERRREEEERRKQEELLRKQEEEAAKW
AREEEEAQRRLEENRLRMEEEAARLRHEEEERKRKELEVQRQKELMRQRQQQQEALRRLQQQQQQQQLAQMKLPSSSTWGQQSNTTACQS
QATLSLAEIQKLEEERERQLREEQRRQQRELMKALQQQQQQQQQKLSGWGNVSKPSGTTKSLLEIQQEEARQMQKQQQQQQQHQQPNRAR
NNTHSNLHTSIGNSVWGSINTGPPNQWASDLVSSIWSNADTKNSNMGFWDDAVKEVGPRNSTNKNKNNASLSKSVGVSNRQNKKVEEEEK
LLKLFQGVNKAQDGFTQWCEQMLHALNTANNLDVPTFVSFLKEVESPYEVHDYIRAYLGDTSEAKEFAKQFLERRAKQKANQQRQQQQLP
QQQQQQPPQQPPQQPQQQDSVWGMNHSTLHSVFQTNQSNNQQSNFEAVQSGKKKKKQKMVRADPSLLGFSVNASSERLNMGEIETLDDYX

>In-frame_INPP5D_ENST00000538935_chr2_233944108_+_GIGYF2_ENST00000409196_chr2_233681581_+_630aa
MVPCWNHGNITRSKAEELLSRTGKDGSFLVRASESISRAYALCVLYRNCVYTYRILPNEDDKFTVQLEQERREAEMRAKREEEERKRQEE
LRRQQEEILRRQQEEERKRREEEELARRKQEEALRRQREQEIALRRQREEEERQQQEEALRRLEERRREEEERRKQEELLRKQEEEAAKW
AREEEEAQRRLEENRLRMEEEAARLRHEEEERKRKELEVQRQKELMRQRQQQQEALRRLQQQQQQQQLAQMKLPSSSTWGQQSNTTACQS
QATLSLAEIQKLEEERERQLREEQRRQQRELMKALQQQQQQQQQKLSGWGNVSKPSGTTKSLLEIQQEEARQMQKQQQQQQQHQQPNRAR
NNTHSNLHTSIGNSVWGSINTGPPNQWASDLVSSIWSNADTKNSNMGFWDDAVKEVGPRNSTNKNKNNASLSKSVGVSNRQNKKVEEEEK
LLKLFQGVNKAQDGFTQWCEQMLHALNTANNLDVPTFVSFLKEVESPYEVHDYIRAYLGDTSEAKEFAKQFLERRAKQKANQQRQQQQLP
QQQQQQPPQQPPQQPQQQDSVWGMNHSTLHSVFQTNQSNNQQSNFEAVQSGKKKKKQKMVRADPSLLGFSVNASSERLNMGEIETLDDYX

>In-frame_INPP5D_ENST00000538935_chr2_233944108_+_GIGYF2_ENST00000409451_chr2_233681581_+_630aa
MVPCWNHGNITRSKAEELLSRTGKDGSFLVRASESISRAYALCVLYRNCVYTYRILPNEDDKFTVQLEQERREAEMRAKREEEERKRQEE
LRRQQEEILRRQQEEERKRREEEELARRKQEEALRRQREQEIALRRQREEEERQQQEEALRRLEERRREEEERRKQEELLRKQEEEAAKW
AREEEEAQRRLEENRLRMEEEAARLRHEEEERKRKELEVQRQKELMRQRQQQQEALRRLQQQQQQQQLAQMKLPSSSTWGQQSNTTACQS
QATLSLAEIQKLEEERERQLREEQRRQQRELMKALQQQQQQQQQKLSGWGNVSKPSGTTKSLLEIQQEEARQMQKQQQQQQQHQQPNRAR
NNTHSNLHTSIGNSVWGSINTGPPNQWASDLVSSIWSNADTKNSNMGFWDDAVKEVGPRNSTNKNKNNASLSKSVGVSNRQNKKVEEEEK
LLKLFQGVNKAQDGFTQWCEQMLHALNTANNLDVPTFVSFLKEVESPYEVHDYIRAYLGDTSEAKEFAKQFLERRAKQKANQQRQQQQLP
QQQQQQPPQQPPQQPQQQDSVWGMNHSTLHSVFQTNQSNNQQSNFEAVQSGKKKKKQKMVRADPSLLGFSVNASSERLNMGEIETLDDYX

>In-frame_INPP5D_ENST00000359570_chr2_233944108_+_GIGYF2_ENST00000373566_chr2_233681581_+_630aa
MVPCWNHGNITRSKAEELLSRTGKDGSFLVRASESISRAYALCVLYRNCVYTYRILPNEDDKFTVQLEQERREAEMRAKREEEERKRQEE
LRRQQEEILRRQQEEERKRREEEELARRKQEEALRRQREQEIALRRQREEEERQQQEEALRRLEERRREEEERRKQEELLRKQEEEAAKW
AREEEEAQRRLEENRLRMEEEAARLRHEEEERKRKELEVQRQKELMRQRQQQQEALRRLQQQQQQQQLAQMKLPSSSTWGQQSNTTACQS
QATLSLAEIQKLEEERERQLREEQRRQQRELMKALQQQQQQQQQKLSGWGNVSKPSGTTKSLLEIQQEEARQMQKQQQQQQQHQQPNRAR
NNTHSNLHTSIGNSVWGSINTGPPNQWASDLVSSIWSNADTKNSNMGFWDDAVKEVGPRNSTNKNKNNASLSKSVGVSNRQNKKVEEEEK
LLKLFQGVNKAQDGFTQWCEQMLHALNTANNLDVPTFVSFLKEVESPYEVHDYIRAYLGDTSEAKEFAKQFLERRAKQKANQQRQQQQLP
QQQQQQPPQQPPQQPQQQDSVWGMNHSTLHSVFQTNQSNNQQSNFEAVQSGKKKKKQKMVRADPSLLGFSVNASSERLNMGEIETLDDYX

>In-frame_INPP5D_ENST00000359570_chr2_233944108_+_GIGYF2_ENST00000373563_chr2_233681581_+_630aa
MVPCWNHGNITRSKAEELLSRTGKDGSFLVRASESISRAYALCVLYRNCVYTYRILPNEDDKFTVQLEQERREAEMRAKREEEERKRQEE
LRRQQEEILRRQQEEERKRREEEELARRKQEEALRRQREQEIALRRQREEEERQQQEEALRRLEERRREEEERRKQEELLRKQEEEAAKW
AREEEEAQRRLEENRLRMEEEAARLRHEEEERKRKELEVQRQKELMRQRQQQQEALRRLQQQQQQQQLAQMKLPSSSTWGQQSNTTACQS
QATLSLAEIQKLEEERERQLREEQRRQQRELMKALQQQQQQQQQKLSGWGNVSKPSGTTKSLLEIQQEEARQMQKQQQQQQQHQQPNRAR
NNTHSNLHTSIGNSVWGSINTGPPNQWASDLVSSIWSNADTKNSNMGFWDDAVKEVGPRNSTNKNKNNASLSKSVGVSNRQNKKVEEEEK
LLKLFQGVNKAQDGFTQWCEQMLHALNTANNLDVPTFVSFLKEVESPYEVHDYIRAYLGDTSEAKEFAKQFLERRAKQKANQQRQQQQLP
QQQQQQPPQQPPQQPQQQDSVWGMNHSTLHSVFQTNQSNNQQSNFEAVQSGKKKKKQKMVRADPSLLGFSVNASSERLNMGEIETLDDYX

>In-frame_INPP5D_ENST00000359570_chr2_233944108_+_GIGYF2_ENST00000409480_chr2_233681581_+_630aa
MVPCWNHGNITRSKAEELLSRTGKDGSFLVRASESISRAYALCVLYRNCVYTYRILPNEDDKFTVQLEQERREAEMRAKREEEERKRQEE
LRRQQEEILRRQQEEERKRREEEELARRKQEEALRRQREQEIALRRQREEEERQQQEEALRRLEERRREEEERRKQEELLRKQEEEAAKW
AREEEEAQRRLEENRLRMEEEAARLRHEEEERKRKELEVQRQKELMRQRQQQQEALRRLQQQQQQQQLAQMKLPSSSTWGQQSNTTACQS
QATLSLAEIQKLEEERERQLREEQRRQQRELMKALQQQQQQQQQKLSGWGNVSKPSGTTKSLLEIQQEEARQMQKQQQQQQQHQQPNRAR
NNTHSNLHTSIGNSVWGSINTGPPNQWASDLVSSIWSNADTKNSNMGFWDDAVKEVGPRNSTNKNKNNASLSKSVGVSNRQNKKVEEEEK
LLKLFQGVNKAQDGFTQWCEQMLHALNTANNLDVPTFVSFLKEVESPYEVHDYIRAYLGDTSEAKEFAKQFLERRAKQKANQQRQQQQLP
QQQQQQPPQQPPQQPQQQDSVWGMNHSTLHSVFQTNQSNNQQSNFEAVQSGKKKKKQKMVRADPSLLGFSVNASSERLNMGEIETLDDYX

>In-frame_INPP5D_ENST00000359570_chr2_233944108_+_GIGYF2_ENST00000409547_chr2_233681581_+_630aa
MVPCWNHGNITRSKAEELLSRTGKDGSFLVRASESISRAYALCVLYRNCVYTYRILPNEDDKFTVQLEQERREAEMRAKREEEERKRQEE
LRRQQEEILRRQQEEERKRREEEELARRKQEEALRRQREQEIALRRQREEEERQQQEEALRRLEERRREEEERRKQEELLRKQEEEAAKW
AREEEEAQRRLEENRLRMEEEAARLRHEEEERKRKELEVQRQKELMRQRQQQQEALRRLQQQQQQQQLAQMKLPSSSTWGQQSNTTACQS
QATLSLAEIQKLEEERERQLREEQRRQQRELMKALQQQQQQQQQKLSGWGNVSKPSGTTKSLLEIQQEEARQMQKQQQQQQQHQQPNRAR
NNTHSNLHTSIGNSVWGSINTGPPNQWASDLVSSIWSNADTKNSNMGFWDDAVKEVGPRNSTNKNKNNASLSKSVGVSNRQNKKVEEEEK
LLKLFQGVNKAQDGFTQWCEQMLHALNTANNLDVPTFVSFLKEVESPYEVHDYIRAYLGDTSEAKEFAKQFLERRAKQKANQQRQQQQLP
QQQQQQPPQQPPQQPQQQDSVWGMNHSTLHSVFQTNQSNNQQSNFEAVQSGKKKKKQKMVRADPSLLGFSVNASSERLNMGEIETLDDYX

>In-frame_INPP5D_ENST00000359570_chr2_233944108_+_GIGYF2_ENST00000409196_chr2_233681581_+_630aa
MVPCWNHGNITRSKAEELLSRTGKDGSFLVRASESISRAYALCVLYRNCVYTYRILPNEDDKFTVQLEQERREAEMRAKREEEERKRQEE
LRRQQEEILRRQQEEERKRREEEELARRKQEEALRRQREQEIALRRQREEEERQQQEEALRRLEERRREEEERRKQEELLRKQEEEAAKW
AREEEEAQRRLEENRLRMEEEAARLRHEEEERKRKELEVQRQKELMRQRQQQQEALRRLQQQQQQQQLAQMKLPSSSTWGQQSNTTACQS
QATLSLAEIQKLEEERERQLREEQRRQQRELMKALQQQQQQQQQKLSGWGNVSKPSGTTKSLLEIQQEEARQMQKQQQQQQQHQQPNRAR
NNTHSNLHTSIGNSVWGSINTGPPNQWASDLVSSIWSNADTKNSNMGFWDDAVKEVGPRNSTNKNKNNASLSKSVGVSNRQNKKVEEEEK
LLKLFQGVNKAQDGFTQWCEQMLHALNTANNLDVPTFVSFLKEVESPYEVHDYIRAYLGDTSEAKEFAKQFLERRAKQKANQQRQQQQLP
QQQQQQPPQQPPQQPQQQDSVWGMNHSTLHSVFQTNQSNNQQSNFEAVQSGKKKKKQKMVRADPSLLGFSVNASSERLNMGEIETLDDYX

>In-frame_INPP5D_ENST00000359570_chr2_233944108_+_GIGYF2_ENST00000409451_chr2_233681581_+_630aa
MVPCWNHGNITRSKAEELLSRTGKDGSFLVRASESISRAYALCVLYRNCVYTYRILPNEDDKFTVQLEQERREAEMRAKREEEERKRQEE
LRRQQEEILRRQQEEERKRREEEELARRKQEEALRRQREQEIALRRQREEEERQQQEEALRRLEERRREEEERRKQEELLRKQEEEAAKW
AREEEEAQRRLEENRLRMEEEAARLRHEEEERKRKELEVQRQKELMRQRQQQQEALRRLQQQQQQQQLAQMKLPSSSTWGQQSNTTACQS
QATLSLAEIQKLEEERERQLREEQRRQQRELMKALQQQQQQQQQKLSGWGNVSKPSGTTKSLLEIQQEEARQMQKQQQQQQQHQQPNRAR
NNTHSNLHTSIGNSVWGSINTGPPNQWASDLVSSIWSNADTKNSNMGFWDDAVKEVGPRNSTNKNKNNASLSKSVGVSNRQNKKVEEEEK
LLKLFQGVNKAQDGFTQWCEQMLHALNTANNLDVPTFVSFLKEVESPYEVHDYIRAYLGDTSEAKEFAKQFLERRAKQKANQQRQQQQLP
QQQQQQPPQQPPQQPQQQDSVWGMNHSTLHSVFQTNQSNNQQSNFEAVQSGKKKKKQKMVRADPSLLGFSVNASSERLNMGEIETLDDYX


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_INPP5D_ENST00000538935_chr2_233944108_+_GIGYF2_ENST00000373566_chr2_233681581_+_1890nt
ATGGTCCCCTGCTGGAACCATGGCAACATCACCCGCTCCAAGGCGGAGGAGCTGCTTTCCAGGACAGGCAAGGACGGGAGCTTCCTCGTG
CGTGCCAGCGAGTCCATCTCCCGGGCATACGCGCTCTGCGTGCTGTATCGGAATTGCGTTTACACTTACAGAATTCTGCCCAATGAAGAT
GATAAATTCACTGTTCAGCTAGAGCAAGAGAGAAGAGAGGCAGAAATGAGGGCAAAACGGGAAGAGGAAGAGCGAAAGAGGCAGGAAGAA
CTCCGAAGACAACAGGAGGAAATTCTTCGGCGACAGCAGGAAGAAGAAAGGAAAAGGCGAGAGGAAGAAGAACTTGCCCGAAGGAAACAG
GAAGAGGCTCTGCGTCGCCAGCGGGAGCAAGAAATTGCATTAAGGCGACAGCGAGAAGAGGAAGAAAGACAGCAGCAAGAAGAAGCTCTT
AGAAGACTGGAAGAGAGGAGAAGAGAAGAGGAAGAAAGGCGGAAGCAGGAAGAATTGTTACGCAAACAGGAAGAGGAGGCTGCAAAATGG
GCCCGGGAAGAAGAAGAAGCCCAGCGTCGATTAGAGGAGAACCGGCTGCGGATGGAAGAGGAGGCAGCCAGACTCCGGCATGAGGAAGAA
GAACGGAAGAGAAAGGAGCTGGAGGTCCAGCGGCAGAAGGAGTTAATGCGCCAGAGGCAGCAGCAGCAAGAGGCTCTCCGGAGGTTGCAG
CAGCAGCAGCAGCAACAACAGCTGGCGCAGATGAAGCTTCCTTCTTCTTCAACGTGGGGCCAGCAGTCCAATACAACAGCATGTCAGTCC
CAGGCCACGCTGTCGTTGGCTGAAATCCAAAAACTAGAGGAAGAACGAGAACGGCAGCTTCGAGAAGAGCAAAGGCGCCAGCAGAGGGAG
TTGATGAAAGCTCTTCAGCAGCAGCAGCAACAGCAACAGCAGAAACTCTCAGGTTGGGGGAATGTCAGCAAACCTTCAGGTACCACGAAA
TCTCTTCTGGAGATCCAGCAGGAAGAGGCCAGGCAAATGCAAAAGCAGCAGCAGCAGCAGCAGCAACACCAGCAACCAAACAGAGCTCGT
AACAATACGCATTCCAACCTGCACACCAGCATTGGGAATTCTGTTTGGGGCTCTATAAATACTGGTCCTCCTAACCAGTGGGCATCTGAC
CTAGTCAGTAGTATTTGGAGTAATGCTGACACTAAAAACTCCAACATGGGATTCTGGGATGATGCAGTGAAAGAGGTGGGACCTAGGAAT
TCAACAAATAAAAATAAAAACAACGCCAGTCTCAGTAAATCTGTAGGTGTGTCTAACCGGCAGAATAAGAAAGTAGAAGAAGAAGAAAAG
TTGCTGAAGCTCTTTCAGGGAGTAAATAAAGCCCAAGATGGATTTACGCAGTGGTGTGAACAGATGCTTCATGCCCTTAATACGGCAAAT
AACTTGGATGTTCCCACATTTGTTTCTTTCCTGAAAGAAGTAGAATCTCCTTATGAGGTCCATGATTATATCAGGGCCTATTTAGGAGAT
ACTTCTGAGGCCAAGGAGTTTGCCAAGCAGTTCCTTGAGCGCCGTGCCAAACAGAAAGCCAACCAGCAGCGTCAGCAGCAGCAGCTGCCA
CAGCAGCAGCAGCAGCAGCCGCCACAGCAGCCGCCACAGCAGCCACAACAGCAGGACTCTGTGTGGGGGATGAACCACAGTACACTCCAT
TCAGTATTTCAGACCAATCAAAGCAACAACCAACAATCCAATTTTGAGGCTGTGCAGAGTGGCAAGAAGAAGAAAAAGCAGAAGATGGTC
CGAGCAGATCCCAGTTTATTAGGATTTTCAGTCAATGCATCATCGGAGCGACTCAACATGGGTGAAATCGAGACGTTGGATGACTACTGA

>In-frame_INPP5D_ENST00000538935_chr2_233944108_+_GIGYF2_ENST00000373563_chr2_233681581_+_1890nt
ATGGTCCCCTGCTGGAACCATGGCAACATCACCCGCTCCAAGGCGGAGGAGCTGCTTTCCAGGACAGGCAAGGACGGGAGCTTCCTCGTG
CGTGCCAGCGAGTCCATCTCCCGGGCATACGCGCTCTGCGTGCTGTATCGGAATTGCGTTTACACTTACAGAATTCTGCCCAATGAAGAT
GATAAATTCACTGTTCAGCTAGAGCAAGAGAGAAGAGAGGCAGAAATGAGGGCAAAACGGGAAGAGGAAGAGCGAAAGAGGCAGGAAGAA
CTCCGAAGACAACAGGAGGAAATTCTTCGGCGACAGCAGGAAGAAGAAAGGAAAAGGCGAGAGGAAGAAGAACTTGCCCGAAGGAAACAG
GAAGAGGCTCTGCGTCGCCAGCGGGAGCAAGAAATTGCATTAAGGCGACAGCGAGAAGAGGAAGAAAGACAGCAGCAAGAAGAAGCTCTT
AGAAGACTGGAAGAGAGGAGAAGAGAAGAGGAAGAAAGGCGGAAGCAGGAAGAATTGTTACGCAAACAGGAAGAGGAGGCTGCAAAATGG
GCCCGGGAAGAAGAAGAAGCCCAGCGTCGATTAGAGGAGAACCGGCTGCGGATGGAAGAGGAGGCAGCCAGACTCCGGCATGAGGAAGAA
GAACGGAAGAGAAAGGAGCTGGAGGTCCAGCGGCAGAAGGAGTTAATGCGCCAGAGGCAGCAGCAGCAAGAGGCTCTCCGGAGGTTGCAG
CAGCAGCAGCAGCAACAACAGCTGGCGCAGATGAAGCTTCCTTCTTCTTCAACGTGGGGCCAGCAGTCCAATACAACAGCATGTCAGTCC
CAGGCCACGCTGTCGTTGGCTGAAATCCAAAAACTAGAGGAAGAACGAGAACGGCAGCTTCGAGAAGAGCAAAGGCGCCAGCAGAGGGAG
TTGATGAAAGCTCTTCAGCAGCAGCAGCAACAGCAACAGCAGAAACTCTCAGGTTGGGGGAATGTCAGCAAACCTTCAGGTACCACGAAA
TCTCTTCTGGAGATCCAGCAGGAAGAGGCCAGGCAAATGCAAAAGCAGCAGCAGCAGCAGCAGCAACACCAGCAACCAAACAGAGCTCGT
AACAATACGCATTCCAACCTGCACACCAGCATTGGGAATTCTGTTTGGGGCTCTATAAATACTGGTCCTCCTAACCAGTGGGCATCTGAC
CTAGTCAGTAGTATTTGGAGTAATGCTGACACTAAAAACTCCAACATGGGATTCTGGGATGATGCAGTGAAAGAGGTGGGACCTAGGAAT
TCAACAAATAAAAATAAAAACAACGCCAGTCTCAGTAAATCTGTAGGTGTGTCTAACCGGCAGAATAAGAAAGTAGAAGAAGAAGAAAAG
TTGCTGAAGCTCTTTCAGGGAGTAAATAAAGCCCAAGATGGATTTACGCAGTGGTGTGAACAGATGCTTCATGCCCTTAATACGGCAAAT
AACTTGGATGTTCCCACATTTGTTTCTTTCCTGAAAGAAGTAGAATCTCCTTATGAGGTCCATGATTATATCAGGGCCTATTTAGGAGAT
ACTTCTGAGGCCAAGGAGTTTGCCAAGCAGTTCCTTGAGCGCCGTGCCAAACAGAAAGCCAACCAGCAGCGTCAGCAGCAGCAGCTGCCA
CAGCAGCAGCAGCAGCAGCCGCCACAGCAGCCGCCACAGCAGCCACAACAGCAGGACTCTGTGTGGGGGATGAACCACAGTACACTCCAT
TCAGTATTTCAGACCAATCAAAGCAACAACCAACAATCCAATTTTGAGGCTGTGCAGAGTGGCAAGAAGAAGAAAAAGCAGAAGATGGTC
CGAGCAGATCCCAGTTTATTAGGATTTTCAGTCAATGCATCATCGGAGCGACTCAACATGGGTGAAATCGAGACGTTGGATGACTACTGA

