FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 17499

FusionGeneSummary for INPP4B_NAA15

check button Fusion gene summary
Fusion gene informationFusion gene name: INPP4B_NAA15
Fusion gene ID: 17499
HgeneTgene
Gene symbol

INPP4B

NAA15

Gene ID

8821

80155

Gene nameinositol polyphosphate-4-phosphatase type II BN(alpha)-acetyltransferase 15, NatA auxiliary subunit
Synonyms-Ga19|MRD50|NARG1|NAT1P|NATH|TBDN|TBDN100
Cytomap

4q31.21

4q31.1

Type of geneprotein-codingprotein-coding
Descriptiontype II inositol 3,4-bisphosphate 4-phosphataseinositol polyphosphate 4-phosphatase II; 4-phosphatase IIinositol polyphosphate-4-phosphatase, type II, 105kDaN-alpha-acetyltransferase 15, NatA auxiliary subunitN-terminal acetyltransferaseNMDA receptor regulated 1NMDA receptor-regulated protein 1gastric cancer antigen Ga19protein tubedown-1transcriptional coactivator tubedown-100tubedown-1
Modification date2018052320180523
UniProtAcc

O15327

Q9BXJ9

Ensembl transtripts involved in fusion geneENST00000513000, ENST00000509777, 
ENST00000262992, ENST00000308502, 
ENST00000508116, ENST00000507861, 
ENST00000506217, ENST00000508084, 
ENST00000296543, ENST00000398947, 
ENST00000480277, ENST00000515576, 
Fusion gene scores* DoF score7 X 7 X 3=1477 X 5 X 7=245
# samples 87
** MAII scorelog2(8/147*10)=-0.877744249949002
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(7/245*10)=-1.8073549220576
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: INPP4B [Title/Abstract] AND NAA15 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneNAA15

GO:0006474

N-terminal protein amino acid acetylation

15496142

TgeneNAA15

GO:0045893

positive regulation of transcription, DNA-templated

12145306


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDLUSCTCGA-NC-A5HT-01AINPP4Bchr4

143324091

-NAA15chr4

140255328

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000513000ENST00000296543INPP4Bchr4