>In-frame_INPP5D_ENST00000538935_chr2_233944108_+_GIGYF2_ENST00000409480_chr2_233681581_+_1890nt
ATGGTCCCCTGCTGGAACCATGGCAACATCACCCGCTCCAAGGCGGAGGAGCTGCTTTCCAGGACAGGCAAGGACGGGAGCTTCCTCGTG
CGTGCCAGCGAGTCCATCTCCCGGGCATACGCGCTCTGCGTGCTGTATCGGAATTGCGTTTACACTTACAGAATTCTGCCCAATGAAGAT
GATAAATTCACTGTTCAGCTAGAGCAAGAGAGAAGAGAGGCAGAAATGAGGGCAAAACGGGAAGAGGAAGAGCGAAAGAGGCAGGAAGAA
CTCCGAAGACAACAGGAGGAAATTCTTCGGCGACAGCAGGAAGAAGAAAGGAAAAGGCGAGAGGAAGAAGAACTTGCCCGAAGGAAACAG
GAAGAGGCTCTGCGTCGCCAGCGGGAGCAAGAAATTGCATTAAGGCGACAGCGAGAAGAGGAAGAAAGACAGCAGCAAGAAGAAGCTCTT
AGAAGACTGGAAGAGAGGAGAAGAGAAGAGGAAGAAAGGCGGAAGCAGGAAGAATTGTTACGCAAACAGGAAGAGGAGGCTGCAAAATGG
GCCCGGGAAGAAGAAGAAGCCCAGCGTCGATTAGAGGAGAACCGGCTGCGGATGGAAGAGGAGGCAGCCAGACTCCGGCATGAGGAAGAA
GAACGGAAGAGAAAGGAGCTGGAGGTCCAGCGGCAGAAGGAGTTAATGCGCCAGAGGCAGCAGCAGCAAGAGGCTCTCCGGAGGTTGCAG
CAGCAGCAGCAGCAACAACAGCTGGCGCAGATGAAGCTTCCTTCTTCTTCAACGTGGGGCCAGCAGTCCAATACAACAGCATGTCAGTCC
CAGGCCACGCTGTCGTTGGCTGAAATCCAAAAACTAGAGGAAGAACGAGAACGGCAGCTTCGAGAAGAGCAAAGGCGCCAGCAGAGGGAG
TTGATGAAAGCTCTTCAGCAGCAGCAGCAACAGCAACAGCAGAAACTCTCAGGTTGGGGGAATGTCAGCAAACCTTCAGGTACCACGAAA
TCTCTTCTGGAGATCCAGCAGGAAGAGGCCAGGCAAATGCAAAAGCAGCAGCAGCAGCAGCAGCAACACCAGCAACCAAACAGAGCTCGT
AACAATACGCATTCCAACCTGCACACCAGCATTGGGAATTCTGTTTGGGGCTCTATAAATACTGGTCCTCCTAACCAGTGGGCATCTGAC
CTAGTCAGTAGTATTTGGAGTAATGCTGACACTAAAAACTCCAACATGGGATTCTGGGATGATGCAGTGAAAGAGGTGGGACCTAGGAAT
TCAACAAATAAAAATAAAAACAACGCCAGTCTCAGTAAATCTGTAGGTGTGTCTAACCGGCAGAATAAGAAAGTAGAAGAAGAAGAAAAG
TTGCTGAAGCTCTTTCAGGGAGTAAATAAAGCCCAAGATGGATTTACGCAGTGGTGTGAACAGATGCTTCATGCCCTTAATACGGCAAAT
AACTTGGATGTTCCCACATTTGTTTCTTTCCTGAAAGAAGTAGAATCTCCTTATGAGGTCCATGATTATATCAGGGCCTATTTAGGAGAT
ACTTCTGAGGCCAAGGAGTTTGCCAAGCAGTTCCTTGAGCGCCGTGCCAAACAGAAAGCCAACCAGCAGCGTCAGCAGCAGCAGCTGCCA
CAGCAGCAGCAGCAGCAGCCGCCACAGCAGCCGCCACAGCAGCCACAACAGCAGGACTCTGTGTGGGGGATGAACCACAGTACACTCCAT
TCAGTATTTCAGACCAATCAAAGCAACAACCAACAATCCAATTTTGAGGCTGTGCAGAGTGGCAAGAAGAAGAAAAAGCAGAAGATGGTC
CGAGCAGATCCCAGTTTATTAGGATTTTCAGTCAATGCATCATCGGAGCGACTCAACATGGGTGAAATCGAGACGTTGGATGACTACTGA

>In-frame_INPP5D_ENST00000538935_chr2_233944108_+_GIGYF2_ENST00000409547_chr2_233681581_+_1890nt
ATGGTCCCCTGCTGGAACCATGGCAACATCACCCGCTCCAAGGCGGAGGAGCTGCTTTCCAGGACAGGCAAGGACGGGAGCTTCCTCGTG
CGTGCCAGCGAGTCCATCTCCCGGGCATACGCGCTCTGCGTGCTGTATCGGAATTGCGTTTACACTTACAGAATTCTGCCCAATGAAGAT
GATAAATTCACTGTTCAGCTAGAGCAAGAGAGAAGAGAGGCAGAAATGAGGGCAAAACGGGAAGAGGAAGAGCGAAAGAGGCAGGAAGAA
CTCCGAAGACAACAGGAGGAAATTCTTCGGCGACAGCAGGAAGAAGAAAGGAAAAGGCGAGAGGAAGAAGAACTTGCCCGAAGGAAACAG
GAAGAGGCTCTGCGTCGCCAGCGGGAGCAAGAAATTGCATTAAGGCGACAGCGAGAAGAGGAAGAAAGACAGCAGCAAGAAGAAGCTCTT
AGAAGACTGGAAGAGAGGAGAAGAGAAGAGGAAGAAAGGCGGAAGCAGGAAGAATTGTTACGCAAACAGGAAGAGGAGGCTGCAAAATGG
GCCCGGGAAGAAGAAGAAGCCCAGCGTCGATTAGAGGAGAACCGGCTGCGGATGGAAGAGGAGGCAGCCAGACTCCGGCATGAGGAAGAA
GAACGGAAGAGAAAGGAGCTGGAGGTCCAGCGGCAGAAGGAGTTAATGCGCCAGAGGCAGCAGCAGCAAGAGGCTCTCCGGAGGTTGCAG
CAGCAGCAGCAGCAACAACAGCTGGCGCAGATGAAGCTTCCTTCTTCTTCAACGTGGGGCCAGCAGTCCAATACAACAGCATGTCAGTCC
CAGGCCACGCTGTCGTTGGCTGAAATCCAAAAACTAGAGGAAGAACGAGAACGGCAGCTTCGAGAAGAGCAAAGGCGCCAGCAGAGGGAG
TTGATGAAAGCTCTTCAGCAGCAGCAGCAACAGCAACAGCAGAAACTCTCAGGTTGGGGGAATGTCAGCAAACCTTCAGGTACCACGAAA
TCTCTTCTGGAGATCCAGCAGGAAGAGGCCAGGCAAATGCAAAAGCAGCAGCAGCAGCAGCAGCAACACCAGCAACCAAACAGAGCTCGT
AACAATACGCATTCCAACCTGCACACCAGCATTGGGAATTCTGTTTGGGGCTCTATAAATACTGGTCCTCCTAACCAGTGGGCATCTGAC
CTAGTCAGTAGTATTTGGAGTAATGCTGACACTAAAAACTCCAACATGGGATTCTGGGATGATGCAGTGAAAGAGGTGGGACCTAGGAAT
TCAACAAATAAAAATAAAAACAACGCCAGTCTCAGTAAATCTGTAGGTGTGTCTAACCGGCAGAATAAGAAAGTAGAAGAAGAAGAAAAG
TTGCTGAAGCTCTTTCAGGGAGTAAATAAAGCCCAAGATGGATTTACGCAGTGGTGTGAACAGATGCTTCATGCCCTTAATACGGCAAAT
AACTTGGATGTTCCCACATTTGTTTCTTTCCTGAAAGAAGTAGAATCTCCTTATGAGGTCCATGATTATATCAGGGCCTATTTAGGAGAT
ACTTCTGAGGCCAAGGAGTTTGCCAAGCAGTTCCTTGAGCGCCGTGCCAAACAGAAAGCCAACCAGCAGCGTCAGCAGCAGCAGCTGCCA
CAGCAGCAGCAGCAGCAGCCGCCACAGCAGCCGCCACAGCAGCCACAACAGCAGGACTCTGTGTGGGGGATGAACCACAGTACACTCCAT
TCAGTATTTCAGACCAATCAAAGCAACAACCAACAATCCAATTTTGAGGCTGTGCAGAGTGGCAAGAAGAAGAAAAAGCAGAAGATGGTC
CGAGCAGATCCCAGTTTATTAGGATTTTCAGTCAATGCATCATCGGAGCGACTCAACATGGGTGAAATCGAGACGTTGGATGACTACTGA

>In-frame_INPP5D_ENST00000538935_chr2_233944108_+_GIGYF2_ENST00000409196_chr2_233681581_+_1890nt
ATGGTCCCCTGCTGGAACCATGGCAACATCACCCGCTCCAAGGCGGAGGAGCTGCTTTCCAGGACAGGCAAGGACGGGAGCTTCCTCGTG
CGTGCCAGCGAGTCCATCTCCCGGGCATACGCGCTCTGCGTGCTGTATCGGAATTGCGTTTACACTTACAGAATTCTGCCCAATGAAGAT
GATAAATTCACTGTTCAGCTAGAGCAAGAGAGAAGAGAGGCAGAAATGAGGGCAAAACGGGAAGAGGAAGAGCGAAAGAGGCAGGAAGAA
CTCCGAAGACAACAGGAGGAAATTCTTCGGCGACAGCAGGAAGAAGAAAGGAAAAGGCGAGAGGAAGAAGAACTTGCCCGAAGGAAACAG
GAAGAGGCTCTGCGTCGCCAGCGGGAGCAAGAAATTGCATTAAGGCGACAGCGAGAAGAGGAAGAAAGACAGCAGCAAGAAGAAGCTCTT
AGAAGACTGGAAGAGAGGAGAAGAGAAGAGGAAGAAAGGCGGAAGCAGGAAGAATTGTTACGCAAACAGGAAGAGGAGGCTGCAAAATGG
GCCCGGGAAGAAGAAGAAGCCCAGCGTCGATTAGAGGAGAACCGGCTGCGGATGGAAGAGGAGGCAGCCAGACTCCGGCATGAGGAAGAA
GAACGGAAGAGAAAGGAGCTGGAGGTCCAGCGGCAGAAGGAGTTAATGCGCCAGAGGCAGCAGCAGCAAGAGGCTCTCCGGAGGTTGCAG
CAGCAGCAGCAGCAACAACAGCTGGCGCAGATGAAGCTTCCTTCTTCTTCAACGTGGGGCCAGCAGTCCAATACAACAGCATGTCAGTCC
CAGGCCACGCTGTCGTTGGCTGAAATCCAAAAACTAGAGGAAGAACGAGAACGGCAGCTTCGAGAAGAGCAAAGGCGCCAGCAGAGGGAG
TTGATGAAAGCTCTTCAGCAGCAGCAGCAACAGCAACAGCAGAAACTCTCAGGTTGGGGGAATGTCAGCAAACCTTCAGGTACCACGAAA
TCTCTTCTGGAGATCCAGCAGGAAGAGGCCAGGCAAATGCAAAAGCAGCAGCAGCAGCAGCAGCAACACCAGCAACCAAACAGAGCTCGT
AACAATACGCATTCCAACCTGCACACCAGCATTGGGAATTCTGTTTGGGGCTCTATAAATACTGGTCCTCCTAACCAGTGGGCATCTGAC
CTAGTCAGTAGTATTTGGAGTAATGCTGACACTAAAAACTCCAACATGGGATTCTGGGATGATGCAGTGAAAGAGGTGGGACCTAGGAAT
TCAACAAATAAAAATAAAAACAACGCCAGTCTCAGTAAATCTGTAGGTGTGTCTAACCGGCAGAATAAGAAAGTAGAAGAAGAAGAAAAG
TTGCTGAAGCTCTTTCAGGGAGTAAATAAAGCCCAAGATGGATTTACGCAGTGGTGTGAACAGATGCTTCATGCCCTTAATACGGCAAAT
AACTTGGATGTTCCCACATTTGTTTCTTTCCTGAAAGAAGTAGAATCTCCTTATGAGGTCCATGATTATATCAGGGCCTATTTAGGAGAT
ACTTCTGAGGCCAAGGAGTTTGCCAAGCAGTTCCTTGAGCGCCGTGCCAAACAGAAAGCCAACCAGCAGCGTCAGCAGCAGCAGCTGCCA
CAGCAGCAGCAGCAGCAGCCGCCACAGCAGCCGCCACAGCAGCCACAACAGCAGGACTCTGTGTGGGGGATGAACCACAGTACACTCCAT
TCAGTATTTCAGACCAATCAAAGCAACAACCAACAATCCAATTTTGAGGCTGTGCAGAGTGGCAAGAAGAAGAAAAAGCAGAAGATGGTC
CGAGCAGATCCCAGTTTATTAGGATTTTCAGTCAATGCATCATCGGAGCGACTCAACATGGGTGAAATCGAGACGTTGGATGACTACTGA

>In-frame_INPP5D_ENST00000538935_chr2_233944108_+_GIGYF2_ENST00000409451_chr2_233681581_+_1890nt
ATGGTCCCCTGCTGGAACCATGGCAACATCACCCGCTCCAAGGCGGAGGAGCTGCTTTCCAGGACAGGCAAGGACGGGAGCTTCCTCGTG
CGTGCCAGCGAGTCCATCTCCCGGGCATACGCGCTCTGCGTGCTGTATCGGAATTGCGTTTACACTTACAGAATTCTGCCCAATGAAGAT
GATAAATTCACTGTTCAGCTAGAGCAAGAGAGAAGAGAGGCAGAAATGAGGGCAAAACGGGAAGAGGAAGAGCGAAAGAGGCAGGAAGAA
CTCCGAAGACAACAGGAGGAAATTCTTCGGCGACAGCAGGAAGAAGAAAGGAAAAGGCGAGAGGAAGAAGAACTTGCCCGAAGGAAACAG
GAAGAGGCTCTGCGTCGCCAGCGGGAGCAAGAAATTGCATTAAGGCGACAGCGAGAAGAGGAAGAAAGACAGCAGCAAGAAGAAGCTCTT
AGAAGACTGGAAGAGAGGAGAAGAGAAGAGGAAGAAAGGCGGAAGCAGGAAGAATTGTTACGCAAACAGGAAGAGGAGGCTGCAAAATGG
GCCCGGGAAGAAGAAGAAGCCCAGCGTCGATTAGAGGAGAACCGGCTGCGGATGGAAGAGGAGGCAGCCAGACTCCGGCATGAGGAAGAA
GAACGGAAGAGAAAGGAGCTGGAGGTCCAGCGGCAGAAGGAGTTAATGCGCCAGAGGCAGCAGCAGCAAGAGGCTCTCCGGAGGTTGCAG
CAGCAGCAGCAGCAACAACAGCTGGCGCAGATGAAGCTTCCTTCTTCTTCAACGTGGGGCCAGCAGTCCAATACAACAGCATGTCAGTCC
CAGGCCACGCTGTCGTTGGCTGAAATCCAAAAACTAGAGGAAGAACGAGAACGGCAGCTTCGAGAAGAGCAAAGGCGCCAGCAGAGGGAG
TTGATGAAAGCTCTTCAGCAGCAGCAGCAACAGCAACAGCAGAAACTCTCAGGTTGGGGGAATGTCAGCAAACCTTCAGGTACCACGAAA
TCTCTTCTGGAGATCCAGCAGGAAGAGGCCAGGCAAATGCAAAAGCAGCAGCAGCAGCAGCAGCAACACCAGCAACCAAACAGAGCTCGT
AACAATACGCATTCCAACCTGCACACCAGCATTGGGAATTCTGTTTGGGGCTCTATAAATACTGGTCCTCCTAACCAGTGGGCATCTGAC
CTAGTCAGTAGTATTTGGAGTAATGCTGACACTAAAAACTCCAACATGGGATTCTGGGATGATGCAGTGAAAGAGGTGGGACCTAGGAAT
TCAACAAATAAAAATAAAAACAACGCCAGTCTCAGTAAATCTGTAGGTGTGTCTAACCGGCAGAATAAGAAAGTAGAAGAAGAAGAAAAG
TTGCTGAAGCTCTTTCAGGGAGTAAATAAAGCCCAAGATGGATTTACGCAGTGGTGTGAACAGATGCTTCATGCCCTTAATACGGCAAAT
AACTTGGATGTTCCCACATTTGTTTCTTTCCTGAAAGAAGTAGAATCTCCTTATGAGGTCCATGATTATATCAGGGCCTATTTAGGAGAT
ACTTCTGAGGCCAAGGAGTTTGCCAAGCAGTTCCTTGAGCGCCGTGCCAAACAGAAAGCCAACCAGCAGCGTCAGCAGCAGCAGCTGCCA
CAGCAGCAGCAGCAGCAGCCGCCACAGCAGCCGCCACAGCAGCCACAACAGCAGGACTCTGTGTGGGGGATGAACCACAGTACACTCCAT
TCAGTATTTCAGACCAATCAAAGCAACAACCAACAATCCAATTTTGAGGCTGTGCAGAGTGGCAAGAAGAAGAAAAAGCAGAAGATGGTC
CGAGCAGATCCCAGTTTATTAGGATTTTCAGTCAATGCATCATCGGAGCGACTCAACATGGGTGAAATCGAGACGTTGGATGACTACTGA

>In-frame_INPP5D_ENST00000359570_chr2_233944108_+_GIGYF2_ENST00000373566_chr2_233681581_+_1890nt
ATGGTCCCCTGCTGGAACCATGGCAACATCACCCGCTCCAAGGCGGAGGAGCTGCTTTCCAGGACAGGCAAGGACGGGAGCTTCCTCGTG
CGTGCCAGCGAGTCCATCTCCCGGGCATACGCGCTCTGCGTGCTGTATCGGAATTGCGTTTACACTTACAGAATTCTGCCCAATGAAGAT
GATAAATTCACTGTTCAGCTAGAGCAAGAGAGAAGAGAGGCAGAAATGAGGGCAAAACGGGAAGAGGAAGAGCGAAAGAGGCAGGAAGAA
CTCCGAAGACAACAGGAGGAAATTCTTCGGCGACAGCAGGAAGAAGAAAGGAAAAGGCGAGAGGAAGAAGAACTTGCCCGAAGGAAACAG
GAAGAGGCTCTGCGTCGCCAGCGGGAGCAAGAAATTGCATTAAGGCGACAGCGAGAAGAGGAAGAAAGACAGCAGCAAGAAGAAGCTCTT
AGAAGACTGGAAGAGAGGAGAAGAGAAGAGGAAGAAAGGCGGAAGCAGGAAGAATTGTTACGCAAACAGGAAGAGGAGGCTGCAAAATGG
GCCCGGGAAGAAGAAGAAGCCCAGCGTCGATTAGAGGAGAACCGGCTGCGGATGGAAGAGGAGGCAGCCAGACTCCGGCATGAGGAAGAA
GAACGGAAGAGAAAGGAGCTGGAGGTCCAGCGGCAGAAGGAGTTAATGCGCCAGAGGCAGCAGCAGCAAGAGGCTCTCCGGAGGTTGCAG
CAGCAGCAGCAGCAACAACAGCTGGCGCAGATGAAGCTTCCTTCTTCTTCAACGTGGGGCCAGCAGTCCAATACAACAGCATGTCAGTCC
CAGGCCACGCTGTCGTTGGCTGAAATCCAAAAACTAGAGGAAGAACGAGAACGGCAGCTTCGAGAAGAGCAAAGGCGCCAGCAGAGGGAG
TTGATGAAAGCTCTTCAGCAGCAGCAGCAACAGCAACAGCAGAAACTCTCAGGTTGGGGGAATGTCAGCAAACCTTCAGGTACCACGAAA
TCTCTTCTGGAGATCCAGCAGGAAGAGGCCAGGCAAATGCAAAAGCAGCAGCAGCAGCAGCAGCAACACCAGCAACCAAACAGAGCTCGT
AACAATACGCATTCCAACCTGCACACCAGCATTGGGAATTCTGTTTGGGGCTCTATAAATACTGGTCCTCCTAACCAGTGGGCATCTGAC
CTAGTCAGTAGTATTTGGAGTAATGCTGACACTAAAAACTCCAACATGGGATTCTGGGATGATGCAGTGAAAGAGGTGGGACCTAGGAAT
TCAACAAATAAAAATAAAAACAACGCCAGTCTCAGTAAATCTGTAGGTGTGTCTAACCGGCAGAATAAGAAAGTAGAAGAAGAAGAAAAG
TTGCTGAAGCTCTTTCAGGGAGTAAATAAAGCCCAAGATGGATTTACGCAGTGGTGTGAACAGATGCTTCATGCCCTTAATACGGCAAAT
AACTTGGATGTTCCCACATTTGTTTCTTTCCTGAAAGAAGTAGAATCTCCTTATGAGGTCCATGATTATATCAGGGCCTATTTAGGAGAT
ACTTCTGAGGCCAAGGAGTTTGCCAAGCAGTTCCTTGAGCGCCGTGCCAAACAGAAAGCCAACCAGCAGCGTCAGCAGCAGCAGCTGCCA
CAGCAGCAGCAGCAGCAGCCGCCACAGCAGCCGCCACAGCAGCCACAACAGCAGGACTCTGTGTGGGGGATGAACCACAGTACACTCCAT
TCAGTATTTCAGACCAATCAAAGCAACAACCAACAATCCAATTTTGAGGCTGTGCAGAGTGGCAAGAAGAAGAAAAAGCAGAAGATGGTC
CGAGCAGATCCCAGTTTATTAGGATTTTCAGTCAATGCATCATCGGAGCGACTCAACATGGGTGAAATCGAGACGTTGGATGACTACTGA

>In-frame_INPP5D_ENST00000359570_chr2_233944108_+_GIGYF2_ENST00000373563_chr2_233681581_+_1890nt
ATGGTCCCCTGCTGGAACCATGGCAACATCACCCGCTCCAAGGCGGAGGAGCTGCTTTCCAGGACAGGCAAGGACGGGAGCTTCCTCGTG
CGTGCCAGCGAGTCCATCTCCCGGGCATACGCGCTCTGCGTGCTGTATCGGAATTGCGTTTACACTTACAGAATTCTGCCCAATGAAGAT
GATAAATTCACTGTTCAGCTAGAGCAAGAGAGAAGAGAGGCAGAAATGAGGGCAAAACGGGAAGAGGAAGAGCGAAAGAGGCAGGAAGAA
CTCCGAAGACAACAGGAGGAAATTCTTCGGCGACAGCAGGAAGAAGAAAGGAAAAGGCGAGAGGAAGAAGAACTTGCCCGAAGGAAACAG
GAAGAGGCTCTGCGTCGCCAGCGGGAGCAAGAAATTGCATTAAGGCGACAGCGAGAAGAGGAAGAAAGACAGCAGCAAGAAGAAGCTCTT
AGAAGACTGGAAGAGAGGAGAAGAGAAGAGGAAGAAAGGCGGAAGCAGGAAGAATTGTTACGCAAACAGGAAGAGGAGGCTGCAAAATGG
GCCCGGGAAGAAGAAGAAGCCCAGCGTCGATTAGAGGAGAACCGGCTGCGGATGGAAGAGGAGGCAGCCAGACTCCGGCATGAGGAAGAA
GAACGGAAGAGAAAGGAGCTGGAGGTCCAGCGGCAGAAGGAGTTAATGCGCCAGAGGCAGCAGCAGCAAGAGGCTCTCCGGAGGTTGCAG
CAGCAGCAGCAGCAACAACAGCTGGCGCAGATGAAGCTTCCTTCTTCTTCAACGTGGGGCCAGCAGTCCAATACAACAGCATGTCAGTCC
CAGGCCACGCTGTCGTTGGCTGAAATCCAAAAACTAGAGGAAGAACGAGAACGGCAGCTTCGAGAAGAGCAAAGGCGCCAGCAGAGGGAG
TTGATGAAAGCTCTTCAGCAGCAGCAGCAACAGCAACAGCAGAAACTCTCAGGTTGGGGGAATGTCAGCAAACCTTCAGGTACCACGAAA
TCTCTTCTGGAGATCCAGCAGGAAGAGGCCAGGCAAATGCAAAAGCAGCAGCAGCAGCAGCAGCAACACCAGCAACCAAACAGAGCTCGT
AACAATACGCATTCCAACCTGCACACCAGCATTGGGAATTCTGTTTGGGGCTCTATAAATACTGGTCCTCCTAACCAGTGGGCATCTGAC
CTAGTCAGTAGTATTTGGAGTAATGCTGACACTAAAAACTCCAACATGGGATTCTGGGATGATGCAGTGAAAGAGGTGGGACCTAGGAAT
TCAACAAATAAAAATAAAAACAACGCCAGTCTCAGTAAATCTGTAGGTGTGTCTAACCGGCAGAATAAGAAAGTAGAAGAAGAAGAAAAG
TTGCTGAAGCTCTTTCAGGGAGTAAATAAAGCCCAAGATGGATTTACGCAGTGGTGTGAACAGATGCTTCATGCCCTTAATACGGCAAAT
AACTTGGATGTTCCCACATTTGTTTCTTTCCTGAAAGAAGTAGAATCTCCTTATGAGGTCCATGATTATATCAGGGCCTATTTAGGAGAT
ACTTCTGAGGCCAAGGAGTTTGCCAAGCAGTTCCTTGAGCGCCGTGCCAAACAGAAAGCCAACCAGCAGCGTCAGCAGCAGCAGCTGCCA
CAGCAGCAGCAGCAGCAGCCGCCACAGCAGCCGCCACAGCAGCCACAACAGCAGGACTCTGTGTGGGGGATGAACCACAGTACACTCCAT
TCAGTATTTCAGACCAATCAAAGCAACAACCAACAATCCAATTTTGAGGCTGTGCAGAGTGGCAAGAAGAAGAAAAAGCAGAAGATGGTC
CGAGCAGATCCCAGTTTATTAGGATTTTCAGTCAATGCATCATCGGAGCGACTCAACATGGGTGAAATCGAGACGTTGGATGACTACTGA

>In-frame_INPP5D_ENST00000359570_chr2_233944108_+_GIGYF2_ENST00000409480_chr2_233681581_+_1890nt
ATGGTCCCCTGCTGGAACCATGGCAACATCACCCGCTCCAAGGCGGAGGAGCTGCTTTCCAGGACAGGCAAGGACGGGAGCTTCCTCGTG
CGTGCCAGCGAGTCCATCTCCCGGGCATACGCGCTCTGCGTGCTGTATCGGAATTGCGTTTACACTTACAGAATTCTGCCCAATGAAGAT
GATAAATTCACTGTTCAGCTAGAGCAAGAGAGAAGAGAGGCAGAAATGAGGGCAAAACGGGAAGAGGAAGAGCGAAAGAGGCAGGAAGAA
CTCCGAAGACAACAGGAGGAAATTCTTCGGCGACAGCAGGAAGAAGAAAGGAAAAGGCGAGAGGAAGAAGAACTTGCCCGAAGGAAACAG
GAAGAGGCTCTGCGTCGCCAGCGGGAGCAAGAAATTGCATTAAGGCGACAGCGAGAAGAGGAAGAAAGACAGCAGCAAGAAGAAGCTCTT
AGAAGACTGGAAGAGAGGAGAAGAGAAGAGGAAGAAAGGCGGAAGCAGGAAGAATTGTTACGCAAACAGGAAGAGGAGGCTGCAAAATGG
GCCCGGGAAGAAGAAGAAGCCCAGCGTCGATTAGAGGAGAACCGGCTGCGGATGGAAGAGGAGGCAGCCAGACTCCGGCATGAGGAAGAA
GAACGGAAGAGAAAGGAGCTGGAGGTCCAGCGGCAGAAGGAGTTAATGCGCCAGAGGCAGCAGCAGCAAGAGGCTCTCCGGAGGTTGCAG
CAGCAGCAGCAGCAACAACAGCTGGCGCAGATGAAGCTTCCTTCTTCTTCAACGTGGGGCCAGCAGTCCAATACAACAGCATGTCAGTCC
CAGGCCACGCTGTCGTTGGCTGAAATCCAAAAACTAGAGGAAGAACGAGAACGGCAGCTTCGAGAAGAGCAAAGGCGCCAGCAGAGGGAG
TTGATGAAAGCTCTTCAGCAGCAGCAGCAACAGCAACAGCAGAAACTCTCAGGTTGGGGGAATGTCAGCAAACCTTCAGGTACCACGAAA
TCTCTTCTGGAGATCCAGCAGGAAGAGGCCAGGCAAATGCAAAAGCAGCAGCAGCAGCAGCAGCAACACCAGCAACCAAACAGAGCTCGT
AACAATACGCATTCCAACCTGCACACCAGCATTGGGAATTCTGTTTGGGGCTCTATAAATACTGGTCCTCCTAACCAGTGGGCATCTGAC
CTAGTCAGTAGTATTTGGAGTAATGCTGACACTAAAAACTCCAACATGGGATTCTGGGATGATGCAGTGAAAGAGGTGGGACCTAGGAAT
TCAACAAATAAAAATAAAAACAACGCCAGTCTCAGTAAATCTGTAGGTGTGTCTAACCGGCAGAATAAGAAAGTAGAAGAAGAAGAAAAG
TTGCTGAAGCTCTTTCAGGGAGTAAATAAAGCCCAAGATGGATTTACGCAGTGGTGTGAACAGATGCTTCATGCCCTTAATACGGCAAAT
AACTTGGATGTTCCCACATTTGTTTCTTTCCTGAAAGAAGTAGAATCTCCTTATGAGGTCCATGATTATATCAGGGCCTATTTAGGAGAT
ACTTCTGAGGCCAAGGAGTTTGCCAAGCAGTTCCTTGAGCGCCGTGCCAAACAGAAAGCCAACCAGCAGCGTCAGCAGCAGCAGCTGCCA
CAGCAGCAGCAGCAGCAGCCGCCACAGCAGCCGCCACAGCAGCCACAACAGCAGGACTCTGTGTGGGGGATGAACCACAGTACACTCCAT
TCAGTATTTCAGACCAATCAAAGCAACAACCAACAATCCAATTTTGAGGCTGTGCAGAGTGGCAAGAAGAAGAAAAAGCAGAAGATGGTC
CGAGCAGATCCCAGTTTATTAGGATTTTCAGTCAATGCATCATCGGAGCGACTCAACATGGGTGAAATCGAGACGTTGGATGACTACTGA

>In-frame_INPP5D_ENST00000359570_chr2_233944108_+_GIGYF2_ENST00000409547_chr2_233681581_+_1890nt
ATGGTCCCCTGCTGGAACCATGGCAACATCACCCGCTCCAAGGCGGAGGAGCTGCTTTCCAGGACAGGCAAGGACGGGAGCTTCCTCGTG
CGTGCCAGCGAGTCCATCTCCCGGGCATACGCGCTCTGCGTGCTGTATCGGAATTGCGTTTACACTTACAGAATTCTGCCCAATGAAGAT
GATAAATTCACTGTTCAGCTAGAGCAAGAGAGAAGAGAGGCAGAAATGAGGGCAAAACGGGAAGAGGAAGAGCGAAAGAGGCAGGAAGAA
CTCCGAAGACAACAGGAGGAAATTCTTCGGCGACAGCAGGAAGAAGAAAGGAAAAGGCGAGAGGAAGAAGAACTTGCCCGAAGGAAACAG
GAAGAGGCTCTGCGTCGCCAGCGGGAGCAAGAAATTGCATTAAGGCGACAGCGAGAAGAGGAAGAAAGACAGCAGCAAGAAGAAGCTCTT
AGAAGACTGGAAGAGAGGAGAAGAGAAGAGGAAGAAAGGCGGAAGCAGGAAGAATTGTTACGCAAACAGGAAGAGGAGGCTGCAAAATGG
GCCCGGGAAGAAGAAGAAGCCCAGCGTCGATTAGAGGAGAACCGGCTGCGGATGGAAGAGGAGGCAGCCAGACTCCGGCATGAGGAAGAA
GAACGGAAGAGAAAGGAGCTGGAGGTCCAGCGGCAGAAGGAGTTAATGCGCCAGAGGCAGCAGCAGCAAGAGGCTCTCCGGAGGTTGCAG
CAGCAGCAGCAGCAACAACAGCTGGCGCAGATGAAGCTTCCTTCTTCTTCAACGTGGGGCCAGCAGTCCAATACAACAGCATGTCAGTCC
CAGGCCACGCTGTCGTTGGCTGAAATCCAAAAACTAGAGGAAGAACGAGAACGGCAGCTTCGAGAAGAGCAAAGGCGCCAGCAGAGGGAG
TTGATGAAAGCTCTTCAGCAGCAGCAGCAACAGCAACAGCAGAAACTCTCAGGTTGGGGGAATGTCAGCAAACCTTCAGGTACCACGAAA
TCTCTTCTGGAGATCCAGCAGGAAGAGGCCAGGCAAATGCAAAAGCAGCAGCAGCAGCAGCAGCAACACCAGCAACCAAACAGAGCTCGT
AACAATACGCATTCCAACCTGCACACCAGCATTGGGAATTCTGTTTGGGGCTCTATAAATACTGGTCCTCCTAACCAGTGGGCATCTGAC
CTAGTCAGTAGTATTTGGAGTAATGCTGACACTAAAAACTCCAACATGGGATTCTGGGATGATGCAGTGAAAGAGGTGGGACCTAGGAAT
TCAACAAATAAAAATAAAAACAACGCCAGTCTCAGTAAATCTGTAGGTGTGTCTAACCGGCAGAATAAGAAAGTAGAAGAAGAAGAAAAG
TTGCTGAAGCTCTTTCAGGGAGTAAATAAAGCCCAAGATGGATTTACGCAGTGGTGTGAACAGATGCTTCATGCCCTTAATACGGCAAAT
AACTTGGATGTTCCCACATTTGTTTCTTTCCTGAAAGAAGTAGAATCTCCTTATGAGGTCCATGATTATATCAGGGCCTATTTAGGAGAT
ACTTCTGAGGCCAAGGAGTTTGCCAAGCAGTTCCTTGAGCGCCGTGCCAAACAGAAAGCCAACCAGCAGCGTCAGCAGCAGCAGCTGCCA
CAGCAGCAGCAGCAGCAGCCGCCACAGCAGCCGCCACAGCAGCCACAACAGCAGGACTCTGTGTGGGGGATGAACCACAGTACACTCCAT
TCAGTATTTCAGACCAATCAAAGCAACAACCAACAATCCAATTTTGAGGCTGTGCAGAGTGGCAAGAAGAAGAAAAAGCAGAAGATGGTC
CGAGCAGATCCCAGTTTATTAGGATTTTCAGTCAATGCATCATCGGAGCGACTCAACATGGGTGAAATCGAGACGTTGGATGACTACTGA

>In-frame_INPP5D_ENST00000359570_chr2_233944108_+_GIGYF2_ENST00000409196_chr2_233681581_+_1890nt
ATGGTCCCCTGCTGGAACCATGGCAACATCACCCGCTCCAAGGCGGAGGAGCTGCTTTCCAGGACAGGCAAGGACGGGAGCTTCCTCGTG
CGTGCCAGCGAGTCCATCTCCCGGGCATACGCGCTCTGCGTGCTGTATCGGAATTGCGTTTACACTTACAGAATTCTGCCCAATGAAGAT
GATAAATTCACTGTTCAGCTAGAGCAAGAGAGAAGAGAGGCAGAAATGAGGGCAAAACGGGAAGAGGAAGAGCGAAAGAGGCAGGAAGAA
CTCCGAAGACAACAGGAGGAAATTCTTCGGCGACAGCAGGAAGAAGAAAGGAAAAGGCGAGAGGAAGAAGAACTTGCCCGAAGGAAACAG
GAAGAGGCTCTGCGTCGCCAGCGGGAGCAAGAAATTGCATTAAGGCGACAGCGAGAAGAGGAAGAAAGACAGCAGCAAGAAGAAGCTCTT
AGAAGACTGGAAGAGAGGAGAAGAGAAGAGGAAGAAAGGCGGAAGCAGGAAGAATTGTTACGCAAACAGGAAGAGGAGGCTGCAAAATGG
GCCCGGGAAGAAGAAGAAGCCCAGCGTCGATTAGAGGAGAACCGGCTGCGGATGGAAGAGGAGGCAGCCAGACTCCGGCATGAGGAAGAA
GAACGGAAGAGAAAGGAGCTGGAGGTCCAGCGGCAGAAGGAGTTAATGCGCCAGAGGCAGCAGCAGCAAGAGGCTCTCCGGAGGTTGCAG
CAGCAGCAGCAGCAACAACAGCTGGCGCAGATGAAGCTTCCTTCTTCTTCAACGTGGGGCCAGCAGTCCAATACAACAGCATGTCAGTCC
CAGGCCACGCTGTCGTTGGCTGAAATCCAAAAACTAGAGGAAGAACGAGAACGGCAGCTTCGAGAAGAGCAAAGGCGCCAGCAGAGGGAG
TTGATGAAAGCTCTTCAGCAGCAGCAGCAACAGCAACAGCAGAAACTCTCAGGTTGGGGGAATGTCAGCAAACCTTCAGGTACCACGAAA
TCTCTTCTGGAGATCCAGCAGGAAGAGGCCAGGCAAATGCAAAAGCAGCAGCAGCAGCAGCAGCAACACCAGCAACCAAACAGAGCTCGT
AACAATACGCATTCCAACCTGCACACCAGCATTGGGAATTCTGTTTGGGGCTCTATAAATACTGGTCCTCCTAACCAGTGGGCATCTGAC
CTAGTCAGTAGTATTTGGAGTAATGCTGACACTAAAAACTCCAACATGGGATTCTGGGATGATGCAGTGAAAGAGGTGGGACCTAGGAAT
TCAACAAATAAAAATAAAAACAACGCCAGTCTCAGTAAATCTGTAGGTGTGTCTAACCGGCAGAATAAGAAAGTAGAAGAAGAAGAAAAG
TTGCTGAAGCTCTTTCAGGGAGTAAATAAAGCCCAAGATGGATTTACGCAGTGGTGTGAACAGATGCTTCATGCCCTTAATACGGCAAAT
AACTTGGATGTTCCCACATTTGTTTCTTTCCTGAAAGAAGTAGAATCTCCTTATGAGGTCCATGATTATATCAGGGCCTATTTAGGAGAT
ACTTCTGAGGCCAAGGAGTTTGCCAAGCAGTTCCTTGAGCGCCGTGCCAAACAGAAAGCCAACCAGCAGCGTCAGCAGCAGCAGCTGCCA
CAGCAGCAGCAGCAGCAGCCGCCACAGCAGCCGCCACAGCAGCCACAACAGCAGGACTCTGTGTGGGGGATGAACCACAGTACACTCCAT
TCAGTATTTCAGACCAATCAAAGCAACAACCAACAATCCAATTTTGAGGCTGTGCAGAGTGGCAAGAAGAAGAAAAAGCAGAAGATGGTC
CGAGCAGATCCCAGTTTATTAGGATTTTCAGTCAATGCATCATCGGAGCGACTCAACATGGGTGAAATCGAGACGTTGGATGACTACTGA

>In-frame_INPP5D_ENST00000359570_chr2_233944108_+_GIGYF2_ENST00000409451_chr2_233681581_+_1890nt
ATGGTCCCCTGCTGGAACCATGGCAACATCACCCGCTCCAAGGCGGAGGAGCTGCTTTCCAGGACAGGCAAGGACGGGAGCTTCCTCGTG
CGTGCCAGCGAGTCCATCTCCCGGGCATACGCGCTCTGCGTGCTGTATCGGAATTGCGTTTACACTTACAGAATTCTGCCCAATGAAGAT
GATAAATTCACTGTTCAGCTAGAGCAAGAGAGAAGAGAGGCAGAAATGAGGGCAAAACGGGAAGAGGAAGAGCGAAAGAGGCAGGAAGAA
CTCCGAAGACAACAGGAGGAAATTCTTCGGCGACAGCAGGAAGAAGAAAGGAAAAGGCGAGAGGAAGAAGAACTTGCCCGAAGGAAACAG
GAAGAGGCTCTGCGTCGCCAGCGGGAGCAAGAAATTGCATTAAGGCGACAGCGAGAAGAGGAAGAAAGACAGCAGCAAGAAGAAGCTCTT
AGAAGACTGGAAGAGAGGAGAAGAGAAGAGGAAGAAAGGCGGAAGCAGGAAGAATTGTTACGCAAACAGGAAGAGGAGGCTGCAAAATGG
GCCCGGGAAGAAGAAGAAGCCCAGCGTCGATTAGAGGAGAACCGGCTGCGGATGGAAGAGGAGGCAGCCAGACTCCGGCATGAGGAAGAA
GAACGGAAGAGAAAGGAGCTGGAGGTCCAGCGGCAGAAGGAGTTAATGCGCCAGAGGCAGCAGCAGCAAGAGGCTCTCCGGAGGTTGCAG
CAGCAGCAGCAGCAACAACAGCTGGCGCAGATGAAGCTTCCTTCTTCTTCAACGTGGGGCCAGCAGTCCAATACAACAGCATGTCAGTCC
CAGGCCACGCTGTCGTTGGCTGAAATCCAAAAACTAGAGGAAGAACGAGAACGGCAGCTTCGAGAAGAGCAAAGGCGCCAGCAGAGGGAG
TTGATGAAAGCTCTTCAGCAGCAGCAGCAACAGCAACAGCAGAAACTCTCAGGTTGGGGGAATGTCAGCAAACCTTCAGGTACCACGAAA
TCTCTTCTGGAGATCCAGCAGGAAGAGGCCAGGCAAATGCAAAAGCAGCAGCAGCAGCAGCAGCAACACCAGCAACCAAACAGAGCTCGT
AACAATACGCATTCCAACCTGCACACCAGCATTGGGAATTCTGTTTGGGGCTCTATAAATACTGGTCCTCCTAACCAGTGGGCATCTGAC
CTAGTCAGTAGTATTTGGAGTAATGCTGACACTAAAAACTCCAACATGGGATTCTGGGATGATGCAGTGAAAGAGGTGGGACCTAGGAAT
TCAACAAATAAAAATAAAAACAACGCCAGTCTCAGTAAATCTGTAGGTGTGTCTAACCGGCAGAATAAGAAAGTAGAAGAAGAAGAAAAG
TTGCTGAAGCTCTTTCAGGGAGTAAATAAAGCCCAAGATGGATTTACGCAGTGGTGTGAACAGATGCTTCATGCCCTTAATACGGCAAAT
AACTTGGATGTTCCCACATTTGTTTCTTTCCTGAAAGAAGTAGAATCTCCTTATGAGGTCCATGATTATATCAGGGCCTATTTAGGAGAT
ACTTCTGAGGCCAAGGAGTTTGCCAAGCAGTTCCTTGAGCGCCGTGCCAAACAGAAAGCCAACCAGCAGCGTCAGCAGCAGCAGCTGCCA
CAGCAGCAGCAGCAGCAGCCGCCACAGCAGCCGCCACAGCAGCCACAACAGCAGGACTCTGTGTGGGGGATGAACCACAGTACACTCCAT
TCAGTATTTCAGACCAATCAAAGCAACAACCAACAATCCAATTTTGAGGCTGTGCAGAGTGGCAAGAAGAAGAAAAAGCAGAAGATGGTC
CGAGCAGATCCCAGTTTATTAGGATTTTCAGTCAATGCATCATCGGAGCGACTCAACATGGGTGAAATCGAGACGTTGGATGACTACTGA