143324091

-NAA15chr4

140255328

+
In-frameENST00000513000ENST00000398947INPP4Bchr4

143324091

-NAA15chr4

140255328

+
5CDS-intronENST00000513000ENST00000480277INPP4Bchr4

143324091

-NAA15chr4

140255328

+
5CDS-intronENST00000513000ENST00000515576INPP4Bchr4

143324091

-NAA15chr4

140255328

+
In-frameENST00000509777ENST00000296543INPP4Bchr4

143324091

-NAA15chr4

140255328

+
In-frameENST00000509777ENST00000398947INPP4Bchr4

143324091

-NAA15chr4

140255328

+
5CDS-intronENST00000509777ENST00000480277INPP4Bchr4

143324091

-NAA15chr4

140255328

+
5CDS-intronENST00000509777ENST00000515576INPP4Bchr4

143324091

-NAA15chr4

140255328

+
Frame-shitENST00000262992ENST00000296543INPP4Bchr4

143324091

-NAA15chr4

140255328

+
Frame-shitENST00000262992ENST00000398947INPP4Bchr4

143324091

-NAA15chr4

140255328

+
5CDS-intronENST00000262992ENST00000480277INPP4Bchr4

143324091

-NAA15chr4

140255328

+
5CDS-intronENST00000262992ENST00000515576INPP4Bchr4

143324091

-NAA15chr4

140255328

+
In-frameENST00000308502ENST00000296543INPP4Bchr4

143324091

-NAA15chr4

140255328

+
In-frameENST00000308502ENST00000398947INPP4Bchr4

143324091

-NAA15chr4

140255328

+
5CDS-intronENST00000308502ENST00000480277INPP4Bchr4

143324091

-NAA15chr4

140255328

+
5CDS-intronENST00000308502ENST00000515576INPP4Bchr4

143324091

-NAA15chr4

140255328

+
Frame-shitENST00000508116ENST00000296543INPP4Bchr4

143324091

-NAA15chr4

140255328

+
Frame-shitENST00000508116ENST00000398947INPP4Bchr4

143324091

-NAA15chr4

140255328

+
5CDS-intronENST00000508116ENST00000480277INPP4Bchr4

143324091

-NAA15chr4

140255328

+
5CDS-intronENST00000508116ENST00000515576INPP4Bchr4

143324091

-NAA15chr4

140255328

+
intron-3CDSENST00000507861ENST00000296543INPP4Bchr4

143324091

-NAA15chr4

140255328

+
intron-3CDSENST00000507861ENST00000398947INPP4Bchr4

143324091

-NAA15chr4

140255328

+
intron-intronENST00000507861ENST00000480277INPP4Bchr4

143324091

-NAA15chr4

140255328

+
intron-intronENST00000507861ENST00000515576INPP4Bchr4

143324091

-NAA15chr4

140255328

+
In-frameENST00000506217ENST00000296543INPP4Bchr4

143324091

-NAA15chr4

140255328

+
In-frameENST00000506217ENST00000398947INPP4Bchr4

143324091

-NAA15chr4

140255328

+
5CDS-intronENST00000506217ENST00000480277INPP4Bchr4

143324091

-NAA15chr4

140255328

+
5CDS-intronENST00000506217ENST00000515576INPP4Bchr4

143324091

-NAA15chr4

140255328

+
intron-3CDSENST00000508084ENST00000296543INPP4Bchr4

143324091

-NAA15chr4

140255328

+
intron-3CDSENST00000508084ENST00000398947INPP4Bchr4

143324091

-NAA15chr4

140255328

+
intron-intronENST00000508084ENST00000480277INPP4Bchr4

143324091

-NAA15chr4

140255328

+
intron-intronENST00000508084ENST00000515576INPP4Bchr4

143324091

-NAA15chr4

140255328

+

Top

FusionProtFeatures for INPP4B_NAA15


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
INPP4B

O15327

NAA15

Q9BXJ9

Catalyzes the hydrolysis of the 4-position phosphate ofphosphatidylinositol 3,4-bisphosphate, inositol 1,3,4-trisphosphate and inositol 1,4-bisphosphate. Auxillary subunit of the N-terminal acetyltransferase A(NatA) complex which displays alpha (N-terminal) acetyltransferaseactivity. The NAT activity may be important for vascular,hematopoietic and neuronal growth and development. Required tocontrol retinal neovascularization in adult ocular endothelialcells. In complex with XRCC6 and XRCC5 (Ku80), up-regulatestranscription from the osteocalcin promoter.{ECO:0000269|PubMed:11687548, ECO:0000269|PubMed:12145306,ECO:0000269|PubMed:15496142}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneNAA15chr4:143324091chr4:140255328ENST00000296543+020629_63218867Compositional biasNote=Poly-Asp
TgeneNAA15chr4:143324091chr4:140255328ENST00000296543+020612_62918867MotifBipartite nuclear localization signal
TgeneNAA15chr4:143324091chr4:140255328ENST00000296543+020148_18418867RepeatNote=TPR 3
TgeneNAA15chr4:143324091chr4:140255328ENST00000296543+020224_25718867RepeatNote=TPR 4
TgeneNAA15chr4:143324091chr4:140255328ENST00000296543+020374_40718867RepeatNote=TPR 5
TgeneNAA15chr4:143324091chr4:140255328ENST00000296543+020409_44118867RepeatNote=TPR 6
TgeneNAA15chr4:143324091chr4:140255328ENST00000296543+02046_7918867RepeatNote=TPR 1
TgeneNAA15chr4:143324091chr4:140255328ENST00000296543+020485_51818867RepeatNote=TPR 7
TgeneNAA15chr4:143324091chr4:140255328ENST00000296543+020672_70518867RepeatNote=TPR 8
TgeneNAA15chr4:143324091chr4:140255328ENST00000296543+02080_11318867RepeatNote=TPR 2