* Fusion transcript sequences (Full-length transcript).
>In-frame_INPP5D_ENST00000538935_chr2_233944108_+_GIGYF2_ENST00000373566_chr2_233681581_+_5605nt
ATGGTCCCCTGCTGGAACCATGGCAACATCACCCGCTCCAAGGCGGAGGAGCTGCTTTCCAGGACAGGCAAGGACGGGAGCTTCCTCGTG
CGTGCCAGCGAGTCCATCTCCCGGGCATACGCGCTCTGCGTGCTGTATCGGAATTGCGTTTACACTTACAGAATTCTGCCCAATGAAGAT
GATAAATTCACTGTTCAGCTAGAGCAAGAGAGAAGAGAGGCAGAAATGAGGGCAAAACGGGAAGAGGAAGAGCGAAAGAGGCAGGAAGAA
CTCCGAAGACAACAGGAGGAAATTCTTCGGCGACAGCAGGAAGAAGAAAGGAAAAGGCGAGAGGAAGAAGAACTTGCCCGAAGGAAACAG
GAAGAGGCTCTGCGTCGCCAGCGGGAGCAAGAAATTGCATTAAGGCGACAGCGAGAAGAGGAAGAAAGACAGCAGCAAGAAGAAGCTCTT
AGAAGACTGGAAGAGAGGAGAAGAGAAGAGGAAGAAAGGCGGAAGCAGGAAGAATTGTTACGCAAACAGGAAGAGGAGGCTGCAAAATGG
GCCCGGGAAGAAGAAGAAGCCCAGCGTCGATTAGAGGAGAACCGGCTGCGGATGGAAGAGGAGGCAGCCAGACTCCGGCATGAGGAAGAA
GAACGGAAGAGAAAGGAGCTGGAGGTCCAGCGGCAGAAGGAGTTAATGCGCCAGAGGCAGCAGCAGCAAGAGGCTCTCCGGAGGTTGCAG
CAGCAGCAGCAGCAACAACAGCTGGCGCAGATGAAGCTTCCTTCTTCTTCAACGTGGGGCCAGCAGTCCAATACAACAGCATGTCAGTCC
CAGGCCACGCTGTCGTTGGCTGAAATCCAAAAACTAGAGGAAGAACGAGAACGGCAGCTTCGAGAAGAGCAAAGGCGCCAGCAGAGGGAG
TTGATGAAAGCTCTTCAGCAGCAGCAGCAACAGCAACAGCAGAAACTCTCAGGTTGGGGGAATGTCAGCAAACCTTCAGGTACCACGAAA
TCTCTTCTGGAGATCCAGCAGGAAGAGGCCAGGCAAATGCAAAAGCAGCAGCAGCAGCAGCAGCAACACCAGCAACCAAACAGAGCTCGT
AACAATACGCATTCCAACCTGCACACCAGCATTGGGAATTCTGTTTGGGGCTCTATAAATACTGGTCCTCCTAACCAGTGGGCATCTGAC
CTAGTCAGTAGTATTTGGAGTAATGCTGACACTAAAAACTCCAACATGGGATTCTGGGATGATGCAGTGAAAGAGGTGGGACCTAGGAAT
TCAACAAATAAAAATAAAAACAACGCCAGTCTCAGTAAATCTGTAGGTGTGTCTAACCGGCAGAATAAGAAAGTAGAAGAAGAAGAAAAG
TTGCTGAAGCTCTTTCAGGGAGTAAATAAAGCCCAAGATGGATTTACGCAGTGGTGTGAACAGATGCTTCATGCCCTTAATACGGCAAAT
AACTTGGATGTTCCCACATTTGTTTCTTTCCTGAAAGAAGTAGAATCTCCTTATGAGGTCCATGATTATATCAGGGCCTATTTAGGAGAT
ACTTCTGAGGCCAAGGAGTTTGCCAAGCAGTTCCTTGAGCGCCGTGCCAAACAGAAAGCCAACCAGCAGCGTCAGCAGCAGCAGCTGCCA
CAGCAGCAGCAGCAGCAGCCGCCACAGCAGCCGCCACAGCAGCCACAACAGCAGGACTCTGTGTGGGGGATGAACCACAGTACACTCCAT
TCAGTATTTCAGACCAATCAAAGCAACAACCAACAATCCAATTTTGAGGCTGTGCAGAGTGGCAAGAAGAAGAAAAAGCAGAAGATGGTC
CGAGCAGATCCCAGTTTATTAGGATTTTCAGTCAATGCATCATCGGAGCGACTCAACATGGGTGAAATCGAGACGTTGGATGACTACTGA
GCACCTGCCAGTGGACTGGCCATCCCTCTCCTGTCTGCCGACTATGGAGTCTCCACCTTTGGACACAACACTTACTCACCATTTACTCTT
TATCACTCTGCAACAAATCACAGAACCGATCATCTCAGGCTTTTTCTTCTGGCCCTTTGTGTCCAAGATTCTTTAATCCATTTTTGTTGG
TGAACATCTCAGACTATAGATAAGTGGACTGGACCCTGTGTCTTGGGGGTGGCAGTTGGGATTACTCCCCAACAAGGCTGATTTTAGGCA
GCATGTGTTCACTGTGCTGTGATTTCATCTACTGTCTCCCAGAAAGTGTGTTGGGATCGGCCATTAGCAGCTTGCTTTCTCTTGTCACTT
TTTTTCTTCTATTTTGTTTTTTCTTCTTCTTTTTCCCCCCATCAGGGCAAATGGTCTAACTGGTGCAATCATGAAGAGAGTTAATGGTTA
ACAGACATTGGCCAATAACAAAACACCCCATGGACTGTGACTCGAGTATCCAACAGGCAGTCAGAGCTCTCCCGGTCTGAAAGTTGCATT
GCCACTGCTAACTTTGGGATTGCATCAGAGAGGCCCTGAGTGGGGTTGAGATGAGGTTGGTTTGGTTTGATGTTACACACTCCTCACCTG
TTCTTTCTGAGTGTCCTTTCTCTGAAAGGATTTATGTTTTTCTTCGTTAGATAGTGACTTCTGAGCAAGCTGATCTCCCCTGGCATGCTC
CAACCTGATTGGACAAAGGAAGCTCTATGGCCTGGGAGAGAGACTATTCTTAATTTTTCTTTCTTACAAAAACTGATTTTTCCCATAAAT
ATTTTTACTTCAGAGGACTAGGACCATTTTGTTTTGGGCCCTTCTGCTGAAAATTTGTCTCGTTTAAGAGGCAGCTAGAATCTTTACCAT
ATGTATGAATTTGTATAATTTCATTTTTGGATAGGGATAAACTTTTGCTTCTGATAAAAGCCTGGAATTTCATCTGGTCCTCAGAGCATT
GCGTGTGTGTCTTGCTGTAGCCCGGAAAAGGTTTTGTGTAAAGATTCTGGGATGGCAAGTTGTTTGCCTTTTCTGAAAAGAGAACATACA
GAACCTGTCCATCTTTAAGACCTTCATCCATGGAATCTACTATACAGGAGGATGCAGTGGGCTGGAGGGGATGGGCGAAAATGGGAGCAG
GAAGCCTGGCCTGGCTTCTGGTCATGGCCTCCTAAAACCTTAAACTTCAAGTAGAAATGTACTCAAGCCCTATTTATAAACAAATACTTT
TCCTGCCTCCACCAAACCCCTACAGAACATCACCTGGAATTGCCACTCACACTGGGTTGGAGTCATTGGGCAGCTGTGCCTGTGCGAGAG
GTGCTGTGGTCTGGGCAGCCCCTGGAAAAGCACCTTTGCTGCCTGTCATTGTTGCCTGAAGAAGGCTGGAGTTGCTCTGAGAGCAGTTTG
GGTTTGGAGTATTATATTTGGCTTCTATTTTTATTATTTTGGATCACCATTCTCCCTATCCCTTCTTGCCTCCCTCCCTTCTAAACATGT
GTAATAACTATACAGAGACTGCTACAAAATTGTATATAGTTTTTGGATCAAATAGCATGAGGGGAGAGGAAACCATTAAAAGTTGGGGCT
CCTACTCTCCTTTGCTTTGTAAATTCAAAAGTTGGGGGTGGGTAAGAGGGATAGTTAAAATGTTTACAAAACTTTAGGCTCCCTCGGAAC
TTTTGCCAGTGTGGAGGAAAATAAAAAAGAACTTAAATAAAATCTGATTGTATTCTATCTGAGTGCACCTCTTGTACTCACCTTTATGGA
GGCTGAGTTCTGCACTAAACTGTTCCTCTTGGTACCATGGAAAAGCTCCAAGCACCCAAGACATGGAGGCAGCCATGGCTTCTTTCTCTG
CCAGACCACGTAGCACTGGCTGGTTCTGTATTTGAGAATGTAGAGGTCAAGGCAGATGTCGGTAAGTTTGACCAAATATCTTTTCTCTTT
TTGACTCTCCCTTTCTGCTAACATGTGGATCAGCTCCTGCCCTCATACCGCAGACACACCCACTCTGAACACACCCCTCCAGAGCTTGCC
CACACCTTCCCAACTAGACTCTGTGTGTGTATTCAGGAAAAATGAAAATAAATTTTTAAAAATTGGGAGTGGAATGGGCAGATTAGGGGG
AACAAAGTCATTTTGGTCATGGAACATCCATTTGCTTAACCAAGGAGACTTGCTTCTATCTGAGGAATTTCCCACTTAGTAGAAAGAAAC
ACTCTTCCCTGGGAATGTTTGTTTCTGTCTCTCTCAATGCTACTCTCTTTCATATTCTCATTTGCTCACCCTTTCACTTAGAGCCACCGT
TTTCTCATCCCATTCTATGAACTTATTTCCAAATTCTCCTAACTATTCCTGAGTTTTGAAGTATTTGTTTTGTACCCTCTCTGCTTCCGG
TTTTTTGTTTGGTTGGCTTTTTTGGAGATAGGGTCTTGTGATGTTGCCCACACTGGTCTCGAGCCCCTGGGCTCAAGTGATCCTCCCGCC
TCAGCCTCCTAAATATCTAGGACTACAGGTGTGTGCCACCATGCCCAGCTCCAGTTTTGTTGGTTGATTTGTTTAAATTCAGAGATTTAA
AAACATCCCAGACAAGACAGTTTGATTATGGAGACTGTCCCCAAGCAGATTGGTGTGCTGGTGGCTGCTGTGCATAACAGATTCCCTCCA
GATTGGCTTACAACAGCTACTTCATTCTGTGGGTCAGGAATTTGGATAGGGCTCAGCTGGGTGGTGGTTCTCCTGGGGTATTCTTTGGTT
GTGGTCAGATGTCTTCCAGGGCATCATTCCTATGAAGGCTTAATGAATTAGGCAAGCTGTCCAAGATGGCTCACTCGTGTAATGACAGTT
GACGTTGGCTGTAGGCTGGGAACTCAGCTGGGTTGATGACTGGAGGAGCTTATGTGTGTCGTCTCCGGAATGGCAGCTTCAGAGGAGTTG
AACTTAAGTGGTGATTGGCTTCCCCCAGAGAACCAGGCAGAAGCTGTGTTACCTTTTTGAGCTCTTAGCTCAGGAGTCACATAGAGTCAC
TTCTGTGACACTGTGTTGCATCAAAGTAGTCACAAACCCACTCAGATTCAAGAGAAGGGAGCATGGCCCTCTCCCTGCAACCCCCTCCCC
CCCCGCCTTGATGAAAGGAGTGACAAGGTCACATTGGAGAAGAGCTTGTGGGGTGGGAGATATTATAGCCATTTTTGGGAAATATCTGCA
TAAAATGAGTTTATGCATACATGAAGGACTTTATTTTCATTGGCTTTAAGTTGAGGGTTTTTGTTTTTGTTTTTGTATTGGAGATGGGTT
CTTACTATGTTGCCCAGGCTGGTCTCAAACCCCTGGGCTCAAGTGATCCTGTTGCCTCAGCCTCCCAAGTAGCTGGGACTACAGCTATGT
GCCAGTGCACCCAGCTTGTTTTTTTTAAATTTTAGGATAGATAATGGTACTTCTGGCTTTATTTAAATAATTTTTTTAGGGAAACCATTG
TATTTATACATGCATATATTTTTATATATACAAATATGTATATAAAAGTATATGTTTTACATTTTCAATATATATATAATATATACATAT
ATGTTATATACGTATATATATTGCACCCTACTTTAAAATTGACTGATAACAAAATTGGTAATTTTGTATAAAATGCCCAACTGTGCATTA

>In-frame_INPP5D_ENST00000538935_chr2_233944108_+_GIGYF2_ENST00000373563_chr2_233681581_+_3642nt
ATGGTCCCCTGCTGGAACCATGGCAACATCACCCGCTCCAAGGCGGAGGAGCTGCTTTCCAGGACAGGCAAGGACGGGAGCTTCCTCGTG
CGTGCCAGCGAGTCCATCTCCCGGGCATACGCGCTCTGCGTGCTGTATCGGAATTGCGTTTACACTTACAGAATTCTGCCCAATGAAGAT
GATAAATTCACTGTTCAGCTAGAGCAAGAGAGAAGAGAGGCAGAAATGAGGGCAAAACGGGAAGAGGAAGAGCGAAAGAGGCAGGAAGAA
CTCCGAAGACAACAGGAGGAAATTCTTCGGCGACAGCAGGAAGAAGAAAGGAAAAGGCGAGAGGAAGAAGAACTTGCCCGAAGGAAACAG
GAAGAGGCTCTGCGTCGCCAGCGGGAGCAAGAAATTGCATTAAGGCGACAGCGAGAAGAGGAAGAAAGACAGCAGCAAGAAGAAGCTCTT
AGAAGACTGGAAGAGAGGAGAAGAGAAGAGGAAGAAAGGCGGAAGCAGGAAGAATTGTTACGCAAACAGGAAGAGGAGGCTGCAAAATGG
GCCCGGGAAGAAGAAGAAGCCCAGCGTCGATTAGAGGAGAACCGGCTGCGGATGGAAGAGGAGGCAGCCAGACTCCGGCATGAGGAAGAA
GAACGGAAGAGAAAGGAGCTGGAGGTCCAGCGGCAGAAGGAGTTAATGCGCCAGAGGCAGCAGCAGCAAGAGGCTCTCCGGAGGTTGCAG
CAGCAGCAGCAGCAACAACAGCTGGCGCAGATGAAGCTTCCTTCTTCTTCAACGTGGGGCCAGCAGTCCAATACAACAGCATGTCAGTCC
CAGGCCACGCTGTCGTTGGCTGAAATCCAAAAACTAGAGGAAGAACGAGAACGGCAGCTTCGAGAAGAGCAAAGGCGCCAGCAGAGGGAG
TTGATGAAAGCTCTTCAGCAGCAGCAGCAACAGCAACAGCAGAAACTCTCAGGTTGGGGGAATGTCAGCAAACCTTCAGGTACCACGAAA
TCTCTTCTGGAGATCCAGCAGGAAGAGGCCAGGCAAATGCAAAAGCAGCAGCAGCAGCAGCAGCAACACCAGCAACCAAACAGAGCTCGT
AACAATACGCATTCCAACCTGCACACCAGCATTGGGAATTCTGTTTGGGGCTCTATAAATACTGGTCCTCCTAACCAGTGGGCATCTGAC
CTAGTCAGTAGTATTTGGAGTAATGCTGACACTAAAAACTCCAACATGGGATTCTGGGATGATGCAGTGAAAGAGGTGGGACCTAGGAAT
TCAACAAATAAAAATAAAAACAACGCCAGTCTCAGTAAATCTGTAGGTGTGTCTAACCGGCAGAATAAGAAAGTAGAAGAAGAAGAAAAG
TTGCTGAAGCTCTTTCAGGGAGTAAATAAAGCCCAAGATGGATTTACGCAGTGGTGTGAACAGATGCTTCATGCCCTTAATACGGCAAAT
AACTTGGATGTTCCCACATTTGTTTCTTTCCTGAAAGAAGTAGAATCTCCTTATGAGGTCCATGATTATATCAGGGCCTATTTAGGAGAT
ACTTCTGAGGCCAAGGAGTTTGCCAAGCAGTTCCTTGAGCGCCGTGCCAAACAGAAAGCCAACCAGCAGCGTCAGCAGCAGCAGCTGCCA
CAGCAGCAGCAGCAGCAGCCGCCACAGCAGCCGCCACAGCAGCCACAACAGCAGGACTCTGTGTGGGGGATGAACCACAGTACACTCCAT
TCAGTATTTCAGACCAATCAAAGCAACAACCAACAATCCAATTTTGAGGCTGTGCAGAGTGGCAAGAAGAAGAAAAAGCAGAAGATGGTC
CGAGCAGATCCCAGTTTATTAGGATTTTCAGTCAATGCATCATCGGAGCGACTCAACATGGGTGAAATCGAGACGTTGGATGACTACTGA
GCACCTGCCAGTGGACTGGCCATCCCTCTCCTGTCTGCCGACTATGGAGTCTCCACCTTTGGACACAACACTTACTCACCATTTACTCTT
TATCACTCTGCAACAAATCACAGAACCGATCATCTCAGGCTTTTTCTTCTGGCCCTTTGTGTCCAAGATTCTTTAATCCATTTTTGTTGG
TGAACATCTCAGACTATAGATAAGTGGACTGGACCCTGTGTCTTGGGGGTGGCAGTTGGGATTACTCCCCAACAAGGCTGATTTTAGGCA
GCATGTGTTCACTGTGCTGTGATTTCATCTACTGTCTCCCAGAAAGTGTGTTGGGATCGGCCATTAGCAGCTTGCTTTCTCTTGTCACTT
TTTTTCTTCTATTTTGTTTTTTCTTCTTCTTTTTCCCCCCATCAGGGCAAATGGTCTAACTGGTGCAATCATGAAGAGAGTTAATGGTTA
ACAGACATTGGCCAATAACAAAACACCCCATGGACTGTGACTCGAGTATCCAACAGGCAGTCAGAGCTCTCCCGGTCTGAAAGTTGCATT
GCCACTGCTAACTTTGGGATTGCATCAGAGAGGCCCTGAGTGGGGTTGAGATGAGGTTGGTTTGGTTTGATGTTACACACTCCTCACCTG
TTCTTTCTGAGTGTCCTTTCTCTGAAAGGATTTATGTTTTTCTTCGTTAGATAGTGACTTCTGAGCAAGCTGATCTCCCCTGGCATGCTC
CAACCTGATTGGACAAAGGAAGCTCTATGGCCTGGGAGAGAGACTATTCTTAATTTTTCTTTCTTACAAAAACTGATTTTTCCCATAAAT
ATTTTTACTTCAGAGGACTAGGACCATTTTGTTTTGGGCCCTTCTGCTGAAAATTTGTCTCGTTTAAGAGGCAGCTAGAATCTTTACCAT
ATGTATGAATTTGTATAATTTCATTTTTGGATAGGGATAAACTTTTGCTTCTGATAAAAGCCTGGAATTTCATCTGGTCCTCAGAGCATT
GCGTGTGTGTCTTGCTGTAGCCCGGAAAAGGTTTTGTGTAAAGATTCTGGGATGGCAAGTTGTTTGCCTTTTCTGAAAAGAGAACATACA
GAACCTGTCCATCTTTAAGACCTTCATCCATGGAATCTACTATACAGGAGGATGCAGTGGGCTGGAGGGGATGGGCGAAAATGGGAGCAG
GAAGCCTGGCCTGGCTTCTGGTCATGGCCTCCTAAAACCTTAAACTTCAAGTAGAAATGTACTCAAGCCCTATTTATAAACAAATACTTT
TCCTGCCTCCACCAAACCCCTACAGAACATCACCTGGAATTGCCACTCACACTGGGTTGGAGTCATTGGGCAGCTGTGCCTGTGCGAGAG
GTGCTGTGGTCTGGGCAGCCCCTGGAAAAGCACCTTTGCTGCCTGTCATTGTTGCCTGAAGAAGGCTGGAGTTGCTCTGAGAGCAGTTTG
GGTTTGGAGTATTATATTTGGCTTCTATTTTTATTATTTTGGATCACCATTCTCCCTATCCCTTCTTGCCTCCCTCCCTTCTAAACATGT
GTAATAACTATACAGAGACTGCTACAAAATTGTATATAGTTTTTGGATCAAATAGCATGAGGGGAGAGGAAACCATTAAAAGTTGGGGCT
CCTACTCTCCTTTGCTTTGTAAATTCAAAAGTTGGGGGTGGGTAAGAGGGATAGTTAAAATGTTTACAAAACTTTAGGCTCCCTCGGAAC

>In-frame_INPP5D_ENST00000538935_chr2_233944108_+_GIGYF2_ENST00000409480_chr2_233681581_+_3638nt
ATGGTCCCCTGCTGGAACCATGGCAACATCACCCGCTCCAAGGCGGAGGAGCTGCTTTCCAGGACAGGCAAGGACGGGAGCTTCCTCGTG
CGTGCCAGCGAGTCCATCTCCCGGGCATACGCGCTCTGCGTGCTGTATCGGAATTGCGTTTACACTTACAGAATTCTGCCCAATGAAGAT
GATAAATTCACTGTTCAGCTAGAGCAAGAGAGAAGAGAGGCAGAAATGAGGGCAAAACGGGAAGAGGAAGAGCGAAAGAGGCAGGAAGAA
CTCCGAAGACAACAGGAGGAAATTCTTCGGCGACAGCAGGAAGAAGAAAGGAAAAGGCGAGAGGAAGAAGAACTTGCCCGAAGGAAACAG
GAAGAGGCTCTGCGTCGCCAGCGGGAGCAAGAAATTGCATTAAGGCGACAGCGAGAAGAGGAAGAAAGACAGCAGCAAGAAGAAGCTCTT
AGAAGACTGGAAGAGAGGAGAAGAGAAGAGGAAGAAAGGCGGAAGCAGGAAGAATTGTTACGCAAACAGGAAGAGGAGGCTGCAAAATGG
GCCCGGGAAGAAGAAGAAGCCCAGCGTCGATTAGAGGAGAACCGGCTGCGGATGGAAGAGGAGGCAGCCAGACTCCGGCATGAGGAAGAA
GAACGGAAGAGAAAGGAGCTGGAGGTCCAGCGGCAGAAGGAGTTAATGCGCCAGAGGCAGCAGCAGCAAGAGGCTCTCCGGAGGTTGCAG
CAGCAGCAGCAGCAACAACAGCTGGCGCAGATGAAGCTTCCTTCTTCTTCAACGTGGGGCCAGCAGTCCAATACAACAGCATGTCAGTCC
CAGGCCACGCTGTCGTTGGCTGAAATCCAAAAACTAGAGGAAGAACGAGAACGGCAGCTTCGAGAAGAGCAAAGGCGCCAGCAGAGGGAG
TTGATGAAAGCTCTTCAGCAGCAGCAGCAACAGCAACAGCAGAAACTCTCAGGTTGGGGGAATGTCAGCAAACCTTCAGGTACCACGAAA
TCTCTTCTGGAGATCCAGCAGGAAGAGGCCAGGCAAATGCAAAAGCAGCAGCAGCAGCAGCAGCAACACCAGCAACCAAACAGAGCTCGT
AACAATACGCATTCCAACCTGCACACCAGCATTGGGAATTCTGTTTGGGGCTCTATAAATACTGGTCCTCCTAACCAGTGGGCATCTGAC
CTAGTCAGTAGTATTTGGAGTAATGCTGACACTAAAAACTCCAACATGGGATTCTGGGATGATGCAGTGAAAGAGGTGGGACCTAGGAAT
TCAACAAATAAAAATAAAAACAACGCCAGTCTCAGTAAATCTGTAGGTGTGTCTAACCGGCAGAATAAGAAAGTAGAAGAAGAAGAAAAG
TTGCTGAAGCTCTTTCAGGGAGTAAATAAAGCCCAAGATGGATTTACGCAGTGGTGTGAACAGATGCTTCATGCCCTTAATACGGCAAAT
AACTTGGATGTTCCCACATTTGTTTCTTTCCTGAAAGAAGTAGAATCTCCTTATGAGGTCCATGATTATATCAGGGCCTATTTAGGAGAT
ACTTCTGAGGCCAAGGAGTTTGCCAAGCAGTTCCTTGAGCGCCGTGCCAAACAGAAAGCCAACCAGCAGCGTCAGCAGCAGCAGCTGCCA
CAGCAGCAGCAGCAGCAGCCGCCACAGCAGCCGCCACAGCAGCCACAACAGCAGGACTCTGTGTGGGGGATGAACCACAGTACACTCCAT
TCAGTATTTCAGACCAATCAAAGCAACAACCAACAATCCAATTTTGAGGCTGTGCAGAGTGGCAAGAAGAAGAAAAAGCAGAAGATGGTC
CGAGCAGATCCCAGTTTATTAGGATTTTCAGTCAATGCATCATCGGAGCGACTCAACATGGGTGAAATCGAGACGTTGGATGACTACTGA
GCACCTGCCAGTGGACTGGCCATCCCTCTCCTGTCTGCCGACTATGGAGTCTCCACCTTTGGACACAACACTTACTCACCATTTACTCTT
TATCACTCTGCAACAAATCACAGAACCGATCATCTCAGGCTTTTTCTTCTGGCCCTTTGTGTCCAAGATTCTTTAATCCATTTTTGTTGG
TGAACATCTCAGACTATAGATAAGTGGACTGGACCCTGTGTCTTGGGGGTGGCAGTTGGGATTACTCCCCAACAAGGCTGATTTTAGGCA
GCATGTGTTCACTGTGCTGTGATTTCATCTACTGTCTCCCAGAAAGTGTGTTGGGATCGGCCATTAGCAGCTTGCTTTCTCTTGTCACTT
TTTTTCTTCTATTTTGTTTTTTCTTCTTCTTTTTCCCCCCATCAGGGCAAATGGTCTAACTGGTGCAATCATGAAGAGAGTTAATGGTTA
ACAGACATTGGCCAATAACAAAACACCCCATGGACTGTGACTCGAGTATCCAACAGGCAGTCAGAGCTCTCCCGGTCTGAAAGTTGCATT
GCCACTGCTAACTTTGGGATTGCATCAGAGAGGCCCTGAGTGGGGTTGAGATGAGGTTGGTTTGGTTTGATGTTACACACTCCTCACCTG
TTCTTTCTGAGTGTCCTTTCTCTGAAAGGATTTATGTTTTTCTTCGTTAGATAGTGACTTCTGAGCAAGCTGATCTCCCCTGGCATGCTC
CAACCTGATTGGACAAAGGAAGCTCTATGGCCTGGGAGAGAGACTATTCTTAATTTTTCTTTCTTACAAAAACTGATTTTTCCCATAAAT
ATTTTTACTTCAGAGGACTAGGACCATTTTGTTTTGGGCCCTTCTGCTGAAAATTTGTCTCGTTTAAGAGGCAGCTAGAATCTTTACCAT
ATGTATGAATTTGTATAATTTCATTTTTGGATAGGGATAAACTTTTGCTTCTGATAAAAGCCTGGAATTTCATCTGGTCCTCAGAGCATT
GCGTGTGTGTCTTGCTGTAGCCCGGAAAAGGTTTTGTGTAAAGATTCTGGGATGGCAAGTTGTTTGCCTTTTCTGAAAAGAGAACATACA
GAACCTGTCCATCTTTAAGACCTTCATCCATGGAATCTACTATACAGGAGGATGCAGTGGGCTGGAGGGGATGGGCGAAAATGGGAGCAG
GAAGCCTGGCCTGGCTTCTGGTCATGGCCTCCTAAAACCTTAAACTTCAAGTAGAAATGTACTCAAGCCCTATTTATAAACAAATACTTT
TCCTGCCTCCACCAAACCCCTACAGAACATCACCTGGAATTGCCACTCACACTGGGTTGGAGTCATTGGGCAGCTGTGCCTGTGCGAGAG
GTGCTGTGGTCTGGGCAGCCCCTGGAAAAGCACCTTTGCTGCCTGTCATTGTTGCCTGAAGAAGGCTGGAGTTGCTCTGAGAGCAGTTTG
GGTTTGGAGTATTATATTTGGCTTCTATTTTTATTATTTTGGATCACCATTCTCCCTATCCCTTCTTGCCTCCCTCCCTTCTAAACATGT
GTAATAACTATACAGAGACTGCTACAAAATTGTATATAGTTTTTGGATCAAATAGCATGAGGGGAGAGGAAACCATTAAAAGTTGGGGCT
CCTACTCTCCTTTGCTTTGTAAATTCAAAAGTTGGGGGTGGGTAAGAGGGATAGTTAAAATGTTTACAAAACTTTAGGCTCCCTCGGAAC

>In-frame_INPP5D_ENST00000538935_chr2_233944108_+_GIGYF2_ENST00000409547_chr2_233681581_+_3657nt
ATGGTCCCCTGCTGGAACCATGGCAACATCACCCGCTCCAAGGCGGAGGAGCTGCTTTCCAGGACAGGCAAGGACGGGAGCTTCCTCGTG
CGTGCCAGCGAGTCCATCTCCCGGGCATACGCGCTCTGCGTGCTGTATCGGAATTGCGTTTACACTTACAGAATTCTGCCCAATGAAGAT
GATAAATTCACTGTTCAGCTAGAGCAAGAGAGAAGAGAGGCAGAAATGAGGGCAAAACGGGAAGAGGAAGAGCGAAAGAGGCAGGAAGAA
CTCCGAAGACAACAGGAGGAAATTCTTCGGCGACAGCAGGAAGAAGAAAGGAAAAGGCGAGAGGAAGAAGAACTTGCCCGAAGGAAACAG
GAAGAGGCTCTGCGTCGCCAGCGGGAGCAAGAAATTGCATTAAGGCGACAGCGAGAAGAGGAAGAAAGACAGCAGCAAGAAGAAGCTCTT
AGAAGACTGGAAGAGAGGAGAAGAGAAGAGGAAGAAAGGCGGAAGCAGGAAGAATTGTTACGCAAACAGGAAGAGGAGGCTGCAAAATGG
GCCCGGGAAGAAGAAGAAGCCCAGCGTCGATTAGAGGAGAACCGGCTGCGGATGGAAGAGGAGGCAGCCAGACTCCGGCATGAGGAAGAA
GAACGGAAGAGAAAGGAGCTGGAGGTCCAGCGGCAGAAGGAGTTAATGCGCCAGAGGCAGCAGCAGCAAGAGGCTCTCCGGAGGTTGCAG
CAGCAGCAGCAGCAACAACAGCTGGCGCAGATGAAGCTTCCTTCTTCTTCAACGTGGGGCCAGCAGTCCAATACAACAGCATGTCAGTCC
CAGGCCACGCTGTCGTTGGCTGAAATCCAAAAACTAGAGGAAGAACGAGAACGGCAGCTTCGAGAAGAGCAAAGGCGCCAGCAGAGGGAG
TTGATGAAAGCTCTTCAGCAGCAGCAGCAACAGCAACAGCAGAAACTCTCAGGTTGGGGGAATGTCAGCAAACCTTCAGGTACCACGAAA
TCTCTTCTGGAGATCCAGCAGGAAGAGGCCAGGCAAATGCAAAAGCAGCAGCAGCAGCAGCAGCAACACCAGCAACCAAACAGAGCTCGT
AACAATACGCATTCCAACCTGCACACCAGCATTGGGAATTCTGTTTGGGGCTCTATAAATACTGGTCCTCCTAACCAGTGGGCATCTGAC
CTAGTCAGTAGTATTTGGAGTAATGCTGACACTAAAAACTCCAACATGGGATTCTGGGATGATGCAGTGAAAGAGGTGGGACCTAGGAAT
TCAACAAATAAAAATAAAAACAACGCCAGTCTCAGTAAATCTGTAGGTGTGTCTAACCGGCAGAATAAGAAAGTAGAAGAAGAAGAAAAG
TTGCTGAAGCTCTTTCAGGGAGTAAATAAAGCCCAAGATGGATTTACGCAGTGGTGTGAACAGATGCTTCATGCCCTTAATACGGCAAAT
AACTTGGATGTTCCCACATTTGTTTCTTTCCTGAAAGAAGTAGAATCTCCTTATGAGGTCCATGATTATATCAGGGCCTATTTAGGAGAT
ACTTCTGAGGCCAAGGAGTTTGCCAAGCAGTTCCTTGAGCGCCGTGCCAAACAGAAAGCCAACCAGCAGCGTCAGCAGCAGCAGCTGCCA
CAGCAGCAGCAGCAGCAGCCGCCACAGCAGCCGCCACAGCAGCCACAACAGCAGGACTCTGTGTGGGGGATGAACCACAGTACACTCCAT
TCAGTATTTCAGACCAATCAAAGCAACAACCAACAATCCAATTTTGAGGCTGTGCAGAGTGGCAAGAAGAAGAAAAAGCAGAAGATGGTC
CGAGCAGATCCCAGTTTATTAGGATTTTCAGTCAATGCATCATCGGAGCGACTCAACATGGGTGAAATCGAGACGTTGGATGACTACTGA
GCACCTGCCAGTGGACTGGCCATCCCTCTCCTGTCTGCCGACTATGGAGTCTCCACCTTTGGACACAACACTTACTCACCATTTACTCTT
TATCACTCTGCAACAAATCACAGAACCGATCATCTCAGGCTTTTTCTTCTGGCCCTTTGTGTCCAAGATTCTTTAATCCATTTTTGTTGG
TGAACATCTCAGACTATAGATAAGTGGACTGGACCCTGTGTCTTGGGGGTGGCAGTTGGGATTACTCCCCAACAAGGCTGATTTTAGGCA
GCATGTGTTCACTGTGCTGTGATTTCATCTACTGTCTCCCAGAAAGTGTGTTGGGATCGGCCATTAGCAGCTTGCTTTCTCTTGTCACTT
TTTTTCTTCTATTTTGTTTTTTCTTCTTCTTTTTCCCCCCATCAGGGCAAATGGTCTAACTGGTGCAATCATGAAGAGAGTTAATGGTTA
ACAGACATTGGCCAATAACAAAACACCCCATGGACTGTGACTCGAGTATCCAACAGGCAGTCAGAGCTCTCCCGGTCTGAAAGTTGCATT
GCCACTGCTAACTTTGGGATTGCATCAGAGAGGCCCTGAGTGGGGTTGAGATGAGGTTGGTTTGGTTTGATGTTACACACTCCTCACCTG
TTCTTTCTGAGTGTCCTTTCTCTGAAAGGATTTATGTTTTTCTTCGTTAGATAGTGACTTCTGAGCAAGCTGATCTCCCCTGGCATGCTC
CAACCTGATTGGACAAAGGAAGCTCTATGGCCTGGGAGAGAGACTATTCTTAATTTTTCTTTCTTACAAAAACTGATTTTTCCCATAAAT
ATTTTTACTTCAGAGGACTAGGACCATTTTGTTTTGGGCCCTTCTGCTGAAAATTTGTCTCGTTTAAGAGGCAGCTAGAATCTTTACCAT
ATGTATGAATTTGTATAATTTCATTTTTGGATAGGGATAAACTTTTGCTTCTGATAAAAGCCTGGAATTTCATCTGGTCCTCAGAGCATT
GCGTGTGTGTCTTGCTGTAGCCCGGAAAAGGTTTTGTGTAAAGATTCTGGGATGGCAAGTTGTTTGCCTTTTCTGAAAAGAGAACATACA
GAACCTGTCCATCTTTAAGACCTTCATCCATGGAATCTACTATACAGGAGGATGCAGTGGGCTGGAGGGGATGGGCGAAAATGGGAGCAG
GAAGCCTGGCCTGGCTTCTGGTCATGGCCTCCTAAAACCTTAAACTTCAAGTAGAAATGTACTCAAGCCCTATTTATAAACAAATACTTT
TCCTGCCTCCACCAAACCCCTACAGAACATCACCTGGAATTGCCACTCACACTGGGTTGGAGTCATTGGGCAGCTGTGCCTGTGCGAGAG
GTGCTGTGGTCTGGGCAGCCCCTGGAAAAGCACCTTTGCTGCCTGTCATTGTTGCCTGAAGAAGGCTGGAGTTGCTCTGAGAGCAGTTTG
GGTTTGGAGTATTATATTTGGCTTCTATTTTTATTATTTTGGATCACCATTCTCCCTATCCCTTCTTGCCTCCCTCCCTTCTAAACATGT
GTAATAACTATACAGAGACTGCTACAAAATTGTATATAGTTTTTGGATCAAATAGCATGAGGGGAGAGGAAACCATTAAAAGTTGGGGCT
CCTACTCTCCTTTGCTTTGTAAATTCAAAAGTTGGGGGTGGGTAAGAGGGATAGTTAAAATGTTTACAAAACTTTAGGCTCCCTCGGAAC

>In-frame_INPP5D_ENST00000538935_chr2_233944108_+_GIGYF2_ENST00000409196_chr2_233681581_+_3657nt
ATGGTCCCCTGCTGGAACCATGGCAACATCACCCGCTCCAAGGCGGAGGAGCTGCTTTCCAGGACAGGCAAGGACGGGAGCTTCCTCGTG
CGTGCCAGCGAGTCCATCTCCCGGGCATACGCGCTCTGCGTGCTGTATCGGAATTGCGTTTACACTTACAGAATTCTGCCCAATGAAGAT
GATAAATTCACTGTTCAGCTAGAGCAAGAGAGAAGAGAGGCAGAAATGAGGGCAAAACGGGAAGAGGAAGAGCGAAAGAGGCAGGAAGAA
CTCCGAAGACAACAGGAGGAAATTCTTCGGCGACAGCAGGAAGAAGAAAGGAAAAGGCGAGAGGAAGAAGAACTTGCCCGAAGGAAACAG
GAAGAGGCTCTGCGTCGCCAGCGGGAGCAAGAAATTGCATTAAGGCGACAGCGAGAAGAGGAAGAAAGACAGCAGCAAGAAGAAGCTCTT
AGAAGACTGGAAGAGAGGAGAAGAGAAGAGGAAGAAAGGCGGAAGCAGGAAGAATTGTTACGCAAACAGGAAGAGGAGGCTGCAAAATGG
GCCCGGGAAGAAGAAGAAGCCCAGCGTCGATTAGAGGAGAACCGGCTGCGGATGGAAGAGGAGGCAGCCAGACTCCGGCATGAGGAAGAA
GAACGGAAGAGAAAGGAGCTGGAGGTCCAGCGGCAGAAGGAGTTAATGCGCCAGAGGCAGCAGCAGCAAGAGGCTCTCCGGAGGTTGCAG
CAGCAGCAGCAGCAACAACAGCTGGCGCAGATGAAGCTTCCTTCTTCTTCAACGTGGGGCCAGCAGTCCAATACAACAGCATGTCAGTCC
CAGGCCACGCTGTCGTTGGCTGAAATCCAAAAACTAGAGGAAGAACGAGAACGGCAGCTTCGAGAAGAGCAAAGGCGCCAGCAGAGGGAG
TTGATGAAAGCTCTTCAGCAGCAGCAGCAACAGCAACAGCAGAAACTCTCAGGTTGGGGGAATGTCAGCAAACCTTCAGGTACCACGAAA
TCTCTTCTGGAGATCCAGCAGGAAGAGGCCAGGCAAATGCAAAAGCAGCAGCAGCAGCAGCAGCAACACCAGCAACCAAACAGAGCTCGT
AACAATACGCATTCCAACCTGCACACCAGCATTGGGAATTCTGTTTGGGGCTCTATAAATACTGGTCCTCCTAACCAGTGGGCATCTGAC
CTAGTCAGTAGTATTTGGAGTAATGCTGACACTAAAAACTCCAACATGGGATTCTGGGATGATGCAGTGAAAGAGGTGGGACCTAGGAAT
TCAACAAATAAAAATAAAAACAACGCCAGTCTCAGTAAATCTGTAGGTGTGTCTAACCGGCAGAATAAGAAAGTAGAAGAAGAAGAAAAG
TTGCTGAAGCTCTTTCAGGGAGTAAATAAAGCCCAAGATGGATTTACGCAGTGGTGTGAACAGATGCTTCATGCCCTTAATACGGCAAAT
AACTTGGATGTTCCCACATTTGTTTCTTTCCTGAAAGAAGTAGAATCTCCTTATGAGGTCCATGATTATATCAGGGCCTATTTAGGAGAT
ACTTCTGAGGCCAAGGAGTTTGCCAAGCAGTTCCTTGAGCGCCGTGCCAAACAGAAAGCCAACCAGCAGCGTCAGCAGCAGCAGCTGCCA
CAGCAGCAGCAGCAGCAGCCGCCACAGCAGCCGCCACAGCAGCCACAACAGCAGGACTCTGTGTGGGGGATGAACCACAGTACACTCCAT
TCAGTATTTCAGACCAATCAAAGCAACAACCAACAATCCAATTTTGAGGCTGTGCAGAGTGGCAAGAAGAAGAAAAAGCAGAAGATGGTC
CGAGCAGATCCCAGTTTATTAGGATTTTCAGTCAATGCATCATCGGAGCGACTCAACATGGGTGAAATCGAGACGTTGGATGACTACTGA
GCACCTGCCAGTGGACTGGCCATCCCTCTCCTGTCTGCCGACTATGGAGTCTCCACCTTTGGACACAACACTTACTCACCATTTACTCTT
TATCACTCTGCAACAAATCACAGAACCGATCATCTCAGGCTTTTTCTTCTGGCCCTTTGTGTCCAAGATTCTTTAATCCATTTTTGTTGG
TGAACATCTCAGACTATAGATAAGTGGACTGGACCCTGTGTCTTGGGGGTGGCAGTTGGGATTACTCCCCAACAAGGCTGATTTTAGGCA
GCATGTGTTCACTGTGCTGTGATTTCATCTACTGTCTCCCAGAAAGTGTGTTGGGATCGGCCATTAGCAGCTTGCTTTCTCTTGTCACTT
TTTTTCTTCTATTTTGTTTTTTCTTCTTCTTTTTCCCCCCATCAGGGCAAATGGTCTAACTGGTGCAATCATGAAGAGAGTTAATGGTTA
ACAGACATTGGCCAATAACAAAACACCCCATGGACTGTGACTCGAGTATCCAACAGGCAGTCAGAGCTCTCCCGGTCTGAAAGTTGCATT
GCCACTGCTAACTTTGGGATTGCATCAGAGAGGCCCTGAGTGGGGTTGAGATGAGGTTGGTTTGGTTTGATGTTACACACTCCTCACCTG
TTCTTTCTGAGTGTCCTTTCTCTGAAAGGATTTATGTTTTTCTTCGTTAGATAGTGACTTCTGAGCAAGCTGATCTCCCCTGGCATGCTC
CAACCTGATTGGACAAAGGAAGCTCTATGGCCTGGGAGAGAGACTATTCTTAATTTTTCTTTCTTACAAAAACTGATTTTTCCCATAAAT
ATTTTTACTTCAGAGGACTAGGACCATTTTGTTTTGGGCCCTTCTGCTGAAAATTTGTCTCGTTTAAGAGGCAGCTAGAATCTTTACCAT
ATGTATGAATTTGTATAATTTCATTTTTGGATAGGGATAAACTTTTGCTTCTGATAAAAGCCTGGAATTTCATCTGGTCCTCAGAGCATT
GCGTGTGTGTCTTGCTGTAGCCCGGAAAAGGTTTTGTGTAAAGATTCTGGGATGGCAAGTTGTTTGCCTTTTCTGAAAAGAGAACATACA
GAACCTGTCCATCTTTAAGACCTTCATCCATGGAATCTACTATACAGGAGGATGCAGTGGGCTGGAGGGGATGGGCGAAAATGGGAGCAG
GAAGCCTGGCCTGGCTTCTGGTCATGGCCTCCTAAAACCTTAAACTTCAAGTAGAAATGTACTCAAGCCCTATTTATAAACAAATACTTT
TCCTGCCTCCACCAAACCCCTACAGAACATCACCTGGAATTGCCACTCACACTGGGTTGGAGTCATTGGGCAGCTGTGCCTGTGCGAGAG
GTGCTGTGGTCTGGGCAGCCCCTGGAAAAGCACCTTTGCTGCCTGTCATTGTTGCCTGAAGAAGGCTGGAGTTGCTCTGAGAGCAGTTTG
GGTTTGGAGTATTATATTTGGCTTCTATTTTTATTATTTTGGATCACCATTCTCCCTATCCCTTCTTGCCTCCCTCCCTTCTAAACATGT
GTAATAACTATACAGAGACTGCTACAAAATTGTATATAGTTTTTGGATCAAATAGCATGAGGGGAGAGGAAACCATTAAAAGTTGGGGCT
CCTACTCTCCTTTGCTTTGTAAATTCAAAAGTTGGGGGTGGGTAAGAGGGATAGTTAAAATGTTTACAAAACTTTAGGCTCCCTCGGAAC