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneINPP4Bchr4:143324091chr4:140255328ENST00000262992-52425_149124925DomainNote=C2
HgeneINPP4Bchr4:143324091chr4:140255328ENST00000308502-42325_149124925DomainNote=C2
HgeneINPP4Bchr4:143324091chr4:140255328ENST00000506217-4525_149124132DomainNote=C2
HgeneINPP4Bchr4:143324091chr4:140255328ENST00000508116-62525_149124925DomainNote=C2
HgeneINPP4Bchr4:143324091chr4:140255328ENST00000513000-82725_149124925DomainNote=C2


Top

FusionGeneSequence for INPP4B_NAA15


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_INPP4B_ENST00000513000_chr4_143324091_-_NAA15_ENST00000296543_chr4_140255328_+_973aa
MEIKEEGASEEGQHFLPTAQANDPGDCQFTSIQKTPNEPQLEFILACKDLVAPVRDRKLNTLVQISVIHPVEQSLTRYSSTEIVEGTRDP
LFLTGVTFPSETPITEETKIKLTVTDVKDKSHDTRCTEHKQTRNGLKFCKQILSNPKFAEHGETLAMKGLTLNCLGKKEEATELVRRGLR
NDLKSHVCWHVTGLLQRSDKKTDEAIKCYRNALKWDKDNLQILRDLSLLQIQMRDLEGYRETRTQLLQLRPAQRASWIGTAIAYHLLEDT
EMAAKILEEFRKTQQTSPDKVDTETSELLLTQNQVLREAGLTREALEHLCTTEKQICDKLAVEETKGELLLQLCRLEDAADVTRGLQERN
PENWATYKGLEKALKPANMLERLKITEEAWTKTPRGLVPRRLPLNFLSGEKFKECLDKFLRMNFSKGCPPVFNTLRSLYKDKEKVAIIEE
LVVGTETSLKSCRLFNPNDDGKEEPPTTLLWVQYYLAQHTDKIGQPSIALEYINTAIESTPTLIELFLVKAKITKHAGNIKEAARWMDEA
QALDTADRFINSKCAKYMLKANLIKEAEEMCSKFTREGTSAVENLNEMQCMWFQTECAQATKAMNKFGEALKKCHEIERHFIEITDDQFD
FHTYCMRKITLRSTVDLLKLEDVLRQHPFYFKAARIAIEITLKLHDNPLTDENKEHEADTANMSDKELKKLRNKQRRAQKKAQIEEEKKN
AEKEKQQRNQKKKKDDDDEEIGGPKEELIPEKLAKVETPLEEAIKFLTPLKNLVKNKIETHLFAFEIYFRKEKFLLMLQSVKRAFAIDSS
HPWLHECMIRLFNTAVCESKDLSDTVRTVLKQEMNRLFGATNPKNFNETFLKRNSDSLPHRLSAAKMVTYLDPSSQKRAIELATTLDESL