>In-frame_INPP5D_ENST00000538935_chr2_233944108_+_GIGYF2_ENST00000409451_chr2_233681581_+_3638nt
ATGGTCCCCTGCTGGAACCATGGCAACATCACCCGCTCCAAGGCGGAGGAGCTGCTTTCCAGGACAGGCAAGGACGGGAGCTTCCTCGTG
CGTGCCAGCGAGTCCATCTCCCGGGCATACGCGCTCTGCGTGCTGTATCGGAATTGCGTTTACACTTACAGAATTCTGCCCAATGAAGAT
GATAAATTCACTGTTCAGCTAGAGCAAGAGAGAAGAGAGGCAGAAATGAGGGCAAAACGGGAAGAGGAAGAGCGAAAGAGGCAGGAAGAA
CTCCGAAGACAACAGGAGGAAATTCTTCGGCGACAGCAGGAAGAAGAAAGGAAAAGGCGAGAGGAAGAAGAACTTGCCCGAAGGAAACAG
GAAGAGGCTCTGCGTCGCCAGCGGGAGCAAGAAATTGCATTAAGGCGACAGCGAGAAGAGGAAGAAAGACAGCAGCAAGAAGAAGCTCTT
AGAAGACTGGAAGAGAGGAGAAGAGAAGAGGAAGAAAGGCGGAAGCAGGAAGAATTGTTACGCAAACAGGAAGAGGAGGCTGCAAAATGG
GCCCGGGAAGAAGAAGAAGCCCAGCGTCGATTAGAGGAGAACCGGCTGCGGATGGAAGAGGAGGCAGCCAGACTCCGGCATGAGGAAGAA
GAACGGAAGAGAAAGGAGCTGGAGGTCCAGCGGCAGAAGGAGTTAATGCGCCAGAGGCAGCAGCAGCAAGAGGCTCTCCGGAGGTTGCAG
CAGCAGCAGCAGCAACAACAGCTGGCGCAGATGAAGCTTCCTTCTTCTTCAACGTGGGGCCAGCAGTCCAATACAACAGCATGTCAGTCC
CAGGCCACGCTGTCGTTGGCTGAAATCCAAAAACTAGAGGAAGAACGAGAACGGCAGCTTCGAGAAGAGCAAAGGCGCCAGCAGAGGGAG
TTGATGAAAGCTCTTCAGCAGCAGCAGCAACAGCAACAGCAGAAACTCTCAGGTTGGGGGAATGTCAGCAAACCTTCAGGTACCACGAAA
TCTCTTCTGGAGATCCAGCAGGAAGAGGCCAGGCAAATGCAAAAGCAGCAGCAGCAGCAGCAGCAACACCAGCAACCAAACAGAGCTCGT
AACAATACGCATTCCAACCTGCACACCAGCATTGGGAATTCTGTTTGGGGCTCTATAAATACTGGTCCTCCTAACCAGTGGGCATCTGAC
CTAGTCAGTAGTATTTGGAGTAATGCTGACACTAAAAACTCCAACATGGGATTCTGGGATGATGCAGTGAAAGAGGTGGGACCTAGGAAT
TCAACAAATAAAAATAAAAACAACGCCAGTCTCAGTAAATCTGTAGGTGTGTCTAACCGGCAGAATAAGAAAGTAGAAGAAGAAGAAAAG
TTGCTGAAGCTCTTTCAGGGAGTAAATAAAGCCCAAGATGGATTTACGCAGTGGTGTGAACAGATGCTTCATGCCCTTAATACGGCAAAT
AACTTGGATGTTCCCACATTTGTTTCTTTCCTGAAAGAAGTAGAATCTCCTTATGAGGTCCATGATTATATCAGGGCCTATTTAGGAGAT
ACTTCTGAGGCCAAGGAGTTTGCCAAGCAGTTCCTTGAGCGCCGTGCCAAACAGAAAGCCAACCAGCAGCGTCAGCAGCAGCAGCTGCCA
CAGCAGCAGCAGCAGCAGCCGCCACAGCAGCCGCCACAGCAGCCACAACAGCAGGACTCTGTGTGGGGGATGAACCACAGTACACTCCAT
TCAGTATTTCAGACCAATCAAAGCAACAACCAACAATCCAATTTTGAGGCTGTGCAGAGTGGCAAGAAGAAGAAAAAGCAGAAGATGGTC
CGAGCAGATCCCAGTTTATTAGGATTTTCAGTCAATGCATCATCGGAGCGACTCAACATGGGTGAAATCGAGACGTTGGATGACTACTGA
GCACCTGCCAGTGGACTGGCCATCCCTCTCCTGTCTGCCGACTATGGAGTCTCCACCTTTGGACACAACACTTACTCACCATTTACTCTT
TATCACTCTGCAACAAATCACAGAACCGATCATCTCAGGCTTTTTCTTCTGGCCCTTTGTGTCCAAGATTCTTTAATCCATTTTTGTTGG
TGAACATCTCAGACTATAGATAAGTGGACTGGACCCTGTGTCTTGGGGGTGGCAGTTGGGATTACTCCCCAACAAGGCTGATTTTAGGCA
GCATGTGTTCACTGTGCTGTGATTTCATCTACTGTCTCCCAGAAAGTGTGTTGGGATCGGCCATTAGCAGCTTGCTTTCTCTTGTCACTT
TTTTTCTTCTATTTTGTTTTTTCTTCTTCTTTTTCCCCCCATCAGGGCAAATGGTCTAACTGGTGCAATCATGAAGAGAGTTAATGGTTA
ACAGACATTGGCCAATAACAAAACACCCCATGGACTGTGACTCGAGTATCCAACAGGCAGTCAGAGCTCTCCCGGTCTGAAAGTTGCATT
GCCACTGCTAACTTTGGGATTGCATCAGAGAGGCCCTGAGTGGGGTTGAGATGAGGTTGGTTTGGTTTGATGTTACACACTCCTCACCTG
TTCTTTCTGAGTGTCCTTTCTCTGAAAGGATTTATGTTTTTCTTCGTTAGATAGTGACTTCTGAGCAAGCTGATCTCCCCTGGCATGCTC
CAACCTGATTGGACAAAGGAAGCTCTATGGCCTGGGAGAGAGACTATTCTTAATTTTTCTTTCTTACAAAAACTGATTTTTCCCATAAAT
ATTTTTACTTCAGAGGACTAGGACCATTTTGTTTTGGGCCCTTCTGCTGAAAATTTGTCTCGTTTAAGAGGCAGCTAGAATCTTTACCAT
ATGTATGAATTTGTATAATTTCATTTTTGGATAGGGATAAACTTTTGCTTCTGATAAAAGCCTGGAATTTCATCTGGTCCTCAGAGCATT
GCGTGTGTGTCTTGCTGTAGCCCGGAAAAGGTTTTGTGTAAAGATTCTGGGATGGCAAGTTGTTTGCCTTTTCTGAAAAGAGAACATACA
GAACCTGTCCATCTTTAAGACCTTCATCCATGGAATCTACTATACAGGAGGATGCAGTGGGCTGGAGGGGATGGGCGAAAATGGGAGCAG
GAAGCCTGGCCTGGCTTCTGGTCATGGCCTCCTAAAACCTTAAACTTCAAGTAGAAATGTACTCAAGCCCTATTTATAAACAAATACTTT
TCCTGCCTCCACCAAACCCCTACAGAACATCACCTGGAATTGCCACTCACACTGGGTTGGAGTCATTGGGCAGCTGTGCCTGTGCGAGAG
GTGCTGTGGTCTGGGCAGCCCCTGGAAAAGCACCTTTGCTGCCTGTCATTGTTGCCTGAAGAAGGCTGGAGTTGCTCTGAGAGCAGTTTG
GGTTTGGAGTATTATATTTGGCTTCTATTTTTATTATTTTGGATCACCATTCTCCCTATCCCTTCTTGCCTCCCTCCCTTCTAAACATGT
GTAATAACTATACAGAGACTGCTACAAAATTGTATATAGTTTTTGGATCAAATAGCATGAGGGGAGAGGAAACCATTAAAAGTTGGGGCT
CCTACTCTCCTTTGCTTTGTAAATTCAAAAGTTGGGGGTGGGTAAGAGGGATAGTTAAAATGTTTACAAAACTTTAGGCTCCCTCGGAAC

>In-frame_INPP5D_ENST00000359570_chr2_233944108_+_GIGYF2_ENST00000373566_chr2_233681581_+_5605nt
ATGGTCCCCTGCTGGAACCATGGCAACATCACCCGCTCCAAGGCGGAGGAGCTGCTTTCCAGGACAGGCAAGGACGGGAGCTTCCTCGTG
CGTGCCAGCGAGTCCATCTCCCGGGCATACGCGCTCTGCGTGCTGTATCGGAATTGCGTTTACACTTACAGAATTCTGCCCAATGAAGAT
GATAAATTCACTGTTCAGCTAGAGCAAGAGAGAAGAGAGGCAGAAATGAGGGCAAAACGGGAAGAGGAAGAGCGAAAGAGGCAGGAAGAA
CTCCGAAGACAACAGGAGGAAATTCTTCGGCGACAGCAGGAAGAAGAAAGGAAAAGGCGAGAGGAAGAAGAACTTGCCCGAAGGAAACAG
GAAGAGGCTCTGCGTCGCCAGCGGGAGCAAGAAATTGCATTAAGGCGACAGCGAGAAGAGGAAGAAAGACAGCAGCAAGAAGAAGCTCTT
AGAAGACTGGAAGAGAGGAGAAGAGAAGAGGAAGAAAGGCGGAAGCAGGAAGAATTGTTACGCAAACAGGAAGAGGAGGCTGCAAAATGG
GCCCGGGAAGAAGAAGAAGCCCAGCGTCGATTAGAGGAGAACCGGCTGCGGATGGAAGAGGAGGCAGCCAGACTCCGGCATGAGGAAGAA
GAACGGAAGAGAAAGGAGCTGGAGGTCCAGCGGCAGAAGGAGTTAATGCGCCAGAGGCAGCAGCAGCAAGAGGCTCTCCGGAGGTTGCAG
CAGCAGCAGCAGCAACAACAGCTGGCGCAGATGAAGCTTCCTTCTTCTTCAACGTGGGGCCAGCAGTCCAATACAACAGCATGTCAGTCC
CAGGCCACGCTGTCGTTGGCTGAAATCCAAAAACTAGAGGAAGAACGAGAACGGCAGCTTCGAGAAGAGCAAAGGCGCCAGCAGAGGGAG
TTGATGAAAGCTCTTCAGCAGCAGCAGCAACAGCAACAGCAGAAACTCTCAGGTTGGGGGAATGTCAGCAAACCTTCAGGTACCACGAAA
TCTCTTCTGGAGATCCAGCAGGAAGAGGCCAGGCAAATGCAAAAGCAGCAGCAGCAGCAGCAGCAACACCAGCAACCAAACAGAGCTCGT
AACAATACGCATTCCAACCTGCACACCAGCATTGGGAATTCTGTTTGGGGCTCTATAAATACTGGTCCTCCTAACCAGTGGGCATCTGAC
CTAGTCAGTAGTATTTGGAGTAATGCTGACACTAAAAACTCCAACATGGGATTCTGGGATGATGCAGTGAAAGAGGTGGGACCTAGGAAT
TCAACAAATAAAAATAAAAACAACGCCAGTCTCAGTAAATCTGTAGGTGTGTCTAACCGGCAGAATAAGAAAGTAGAAGAAGAAGAAAAG
TTGCTGAAGCTCTTTCAGGGAGTAAATAAAGCCCAAGATGGATTTACGCAGTGGTGTGAACAGATGCTTCATGCCCTTAATACGGCAAAT
AACTTGGATGTTCCCACATTTGTTTCTTTCCTGAAAGAAGTAGAATCTCCTTATGAGGTCCATGATTATATCAGGGCCTATTTAGGAGAT
ACTTCTGAGGCCAAGGAGTTTGCCAAGCAGTTCCTTGAGCGCCGTGCCAAACAGAAAGCCAACCAGCAGCGTCAGCAGCAGCAGCTGCCA
CAGCAGCAGCAGCAGCAGCCGCCACAGCAGCCGCCACAGCAGCCACAACAGCAGGACTCTGTGTGGGGGATGAACCACAGTACACTCCAT
TCAGTATTTCAGACCAATCAAAGCAACAACCAACAATCCAATTTTGAGGCTGTGCAGAGTGGCAAGAAGAAGAAAAAGCAGAAGATGGTC
CGAGCAGATCCCAGTTTATTAGGATTTTCAGTCAATGCATCATCGGAGCGACTCAACATGGGTGAAATCGAGACGTTGGATGACTACTGA
GCACCTGCCAGTGGACTGGCCATCCCTCTCCTGTCTGCCGACTATGGAGTCTCCACCTTTGGACACAACACTTACTCACCATTTACTCTT
TATCACTCTGCAACAAATCACAGAACCGATCATCTCAGGCTTTTTCTTCTGGCCCTTTGTGTCCAAGATTCTTTAATCCATTTTTGTTGG
TGAACATCTCAGACTATAGATAAGTGGACTGGACCCTGTGTCTTGGGGGTGGCAGTTGGGATTACTCCCCAACAAGGCTGATTTTAGGCA
GCATGTGTTCACTGTGCTGTGATTTCATCTACTGTCTCCCAGAAAGTGTGTTGGGATCGGCCATTAGCAGCTTGCTTTCTCTTGTCACTT
TTTTTCTTCTATTTTGTTTTTTCTTCTTCTTTTTCCCCCCATCAGGGCAAATGGTCTAACTGGTGCAATCATGAAGAGAGTTAATGGTTA
ACAGACATTGGCCAATAACAAAACACCCCATGGACTGTGACTCGAGTATCCAACAGGCAGTCAGAGCTCTCCCGGTCTGAAAGTTGCATT
GCCACTGCTAACTTTGGGATTGCATCAGAGAGGCCCTGAGTGGGGTTGAGATGAGGTTGGTTTGGTTTGATGTTACACACTCCTCACCTG
TTCTTTCTGAGTGTCCTTTCTCTGAAAGGATTTATGTTTTTCTTCGTTAGATAGTGACTTCTGAGCAAGCTGATCTCCCCTGGCATGCTC
CAACCTGATTGGACAAAGGAAGCTCTATGGCCTGGGAGAGAGACTATTCTTAATTTTTCTTTCTTACAAAAACTGATTTTTCCCATAAAT
ATTTTTACTTCAGAGGACTAGGACCATTTTGTTTTGGGCCCTTCTGCTGAAAATTTGTCTCGTTTAAGAGGCAGCTAGAATCTTTACCAT
ATGTATGAATTTGTATAATTTCATTTTTGGATAGGGATAAACTTTTGCTTCTGATAAAAGCCTGGAATTTCATCTGGTCCTCAGAGCATT
GCGTGTGTGTCTTGCTGTAGCCCGGAAAAGGTTTTGTGTAAAGATTCTGGGATGGCAAGTTGTTTGCCTTTTCTGAAAAGAGAACATACA
GAACCTGTCCATCTTTAAGACCTTCATCCATGGAATCTACTATACAGGAGGATGCAGTGGGCTGGAGGGGATGGGCGAAAATGGGAGCAG
GAAGCCTGGCCTGGCTTCTGGTCATGGCCTCCTAAAACCTTAAACTTCAAGTAGAAATGTACTCAAGCCCTATTTATAAACAAATACTTT
TCCTGCCTCCACCAAACCCCTACAGAACATCACCTGGAATTGCCACTCACACTGGGTTGGAGTCATTGGGCAGCTGTGCCTGTGCGAGAG
GTGCTGTGGTCTGGGCAGCCCCTGGAAAAGCACCTTTGCTGCCTGTCATTGTTGCCTGAAGAAGGCTGGAGTTGCTCTGAGAGCAGTTTG
GGTTTGGAGTATTATATTTGGCTTCTATTTTTATTATTTTGGATCACCATTCTCCCTATCCCTTCTTGCCTCCCTCCCTTCTAAACATGT
GTAATAACTATACAGAGACTGCTACAAAATTGTATATAGTTTTTGGATCAAATAGCATGAGGGGAGAGGAAACCATTAAAAGTTGGGGCT
CCTACTCTCCTTTGCTTTGTAAATTCAAAAGTTGGGGGTGGGTAAGAGGGATAGTTAAAATGTTTACAAAACTTTAGGCTCCCTCGGAAC
TTTTGCCAGTGTGGAGGAAAATAAAAAAGAACTTAAATAAAATCTGATTGTATTCTATCTGAGTGCACCTCTTGTACTCACCTTTATGGA
GGCTGAGTTCTGCACTAAACTGTTCCTCTTGGTACCATGGAAAAGCTCCAAGCACCCAAGACATGGAGGCAGCCATGGCTTCTTTCTCTG
CCAGACCACGTAGCACTGGCTGGTTCTGTATTTGAGAATGTAGAGGTCAAGGCAGATGTCGGTAAGTTTGACCAAATATCTTTTCTCTTT
TTGACTCTCCCTTTCTGCTAACATGTGGATCAGCTCCTGCCCTCATACCGCAGACACACCCACTCTGAACACACCCCTCCAGAGCTTGCC
CACACCTTCCCAACTAGACTCTGTGTGTGTATTCAGGAAAAATGAAAATAAATTTTTAAAAATTGGGAGTGGAATGGGCAGATTAGGGGG
AACAAAGTCATTTTGGTCATGGAACATCCATTTGCTTAACCAAGGAGACTTGCTTCTATCTGAGGAATTTCCCACTTAGTAGAAAGAAAC
ACTCTTCCCTGGGAATGTTTGTTTCTGTCTCTCTCAATGCTACTCTCTTTCATATTCTCATTTGCTCACCCTTTCACTTAGAGCCACCGT
TTTCTCATCCCATTCTATGAACTTATTTCCAAATTCTCCTAACTATTCCTGAGTTTTGAAGTATTTGTTTTGTACCCTCTCTGCTTCCGG
TTTTTTGTTTGGTTGGCTTTTTTGGAGATAGGGTCTTGTGATGTTGCCCACACTGGTCTCGAGCCCCTGGGCTCAAGTGATCCTCCCGCC
TCAGCCTCCTAAATATCTAGGACTACAGGTGTGTGCCACCATGCCCAGCTCCAGTTTTGTTGGTTGATTTGTTTAAATTCAGAGATTTAA
AAACATCCCAGACAAGACAGTTTGATTATGGAGACTGTCCCCAAGCAGATTGGTGTGCTGGTGGCTGCTGTGCATAACAGATTCCCTCCA
GATTGGCTTACAACAGCTACTTCATTCTGTGGGTCAGGAATTTGGATAGGGCTCAGCTGGGTGGTGGTTCTCCTGGGGTATTCTTTGGTT
GTGGTCAGATGTCTTCCAGGGCATCATTCCTATGAAGGCTTAATGAATTAGGCAAGCTGTCCAAGATGGCTCACTCGTGTAATGACAGTT
GACGTTGGCTGTAGGCTGGGAACTCAGCTGGGTTGATGACTGGAGGAGCTTATGTGTGTCGTCTCCGGAATGGCAGCTTCAGAGGAGTTG
AACTTAAGTGGTGATTGGCTTCCCCCAGAGAACCAGGCAGAAGCTGTGTTACCTTTTTGAGCTCTTAGCTCAGGAGTCACATAGAGTCAC
TTCTGTGACACTGTGTTGCATCAAAGTAGTCACAAACCCACTCAGATTCAAGAGAAGGGAGCATGGCCCTCTCCCTGCAACCCCCTCCCC
CCCCGCCTTGATGAAAGGAGTGACAAGGTCACATTGGAGAAGAGCTTGTGGGGTGGGAGATATTATAGCCATTTTTGGGAAATATCTGCA
TAAAATGAGTTTATGCATACATGAAGGACTTTATTTTCATTGGCTTTAAGTTGAGGGTTTTTGTTTTTGTTTTTGTATTGGAGATGGGTT
CTTACTATGTTGCCCAGGCTGGTCTCAAACCCCTGGGCTCAAGTGATCCTGTTGCCTCAGCCTCCCAAGTAGCTGGGACTACAGCTATGT
GCCAGTGCACCCAGCTTGTTTTTTTTAAATTTTAGGATAGATAATGGTACTTCTGGCTTTATTTAAATAATTTTTTTAGGGAAACCATTG
TATTTATACATGCATATATTTTTATATATACAAATATGTATATAAAAGTATATGTTTTACATTTTCAATATATATATAATATATACATAT
ATGTTATATACGTATATATATTGCACCCTACTTTAAAATTGACTGATAACAAAATTGGTAATTTTGTATAAAATGCCCAACTGTGCATTA

>In-frame_INPP5D_ENST00000359570_chr2_233944108_+_GIGYF2_ENST00000373563_chr2_233681581_+_3642nt
ATGGTCCCCTGCTGGAACCATGGCAACATCACCCGCTCCAAGGCGGAGGAGCTGCTTTCCAGGACAGGCAAGGACGGGAGCTTCCTCGTG
CGTGCCAGCGAGTCCATCTCCCGGGCATACGCGCTCTGCGTGCTGTATCGGAATTGCGTTTACACTTACAGAATTCTGCCCAATGAAGAT
GATAAATTCACTGTTCAGCTAGAGCAAGAGAGAAGAGAGGCAGAAATGAGGGCAAAACGGGAAGAGGAAGAGCGAAAGAGGCAGGAAGAA
CTCCGAAGACAACAGGAGGAAATTCTTCGGCGACAGCAGGAAGAAGAAAGGAAAAGGCGAGAGGAAGAAGAACTTGCCCGAAGGAAACAG
GAAGAGGCTCTGCGTCGCCAGCGGGAGCAAGAAATTGCATTAAGGCGACAGCGAGAAGAGGAAGAAAGACAGCAGCAAGAAGAAGCTCTT
AGAAGACTGGAAGAGAGGAGAAGAGAAGAGGAAGAAAGGCGGAAGCAGGAAGAATTGTTACGCAAACAGGAAGAGGAGGCTGCAAAATGG
GCCCGGGAAGAAGAAGAAGCCCAGCGTCGATTAGAGGAGAACCGGCTGCGGATGGAAGAGGAGGCAGCCAGACTCCGGCATGAGGAAGAA
GAACGGAAGAGAAAGGAGCTGGAGGTCCAGCGGCAGAAGGAGTTAATGCGCCAGAGGCAGCAGCAGCAAGAGGCTCTCCGGAGGTTGCAG
CAGCAGCAGCAGCAACAACAGCTGGCGCAGATGAAGCTTCCTTCTTCTTCAACGTGGGGCCAGCAGTCCAATACAACAGCATGTCAGTCC
CAGGCCACGCTGTCGTTGGCTGAAATCCAAAAACTAGAGGAAGAACGAGAACGGCAGCTTCGAGAAGAGCAAAGGCGCCAGCAGAGGGAG
TTGATGAAAGCTCTTCAGCAGCAGCAGCAACAGCAACAGCAGAAACTCTCAGGTTGGGGGAATGTCAGCAAACCTTCAGGTACCACGAAA
TCTCTTCTGGAGATCCAGCAGGAAGAGGCCAGGCAAATGCAAAAGCAGCAGCAGCAGCAGCAGCAACACCAGCAACCAAACAGAGCTCGT
AACAATACGCATTCCAACCTGCACACCAGCATTGGGAATTCTGTTTGGGGCTCTATAAATACTGGTCCTCCTAACCAGTGGGCATCTGAC
CTAGTCAGTAGTATTTGGAGTAATGCTGACACTAAAAACTCCAACATGGGATTCTGGGATGATGCAGTGAAAGAGGTGGGACCTAGGAAT
TCAACAAATAAAAATAAAAACAACGCCAGTCTCAGTAAATCTGTAGGTGTGTCTAACCGGCAGAATAAGAAAGTAGAAGAAGAAGAAAAG
TTGCTGAAGCTCTTTCAGGGAGTAAATAAAGCCCAAGATGGATTTACGCAGTGGTGTGAACAGATGCTTCATGCCCTTAATACGGCAAAT
AACTTGGATGTTCCCACATTTGTTTCTTTCCTGAAAGAAGTAGAATCTCCTTATGAGGTCCATGATTATATCAGGGCCTATTTAGGAGAT
ACTTCTGAGGCCAAGGAGTTTGCCAAGCAGTTCCTTGAGCGCCGTGCCAAACAGAAAGCCAACCAGCAGCGTCAGCAGCAGCAGCTGCCA
CAGCAGCAGCAGCAGCAGCCGCCACAGCAGCCGCCACAGCAGCCACAACAGCAGGACTCTGTGTGGGGGATGAACCACAGTACACTCCAT
TCAGTATTTCAGACCAATCAAAGCAACAACCAACAATCCAATTTTGAGGCTGTGCAGAGTGGCAAGAAGAAGAAAAAGCAGAAGATGGTC
CGAGCAGATCCCAGTTTATTAGGATTTTCAGTCAATGCATCATCGGAGCGACTCAACATGGGTGAAATCGAGACGTTGGATGACTACTGA
GCACCTGCCAGTGGACTGGCCATCCCTCTCCTGTCTGCCGACTATGGAGTCTCCACCTTTGGACACAACACTTACTCACCATTTACTCTT
TATCACTCTGCAACAAATCACAGAACCGATCATCTCAGGCTTTTTCTTCTGGCCCTTTGTGTCCAAGATTCTTTAATCCATTTTTGTTGG
TGAACATCTCAGACTATAGATAAGTGGACTGGACCCTGTGTCTTGGGGGTGGCAGTTGGGATTACTCCCCAACAAGGCTGATTTTAGGCA
GCATGTGTTCACTGTGCTGTGATTTCATCTACTGTCTCCCAGAAAGTGTGTTGGGATCGGCCATTAGCAGCTTGCTTTCTCTTGTCACTT
TTTTTCTTCTATTTTGTTTTTTCTTCTTCTTTTTCCCCCCATCAGGGCAAATGGTCTAACTGGTGCAATCATGAAGAGAGTTAATGGTTA
ACAGACATTGGCCAATAACAAAACACCCCATGGACTGTGACTCGAGTATCCAACAGGCAGTCAGAGCTCTCCCGGTCTGAAAGTTGCATT
GCCACTGCTAACTTTGGGATTGCATCAGAGAGGCCCTGAGTGGGGTTGAGATGAGGTTGGTTTGGTTTGATGTTACACACTCCTCACCTG
TTCTTTCTGAGTGTCCTTTCTCTGAAAGGATTTATGTTTTTCTTCGTTAGATAGTGACTTCTGAGCAAGCTGATCTCCCCTGGCATGCTC
CAACCTGATTGGACAAAGGAAGCTCTATGGCCTGGGAGAGAGACTATTCTTAATTTTTCTTTCTTACAAAAACTGATTTTTCCCATAAAT
ATTTTTACTTCAGAGGACTAGGACCATTTTGTTTTGGGCCCTTCTGCTGAAAATTTGTCTCGTTTAAGAGGCAGCTAGAATCTTTACCAT
ATGTATGAATTTGTATAATTTCATTTTTGGATAGGGATAAACTTTTGCTTCTGATAAAAGCCTGGAATTTCATCTGGTCCTCAGAGCATT
GCGTGTGTGTCTTGCTGTAGCCCGGAAAAGGTTTTGTGTAAAGATTCTGGGATGGCAAGTTGTTTGCCTTTTCTGAAAAGAGAACATACA
GAACCTGTCCATCTTTAAGACCTTCATCCATGGAATCTACTATACAGGAGGATGCAGTGGGCTGGAGGGGATGGGCGAAAATGGGAGCAG
GAAGCCTGGCCTGGCTTCTGGTCATGGCCTCCTAAAACCTTAAACTTCAAGTAGAAATGTACTCAAGCCCTATTTATAAACAAATACTTT
TCCTGCCTCCACCAAACCCCTACAGAACATCACCTGGAATTGCCACTCACACTGGGTTGGAGTCATTGGGCAGCTGTGCCTGTGCGAGAG
GTGCTGTGGTCTGGGCAGCCCCTGGAAAAGCACCTTTGCTGCCTGTCATTGTTGCCTGAAGAAGGCTGGAGTTGCTCTGAGAGCAGTTTG
GGTTTGGAGTATTATATTTGGCTTCTATTTTTATTATTTTGGATCACCATTCTCCCTATCCCTTCTTGCCTCCCTCCCTTCTAAACATGT
GTAATAACTATACAGAGACTGCTACAAAATTGTATATAGTTTTTGGATCAAATAGCATGAGGGGAGAGGAAACCATTAAAAGTTGGGGCT
CCTACTCTCCTTTGCTTTGTAAATTCAAAAGTTGGGGGTGGGTAAGAGGGATAGTTAAAATGTTTACAAAACTTTAGGCTCCCTCGGAAC

>In-frame_INPP5D_ENST00000359570_chr2_233944108_+_GIGYF2_ENST00000409480_chr2_233681581_+_3638nt
ATGGTCCCCTGCTGGAACCATGGCAACATCACCCGCTCCAAGGCGGAGGAGCTGCTTTCCAGGACAGGCAAGGACGGGAGCTTCCTCGTG
CGTGCCAGCGAGTCCATCTCCCGGGCATACGCGCTCTGCGTGCTGTATCGGAATTGCGTTTACACTTACAGAATTCTGCCCAATGAAGAT
GATAAATTCACTGTTCAGCTAGAGCAAGAGAGAAGAGAGGCAGAAATGAGGGCAAAACGGGAAGAGGAAGAGCGAAAGAGGCAGGAAGAA
CTCCGAAGACAACAGGAGGAAATTCTTCGGCGACAGCAGGAAGAAGAAAGGAAAAGGCGAGAGGAAGAAGAACTTGCCCGAAGGAAACAG
GAAGAGGCTCTGCGTCGCCAGCGGGAGCAAGAAATTGCATTAAGGCGACAGCGAGAAGAGGAAGAAAGACAGCAGCAAGAAGAAGCTCTT
AGAAGACTGGAAGAGAGGAGAAGAGAAGAGGAAGAAAGGCGGAAGCAGGAAGAATTGTTACGCAAACAGGAAGAGGAGGCTGCAAAATGG
GCCCGGGAAGAAGAAGAAGCCCAGCGTCGATTAGAGGAGAACCGGCTGCGGATGGAAGAGGAGGCAGCCAGACTCCGGCATGAGGAAGAA
GAACGGAAGAGAAAGGAGCTGGAGGTCCAGCGGCAGAAGGAGTTAATGCGCCAGAGGCAGCAGCAGCAAGAGGCTCTCCGGAGGTTGCAG
CAGCAGCAGCAGCAACAACAGCTGGCGCAGATGAAGCTTCCTTCTTCTTCAACGTGGGGCCAGCAGTCCAATACAACAGCATGTCAGTCC
CAGGCCACGCTGTCGTTGGCTGAAATCCAAAAACTAGAGGAAGAACGAGAACGGCAGCTTCGAGAAGAGCAAAGGCGCCAGCAGAGGGAG
TTGATGAAAGCTCTTCAGCAGCAGCAGCAACAGCAACAGCAGAAACTCTCAGGTTGGGGGAATGTCAGCAAACCTTCAGGTACCACGAAA
TCTCTTCTGGAGATCCAGCAGGAAGAGGCCAGGCAAATGCAAAAGCAGCAGCAGCAGCAGCAGCAACACCAGCAACCAAACAGAGCTCGT
AACAATACGCATTCCAACCTGCACACCAGCATTGGGAATTCTGTTTGGGGCTCTATAAATACTGGTCCTCCTAACCAGTGGGCATCTGAC
CTAGTCAGTAGTATTTGGAGTAATGCTGACACTAAAAACTCCAACATGGGATTCTGGGATGATGCAGTGAAAGAGGTGGGACCTAGGAAT
TCAACAAATAAAAATAAAAACAACGCCAGTCTCAGTAAATCTGTAGGTGTGTCTAACCGGCAGAATAAGAAAGTAGAAGAAGAAGAAAAG
TTGCTGAAGCTCTTTCAGGGAGTAAATAAAGCCCAAGATGGATTTACGCAGTGGTGTGAACAGATGCTTCATGCCCTTAATACGGCAAAT
AACTTGGATGTTCCCACATTTGTTTCTTTCCTGAAAGAAGTAGAATCTCCTTATGAGGTCCATGATTATATCAGGGCCTATTTAGGAGAT
ACTTCTGAGGCCAAGGAGTTTGCCAAGCAGTTCCTTGAGCGCCGTGCCAAACAGAAAGCCAACCAGCAGCGTCAGCAGCAGCAGCTGCCA
CAGCAGCAGCAGCAGCAGCCGCCACAGCAGCCGCCACAGCAGCCACAACAGCAGGACTCTGTGTGGGGGATGAACCACAGTACACTCCAT
TCAGTATTTCAGACCAATCAAAGCAACAACCAACAATCCAATTTTGAGGCTGTGCAGAGTGGCAAGAAGAAGAAAAAGCAGAAGATGGTC
CGAGCAGATCCCAGTTTATTAGGATTTTCAGTCAATGCATCATCGGAGCGACTCAACATGGGTGAAATCGAGACGTTGGATGACTACTGA
GCACCTGCCAGTGGACTGGCCATCCCTCTCCTGTCTGCCGACTATGGAGTCTCCACCTTTGGACACAACACTTACTCACCATTTACTCTT
TATCACTCTGCAACAAATCACAGAACCGATCATCTCAGGCTTTTTCTTCTGGCCCTTTGTGTCCAAGATTCTTTAATCCATTTTTGTTGG
TGAACATCTCAGACTATAGATAAGTGGACTGGACCCTGTGTCTTGGGGGTGGCAGTTGGGATTACTCCCCAACAAGGCTGATTTTAGGCA
GCATGTGTTCACTGTGCTGTGATTTCATCTACTGTCTCCCAGAAAGTGTGTTGGGATCGGCCATTAGCAGCTTGCTTTCTCTTGTCACTT
TTTTTCTTCTATTTTGTTTTTTCTTCTTCTTTTTCCCCCCATCAGGGCAAATGGTCTAACTGGTGCAATCATGAAGAGAGTTAATGGTTA
ACAGACATTGGCCAATAACAAAACACCCCATGGACTGTGACTCGAGTATCCAACAGGCAGTCAGAGCTCTCCCGGTCTGAAAGTTGCATT
GCCACTGCTAACTTTGGGATTGCATCAGAGAGGCCCTGAGTGGGGTTGAGATGAGGTTGGTTTGGTTTGATGTTACACACTCCTCACCTG
TTCTTTCTGAGTGTCCTTTCTCTGAAAGGATTTATGTTTTTCTTCGTTAGATAGTGACTTCTGAGCAAGCTGATCTCCCCTGGCATGCTC
CAACCTGATTGGACAAAGGAAGCTCTATGGCCTGGGAGAGAGACTATTCTTAATTTTTCTTTCTTACAAAAACTGATTTTTCCCATAAAT
ATTTTTACTTCAGAGGACTAGGACCATTTTGTTTTGGGCCCTTCTGCTGAAAATTTGTCTCGTTTAAGAGGCAGCTAGAATCTTTACCAT
ATGTATGAATTTGTATAATTTCATTTTTGGATAGGGATAAACTTTTGCTTCTGATAAAAGCCTGGAATTTCATCTGGTCCTCAGAGCATT
GCGTGTGTGTCTTGCTGTAGCCCGGAAAAGGTTTTGTGTAAAGATTCTGGGATGGCAAGTTGTTTGCCTTTTCTGAAAAGAGAACATACA
GAACCTGTCCATCTTTAAGACCTTCATCCATGGAATCTACTATACAGGAGGATGCAGTGGGCTGGAGGGGATGGGCGAAAATGGGAGCAG
GAAGCCTGGCCTGGCTTCTGGTCATGGCCTCCTAAAACCTTAAACTTCAAGTAGAAATGTACTCAAGCCCTATTTATAAACAAATACTTT
TCCTGCCTCCACCAAACCCCTACAGAACATCACCTGGAATTGCCACTCACACTGGGTTGGAGTCATTGGGCAGCTGTGCCTGTGCGAGAG
GTGCTGTGGTCTGGGCAGCCCCTGGAAAAGCACCTTTGCTGCCTGTCATTGTTGCCTGAAGAAGGCTGGAGTTGCTCTGAGAGCAGTTTG
GGTTTGGAGTATTATATTTGGCTTCTATTTTTATTATTTTGGATCACCATTCTCCCTATCCCTTCTTGCCTCCCTCCCTTCTAAACATGT
GTAATAACTATACAGAGACTGCTACAAAATTGTATATAGTTTTTGGATCAAATAGCATGAGGGGAGAGGAAACCATTAAAAGTTGGGGCT
CCTACTCTCCTTTGCTTTGTAAATTCAAAAGTTGGGGGTGGGTAAGAGGGATAGTTAAAATGTTTACAAAACTTTAGGCTCCCTCGGAAC

>In-frame_INPP5D_ENST00000359570_chr2_233944108_+_GIGYF2_ENST00000409547_chr2_233681581_+_3657nt
ATGGTCCCCTGCTGGAACCATGGCAACATCACCCGCTCCAAGGCGGAGGAGCTGCTTTCCAGGACAGGCAAGGACGGGAGCTTCCTCGTG
CGTGCCAGCGAGTCCATCTCCCGGGCATACGCGCTCTGCGTGCTGTATCGGAATTGCGTTTACACTTACAGAATTCTGCCCAATGAAGAT
GATAAATTCACTGTTCAGCTAGAGCAAGAGAGAAGAGAGGCAGAAATGAGGGCAAAACGGGAAGAGGAAGAGCGAAAGAGGCAGGAAGAA
CTCCGAAGACAACAGGAGGAAATTCTTCGGCGACAGCAGGAAGAAGAAAGGAAAAGGCGAGAGGAAGAAGAACTTGCCCGAAGGAAACAG
GAAGAGGCTCTGCGTCGCCAGCGGGAGCAAGAAATTGCATTAAGGCGACAGCGAGAAGAGGAAGAAAGACAGCAGCAAGAAGAAGCTCTT
AGAAGACTGGAAGAGAGGAGAAGAGAAGAGGAAGAAAGGCGGAAGCAGGAAGAATTGTTACGCAAACAGGAAGAGGAGGCTGCAAAATGG
GCCCGGGAAGAAGAAGAAGCCCAGCGTCGATTAGAGGAGAACCGGCTGCGGATGGAAGAGGAGGCAGCCAGACTCCGGCATGAGGAAGAA
GAACGGAAGAGAAAGGAGCTGGAGGTCCAGCGGCAGAAGGAGTTAATGCGCCAGAGGCAGCAGCAGCAAGAGGCTCTCCGGAGGTTGCAG
CAGCAGCAGCAGCAACAACAGCTGGCGCAGATGAAGCTTCCTTCTTCTTCAACGTGGGGCCAGCAGTCCAATACAACAGCATGTCAGTCC
CAGGCCACGCTGTCGTTGGCTGAAATCCAAAAACTAGAGGAAGAACGAGAACGGCAGCTTCGAGAAGAGCAAAGGCGCCAGCAGAGGGAG
TTGATGAAAGCTCTTCAGCAGCAGCAGCAACAGCAACAGCAGAAACTCTCAGGTTGGGGGAATGTCAGCAAACCTTCAGGTACCACGAAA
TCTCTTCTGGAGATCCAGCAGGAAGAGGCCAGGCAAATGCAAAAGCAGCAGCAGCAGCAGCAGCAACACCAGCAACCAAACAGAGCTCGT
AACAATACGCATTCCAACCTGCACACCAGCATTGGGAATTCTGTTTGGGGCTCTATAAATACTGGTCCTCCTAACCAGTGGGCATCTGAC
CTAGTCAGTAGTATTTGGAGTAATGCTGACACTAAAAACTCCAACATGGGATTCTGGGATGATGCAGTGAAAGAGGTGGGACCTAGGAAT
TCAACAAATAAAAATAAAAACAACGCCAGTCTCAGTAAATCTGTAGGTGTGTCTAACCGGCAGAATAAGAAAGTAGAAGAAGAAGAAAAG
TTGCTGAAGCTCTTTCAGGGAGTAAATAAAGCCCAAGATGGATTTACGCAGTGGTGTGAACAGATGCTTCATGCCCTTAATACGGCAAAT
AACTTGGATGTTCCCACATTTGTTTCTTTCCTGAAAGAAGTAGAATCTCCTTATGAGGTCCATGATTATATCAGGGCCTATTTAGGAGAT
ACTTCTGAGGCCAAGGAGTTTGCCAAGCAGTTCCTTGAGCGCCGTGCCAAACAGAAAGCCAACCAGCAGCGTCAGCAGCAGCAGCTGCCA
CAGCAGCAGCAGCAGCAGCCGCCACAGCAGCCGCCACAGCAGCCACAACAGCAGGACTCTGTGTGGGGGATGAACCACAGTACACTCCAT
TCAGTATTTCAGACCAATCAAAGCAACAACCAACAATCCAATTTTGAGGCTGTGCAGAGTGGCAAGAAGAAGAAAAAGCAGAAGATGGTC
CGAGCAGATCCCAGTTTATTAGGATTTTCAGTCAATGCATCATCGGAGCGACTCAACATGGGTGAAATCGAGACGTTGGATGACTACTGA
GCACCTGCCAGTGGACTGGCCATCCCTCTCCTGTCTGCCGACTATGGAGTCTCCACCTTTGGACACAACACTTACTCACCATTTACTCTT
TATCACTCTGCAACAAATCACAGAACCGATCATCTCAGGCTTTTTCTTCTGGCCCTTTGTGTCCAAGATTCTTTAATCCATTTTTGTTGG
TGAACATCTCAGACTATAGATAAGTGGACTGGACCCTGTGTCTTGGGGGTGGCAGTTGGGATTACTCCCCAACAAGGCTGATTTTAGGCA
GCATGTGTTCACTGTGCTGTGATTTCATCTACTGTCTCCCAGAAAGTGTGTTGGGATCGGCCATTAGCAGCTTGCTTTCTCTTGTCACTT
TTTTTCTTCTATTTTGTTTTTTCTTCTTCTTTTTCCCCCCATCAGGGCAAATGGTCTAACTGGTGCAATCATGAAGAGAGTTAATGGTTA
ACAGACATTGGCCAATAACAAAACACCCCATGGACTGTGACTCGAGTATCCAACAGGCAGTCAGAGCTCTCCCGGTCTGAAAGTTGCATT
GCCACTGCTAACTTTGGGATTGCATCAGAGAGGCCCTGAGTGGGGTTGAGATGAGGTTGGTTTGGTTTGATGTTACACACTCCTCACCTG
TTCTTTCTGAGTGTCCTTTCTCTGAAAGGATTTATGTTTTTCTTCGTTAGATAGTGACTTCTGAGCAAGCTGATCTCCCCTGGCATGCTC
CAACCTGATTGGACAAAGGAAGCTCTATGGCCTGGGAGAGAGACTATTCTTAATTTTTCTTTCTTACAAAAACTGATTTTTCCCATAAAT
ATTTTTACTTCAGAGGACTAGGACCATTTTGTTTTGGGCCCTTCTGCTGAAAATTTGTCTCGTTTAAGAGGCAGCTAGAATCTTTACCAT
ATGTATGAATTTGTATAATTTCATTTTTGGATAGGGATAAACTTTTGCTTCTGATAAAAGCCTGGAATTTCATCTGGTCCTCAGAGCATT
GCGTGTGTGTCTTGCTGTAGCCCGGAAAAGGTTTTGTGTAAAGATTCTGGGATGGCAAGTTGTTTGCCTTTTCTGAAAAGAGAACATACA
GAACCTGTCCATCTTTAAGACCTTCATCCATGGAATCTACTATACAGGAGGATGCAGTGGGCTGGAGGGGATGGGCGAAAATGGGAGCAG
GAAGCCTGGCCTGGCTTCTGGTCATGGCCTCCTAAAACCTTAAACTTCAAGTAGAAATGTACTCAAGCCCTATTTATAAACAAATACTTT
TCCTGCCTCCACCAAACCCCTACAGAACATCACCTGGAATTGCCACTCACACTGGGTTGGAGTCATTGGGCAGCTGTGCCTGTGCGAGAG
GTGCTGTGGTCTGGGCAGCCCCTGGAAAAGCACCTTTGCTGCCTGTCATTGTTGCCTGAAGAAGGCTGGAGTTGCTCTGAGAGCAGTTTG
GGTTTGGAGTATTATATTTGGCTTCTATTTTTATTATTTTGGATCACCATTCTCCCTATCCCTTCTTGCCTCCCTCCCTTCTAAACATGT
GTAATAACTATACAGAGACTGCTACAAAATTGTATATAGTTTTTGGATCAAATAGCATGAGGGGAGAGGAAACCATTAAAAGTTGGGGCT
CCTACTCTCCTTTGCTTTGTAAATTCAAAAGTTGGGGGTGGGTAAGAGGGATAGTTAAAATGTTTACAAAACTTTAGGCTCCCTCGGAAC

>In-frame_INPP5D_ENST00000359570_chr2_233944108_+_GIGYF2_ENST00000409196_chr2_233681581_+_3657nt
ATGGTCCCCTGCTGGAACCATGGCAACATCACCCGCTCCAAGGCGGAGGAGCTGCTTTCCAGGACAGGCAAGGACGGGAGCTTCCTCGTG
CGTGCCAGCGAGTCCATCTCCCGGGCATACGCGCTCTGCGTGCTGTATCGGAATTGCGTTTACACTTACAGAATTCTGCCCAATGAAGAT
GATAAATTCACTGTTCAGCTAGAGCAAGAGAGAAGAGAGGCAGAAATGAGGGCAAAACGGGAAGAGGAAGAGCGAAAGAGGCAGGAAGAA
CTCCGAAGACAACAGGAGGAAATTCTTCGGCGACAGCAGGAAGAAGAAAGGAAAAGGCGAGAGGAAGAAGAACTTGCCCGAAGGAAACAG
GAAGAGGCTCTGCGTCGCCAGCGGGAGCAAGAAATTGCATTAAGGCGACAGCGAGAAGAGGAAGAAAGACAGCAGCAAGAAGAAGCTCTT
AGAAGACTGGAAGAGAGGAGAAGAGAAGAGGAAGAAAGGCGGAAGCAGGAAGAATTGTTACGCAAACAGGAAGAGGAGGCTGCAAAATGG
GCCCGGGAAGAAGAAGAAGCCCAGCGTCGATTAGAGGAGAACCGGCTGCGGATGGAAGAGGAGGCAGCCAGACTCCGGCATGAGGAAGAA
GAACGGAAGAGAAAGGAGCTGGAGGTCCAGCGGCAGAAGGAGTTAATGCGCCAGAGGCAGCAGCAGCAAGAGGCTCTCCGGAGGTTGCAG
CAGCAGCAGCAGCAACAACAGCTGGCGCAGATGAAGCTTCCTTCTTCTTCAACGTGGGGCCAGCAGTCCAATACAACAGCATGTCAGTCC
CAGGCCACGCTGTCGTTGGCTGAAATCCAAAAACTAGAGGAAGAACGAGAACGGCAGCTTCGAGAAGAGCAAAGGCGCCAGCAGAGGGAG
TTGATGAAAGCTCTTCAGCAGCAGCAGCAACAGCAACAGCAGAAACTCTCAGGTTGGGGGAATGTCAGCAAACCTTCAGGTACCACGAAA
TCTCTTCTGGAGATCCAGCAGGAAGAGGCCAGGCAAATGCAAAAGCAGCAGCAGCAGCAGCAGCAACACCAGCAACCAAACAGAGCTCGT
AACAATACGCATTCCAACCTGCACACCAGCATTGGGAATTCTGTTTGGGGCTCTATAAATACTGGTCCTCCTAACCAGTGGGCATCTGAC
CTAGTCAGTAGTATTTGGAGTAATGCTGACACTAAAAACTCCAACATGGGATTCTGGGATGATGCAGTGAAAGAGGTGGGACCTAGGAAT
TCAACAAATAAAAATAAAAACAACGCCAGTCTCAGTAAATCTGTAGGTGTGTCTAACCGGCAGAATAAGAAAGTAGAAGAAGAAGAAAAG
TTGCTGAAGCTCTTTCAGGGAGTAAATAAAGCCCAAGATGGATTTACGCAGTGGTGTGAACAGATGCTTCATGCCCTTAATACGGCAAAT
AACTTGGATGTTCCCACATTTGTTTCTTTCCTGAAAGAAGTAGAATCTCCTTATGAGGTCCATGATTATATCAGGGCCTATTTAGGAGAT
ACTTCTGAGGCCAAGGAGTTTGCCAAGCAGTTCCTTGAGCGCCGTGCCAAACAGAAAGCCAACCAGCAGCGTCAGCAGCAGCAGCTGCCA
CAGCAGCAGCAGCAGCAGCCGCCACAGCAGCCGCCACAGCAGCCACAACAGCAGGACTCTGTGTGGGGGATGAACCACAGTACACTCCAT
TCAGTATTTCAGACCAATCAAAGCAACAACCAACAATCCAATTTTGAGGCTGTGCAGAGTGGCAAGAAGAAGAAAAAGCAGAAGATGGTC
CGAGCAGATCCCAGTTTATTAGGATTTTCAGTCAATGCATCATCGGAGCGACTCAACATGGGTGAAATCGAGACGTTGGATGACTACTGA
GCACCTGCCAGTGGACTGGCCATCCCTCTCCTGTCTGCCGACTATGGAGTCTCCACCTTTGGACACAACACTTACTCACCATTTACTCTT
TATCACTCTGCAACAAATCACAGAACCGATCATCTCAGGCTTTTTCTTCTGGCCCTTTGTGTCCAAGATTCTTTAATCCATTTTTGTTGG
TGAACATCTCAGACTATAGATAAGTGGACTGGACCCTGTGTCTTGGGGGTGGCAGTTGGGATTACTCCCCAACAAGGCTGATTTTAGGCA
GCATGTGTTCACTGTGCTGTGATTTCATCTACTGTCTCCCAGAAAGTGTGTTGGGATCGGCCATTAGCAGCTTGCTTTCTCTTGTCACTT
TTTTTCTTCTATTTTGTTTTTTCTTCTTCTTTTTCCCCCCATCAGGGCAAATGGTCTAACTGGTGCAATCATGAAGAGAGTTAATGGTTA
ACAGACATTGGCCAATAACAAAACACCCCATGGACTGTGACTCGAGTATCCAACAGGCAGTCAGAGCTCTCCCGGTCTGAAAGTTGCATT
GCCACTGCTAACTTTGGGATTGCATCAGAGAGGCCCTGAGTGGGGTTGAGATGAGGTTGGTTTGGTTTGATGTTACACACTCCTCACCTG
TTCTTTCTGAGTGTCCTTTCTCTGAAAGGATTTATGTTTTTCTTCGTTAGATAGTGACTTCTGAGCAAGCTGATCTCCCCTGGCATGCTC
CAACCTGATTGGACAAAGGAAGCTCTATGGCCTGGGAGAGAGACTATTCTTAATTTTTCTTTCTTACAAAAACTGATTTTTCCCATAAAT
ATTTTTACTTCAGAGGACTAGGACCATTTTGTTTTGGGCCCTTCTGCTGAAAATTTGTCTCGTTTAAGAGGCAGCTAGAATCTTTACCAT
ATGTATGAATTTGTATAATTTCATTTTTGGATAGGGATAAACTTTTGCTTCTGATAAAAGCCTGGAATTTCATCTGGTCCTCAGAGCATT
GCGTGTGTGTCTTGCTGTAGCCCGGAAAAGGTTTTGTGTAAAGATTCTGGGATGGCAAGTTGTTTGCCTTTTCTGAAAAGAGAACATACA
GAACCTGTCCATCTTTAAGACCTTCATCCATGGAATCTACTATACAGGAGGATGCAGTGGGCTGGAGGGGATGGGCGAAAATGGGAGCAG
GAAGCCTGGCCTGGCTTCTGGTCATGGCCTCCTAAAACCTTAAACTTCAAGTAGAAATGTACTCAAGCCCTATTTATAAACAAATACTTT
TCCTGCCTCCACCAAACCCCTACAGAACATCACCTGGAATTGCCACTCACACTGGGTTGGAGTCATTGGGCAGCTGTGCCTGTGCGAGAG
GTGCTGTGGTCTGGGCAGCCCCTGGAAAAGCACCTTTGCTGCCTGTCATTGTTGCCTGAAGAAGGCTGGAGTTGCTCTGAGAGCAGTTTG
GGTTTGGAGTATTATATTTGGCTTCTATTTTTATTATTTTGGATCACCATTCTCCCTATCCCTTCTTGCCTCCCTCCCTTCTAAACATGT
GTAATAACTATACAGAGACTGCTACAAAATTGTATATAGTTTTTGGATCAAATAGCATGAGGGGAGAGGAAACCATTAAAAGTTGGGGCT
CCTACTCTCCTTTGCTTTGTAAATTCAAAAGTTGGGGGTGGGTAAGAGGGATAGTTAAAATGTTTACAAAACTTTAGGCTCCCTCGGAAC

>In-frame_INPP5D_ENST00000359570_chr2_233944108_+_GIGYF2_ENST00000409451_chr2_233681581_+_3638nt
ATGGTCCCCTGCTGGAACCATGGCAACATCACCCGCTCCAAGGCGGAGGAGCTGCTTTCCAGGACAGGCAAGGACGGGAGCTTCCTCGTG
CGTGCCAGCGAGTCCATCTCCCGGGCATACGCGCTCTGCGTGCTGTATCGGAATTGCGTTTACACTTACAGAATTCTGCCCAATGAAGAT
GATAAATTCACTGTTCAGCTAGAGCAAGAGAGAAGAGAGGCAGAAATGAGGGCAAAACGGGAAGAGGAAGAGCGAAAGAGGCAGGAAGAA
CTCCGAAGACAACAGGAGGAAATTCTTCGGCGACAGCAGGAAGAAGAAAGGAAAAGGCGAGAGGAAGAAGAACTTGCCCGAAGGAAACAG
GAAGAGGCTCTGCGTCGCCAGCGGGAGCAAGAAATTGCATTAAGGCGACAGCGAGAAGAGGAAGAAAGACAGCAGCAAGAAGAAGCTCTT
AGAAGACTGGAAGAGAGGAGAAGAGAAGAGGAAGAAAGGCGGAAGCAGGAAGAATTGTTACGCAAACAGGAAGAGGAGGCTGCAAAATGG
GCCCGGGAAGAAGAAGAAGCCCAGCGTCGATTAGAGGAGAACCGGCTGCGGATGGAAGAGGAGGCAGCCAGACTCCGGCATGAGGAAGAA
GAACGGAAGAGAAAGGAGCTGGAGGTCCAGCGGCAGAAGGAGTTAATGCGCCAGAGGCAGCAGCAGCAAGAGGCTCTCCGGAGGTTGCAG
CAGCAGCAGCAGCAACAACAGCTGGCGCAGATGAAGCTTCCTTCTTCTTCAACGTGGGGCCAGCAGTCCAATACAACAGCATGTCAGTCC
CAGGCCACGCTGTCGTTGGCTGAAATCCAAAAACTAGAGGAAGAACGAGAACGGCAGCTTCGAGAAGAGCAAAGGCGCCAGCAGAGGGAG
TTGATGAAAGCTCTTCAGCAGCAGCAGCAACAGCAACAGCAGAAACTCTCAGGTTGGGGGAATGTCAGCAAACCTTCAGGTACCACGAAA
TCTCTTCTGGAGATCCAGCAGGAAGAGGCCAGGCAAATGCAAAAGCAGCAGCAGCAGCAGCAGCAACACCAGCAACCAAACAGAGCTCGT
AACAATACGCATTCCAACCTGCACACCAGCATTGGGAATTCTGTTTGGGGCTCTATAAATACTGGTCCTCCTAACCAGTGGGCATCTGAC
CTAGTCAGTAGTATTTGGAGTAATGCTGACACTAAAAACTCCAACATGGGATTCTGGGATGATGCAGTGAAAGAGGTGGGACCTAGGAAT
TCAACAAATAAAAATAAAAACAACGCCAGTCTCAGTAAATCTGTAGGTGTGTCTAACCGGCAGAATAAGAAAGTAGAAGAAGAAGAAAAG
TTGCTGAAGCTCTTTCAGGGAGTAAATAAAGCCCAAGATGGATTTACGCAGTGGTGTGAACAGATGCTTCATGCCCTTAATACGGCAAAT
AACTTGGATGTTCCCACATTTGTTTCTTTCCTGAAAGAAGTAGAATCTCCTTATGAGGTCCATGATTATATCAGGGCCTATTTAGGAGAT
ACTTCTGAGGCCAAGGAGTTTGCCAAGCAGTTCCTTGAGCGCCGTGCCAAACAGAAAGCCAACCAGCAGCGTCAGCAGCAGCAGCTGCCA
CAGCAGCAGCAGCAGCAGCCGCCACAGCAGCCGCCACAGCAGCCACAACAGCAGGACTCTGTGTGGGGGATGAACCACAGTACACTCCAT
TCAGTATTTCAGACCAATCAAAGCAACAACCAACAATCCAATTTTGAGGCTGTGCAGAGTGGCAAGAAGAAGAAAAAGCAGAAGATGGTC
CGAGCAGATCCCAGTTTATTAGGATTTTCAGTCAATGCATCATCGGAGCGACTCAACATGGGTGAAATCGAGACGTTGGATGACTACTGA
GCACCTGCCAGTGGACTGGCCATCCCTCTCCTGTCTGCCGACTATGGAGTCTCCACCTTTGGACACAACACTTACTCACCATTTACTCTT
TATCACTCTGCAACAAATCACAGAACCGATCATCTCAGGCTTTTTCTTCTGGCCCTTTGTGTCCAAGATTCTTTAATCCATTTTTGTTGG
TGAACATCTCAGACTATAGATAAGTGGACTGGACCCTGTGTCTTGGGGGTGGCAGTTGGGATTACTCCCCAACAAGGCTGATTTTAGGCA
GCATGTGTTCACTGTGCTGTGATTTCATCTACTGTCTCCCAGAAAGTGTGTTGGGATCGGCCATTAGCAGCTTGCTTTCTCTTGTCACTT
TTTTTCTTCTATTTTGTTTTTTCTTCTTCTTTTTCCCCCCATCAGGGCAAATGGTCTAACTGGTGCAATCATGAAGAGAGTTAATGGTTA
ACAGACATTGGCCAATAACAAAACACCCCATGGACTGTGACTCGAGTATCCAACAGGCAGTCAGAGCTCTCCCGGTCTGAAAGTTGCATT
GCCACTGCTAACTTTGGGATTGCATCAGAGAGGCCCTGAGTGGGGTTGAGATGAGGTTGGTTTGGTTTGATGTTACACACTCCTCACCTG
TTCTTTCTGAGTGTCCTTTCTCTGAAAGGATTTATGTTTTTCTTCGTTAGATAGTGACTTCTGAGCAAGCTGATCTCCCCTGGCATGCTC
CAACCTGATTGGACAAAGGAAGCTCTATGGCCTGGGAGAGAGACTATTCTTAATTTTTCTTTCTTACAAAAACTGATTTTTCCCATAAAT
ATTTTTACTTCAGAGGACTAGGACCATTTTGTTTTGGGCCCTTCTGCTGAAAATTTGTCTCGTTTAAGAGGCAGCTAGAATCTTTACCAT
ATGTATGAATTTGTATAATTTCATTTTTGGATAGGGATAAACTTTTGCTTCTGATAAAAGCCTGGAATTTCATCTGGTCCTCAGAGCATT
GCGTGTGTGTCTTGCTGTAGCCCGGAAAAGGTTTTGTGTAAAGATTCTGGGATGGCAAGTTGTTTGCCTTTTCTGAAAAGAGAACATACA
GAACCTGTCCATCTTTAAGACCTTCATCCATGGAATCTACTATACAGGAGGATGCAGTGGGCTGGAGGGGATGGGCGAAAATGGGAGCAG
GAAGCCTGGCCTGGCTTCTGGTCATGGCCTCCTAAAACCTTAAACTTCAAGTAGAAATGTACTCAAGCCCTATTTATAAACAAATACTTT
TCCTGCCTCCACCAAACCCCTACAGAACATCACCTGGAATTGCCACTCACACTGGGTTGGAGTCATTGGGCAGCTGTGCCTGTGCGAGAG
GTGCTGTGGTCTGGGCAGCCCCTGGAAAAGCACCTTTGCTGCCTGTCATTGTTGCCTGAAGAAGGCTGGAGTTGCTCTGAGAGCAGTTTG
GGTTTGGAGTATTATATTTGGCTTCTATTTTTATTATTTTGGATCACCATTCTCCCTATCCCTTCTTGCCTCCCTCCCTTCTAAACATGT
GTAATAACTATACAGAGACTGCTACAAAATTGTATATAGTTTTTGGATCAAATAGCATGAGGGGAGAGGAAACCATTAAAAGTTGGGGCT
CCTACTCTCCTTTGCTTTGTAAATTCAAAAGTTGGGGGTGGGTAAGAGGGATAGTTAAAATGTTTACAAAACTTTAGGCTCCCTCGGAAC


Top

FusionGenePPI for INPP5D_GIGYF2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
INPP5DDOK1, DOK2, SHC1, LYN, CD22, KIT, DAB2, PRKCD, IL4R, PTPN11, SLAMF1, PIK3R1, PECAM1, GRB2, CRKL, TRIP10, EPOR, BCR, CLYBL, MME, ARAP1, SH3KBP1, CD2AP, CBL, SYK, NCK1, UBASH3B, LRRK1, INPPL1, XIAP, DAB1, KRT31, KHDRBS3, KRT40, KRTAP10-7, KRTAP10-9, KRTAP10-3, NOTCH2NL, ZDHHC17GIGYF2GRB10, USP11, PRPF6, PRPF8, DDX20, SMN1, GEMIN4, U2AF2, U2AF1L4, SF3B2, ATN1, ELAVL1, YBX1, PABPC1, TNRC6B, FXR1, AGO2, G3BP1, CAPRIN1, APC, PCK1, SIRT7, DIS3L, HSP90AA1, EIF4E2, ZNF598, RQCD1, TARDBP, YWHAB, LGR4, AIRE, AURKB, CDKN1A, CEP250, CEP57, CEP76, EMD, LGALS3BP, MAGED2, TP53, TUBGCP3, VCP, HUWE1, CCDC8, BMI1, EXOSC7, WDR83, NTRK1, NINL, XPO1, RFX5, MCM2, MEX3C, CDH1, EGFR, MRPL12, C10orf88, NCAPH2, KCTD3, CGN, KIF13B, ZBTB21, KSR1, GIGYF1, RTKN, RALGPS2, MAST3, LRFN1, DENND1A, PPM1H, DENND4C, CDC25C, SH3PXD2A, SRGAP2, NF1, CBY1, LPIN3, SIPA1L1, CAMSAP2, HDAC4, NADK, LIMA1, MAGI1, TESK2, DCLK1, RASAL2, ZNF638, SH3RF3, OSBPL6, KIAA1804, MAPKAP1, TIAM1, KIF1C, PLEKHA7, PHLDB2, TANC2, PTPN13, NAV1, INPP5E, TRIM25


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneINPP5Dchr2:233944108chr2:233681581ENST00000359570+2291016_1030661178DAB2


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for INPP5D_GIGYF2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for INPP5D_GIGYF2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneINPP5DC0023893Liver Cirrhosis, Experimental1CTD_human
HgeneINPP5DC0035126Reperfusion Injury1CTD_human
TgeneGIGYF2C4083045PARKINSON DISEASE 11, AUTOSOMAL DOMINANT, SUSCEPTIBILITY TO1CTD_human;UNIPROT