>In-frame_INPP4B_ENST00000513000_chr4_143324091_-_NAA15_ENST00000398947_chr4_140255328_+_972aa
MEIKEEGASEEGQHFLPTAQANDPGDCQFTSIQKTPNEPQLEFILACKDLVAPVRDRKLNTLVQISVIHPVEQSLTRYSSTEIVEGTRDP
LFLTGVTFPSETPITEETKIKLTVTDVKDKSHDTRCTEHKQTRNGLKFCKQILSNPKFAEHGETLAMKGLTLNCLGKKEEATELVRRGLR
NDLKSHVCWHVTGLLQRSDKKTDEAIKCYRNALKWDKDNLQILRDLSLLQIQMRDLEGYRETRTQLLQLRPAQRASWIGTAIAYHLLEDT
EMAAKILEEFRKTQQTSPDKVDTETSELLLTQNQVLREAGLTREALEHLCTTEKQICDKLAVEETKGELLLQLCRLEDAADVTRGLQERN
PENWATYKGLEKALKPANMLERLKITEEAWTKTPRGLVPRRLPLNFLSGEKFKECLDKFLRMNFSKGCPPVFNTLRSLYKDKEKVAIIEE
LVVGTETSLKSCRLFNPNDDGKEEPPTTLLWVQYYLAQHTDKIGQPSIALEYINTAIESTPTLIELFLVKAKITKHAGNIKEAARWMDEA
QALDTADRFINSKCAKYMLKANLIKEAEEMCSKFTREGTSAVENLNEMQCMWFQTECAQATKAMNKFGEALKKCHEIERHFIEITDDQFD
FHTYCMRKITLRSTVDLLKLEDVLRQHPFYFKAARIAIEITLKLHDNPLTDENKEHEADTANMSDKELKKLRNKQRRAQKKAQIEEEKKN
AEKEKQQRNQKKKKDDDDEEIGGPKEELIPEKLAKVETPLEEAIKFLTPLKNLVKNKIETHLFAFEIYFRKEKFLLMLQSVKRAFAIDSS
HPWLHECMIRLFNTVCESKDLSDTVRTVLKQEMNRLFGATNPKNFNETFLKRNSDSLPHRLSAAKMVTYLDPSSQKRAIELATTLDESLT

>In-frame_INPP4B_ENST00000509777_chr4_143324091_-_NAA15_ENST00000296543_chr4_140255328_+_973aa
MEIKEEGASEEGQHFLPTAQANDPGDCQFTSIQKTPNEPQLEFILACKDLVAPVRDRKLNTLVQISVIHPVEQSLTRYSSTEIVEGTRDP
LFLTGVTFPSETPITEETKIKLTVTDVKDKSHDTRCTEHKQTRNGLKFCKQILSNPKFAEHGETLAMKGLTLNCLGKKEEATELVRRGLR
NDLKSHVCWHVTGLLQRSDKKTDEAIKCYRNALKWDKDNLQILRDLSLLQIQMRDLEGYRETRTQLLQLRPAQRASWIGTAIAYHLLEDT
EMAAKILEEFRKTQQTSPDKVDTETSELLLTQNQVLREAGLTREALEHLCTTEKQICDKLAVEETKGELLLQLCRLEDAADVTRGLQERN
PENWATYKGLEKALKPANMLERLKITEEAWTKTPRGLVPRRLPLNFLSGEKFKECLDKFLRMNFSKGCPPVFNTLRSLYKDKEKVAIIEE
LVVGTETSLKSCRLFNPNDDGKEEPPTTLLWVQYYLAQHTDKIGQPSIALEYINTAIESTPTLIELFLVKAKITKHAGNIKEAARWMDEA
QALDTADRFINSKCAKYMLKANLIKEAEEMCSKFTREGTSAVENLNEMQCMWFQTECAQATKAMNKFGEALKKCHEIERHFIEITDDQFD
FHTYCMRKITLRSTVDLLKLEDVLRQHPFYFKAARIAIEITLKLHDNPLTDENKEHEADTANMSDKELKKLRNKQRRAQKKAQIEEEKKN
AEKEKQQRNQKKKKDDDDEEIGGPKEELIPEKLAKVETPLEEAIKFLTPLKNLVKNKIETHLFAFEIYFRKEKFLLMLQSVKRAFAIDSS
HPWLHECMIRLFNTAVCESKDLSDTVRTVLKQEMNRLFGATNPKNFNETFLKRNSDSLPHRLSAAKMVTYLDPSSQKRAIELATTLDESL

>In-frame_INPP4B_ENST00000509777_chr4_143324091_-_NAA15_ENST00000398947_chr4_140255328_+_972aa
MEIKEEGASEEGQHFLPTAQANDPGDCQFTSIQKTPNEPQLEFILACKDLVAPVRDRKLNTLVQISVIHPVEQSLTRYSSTEIVEGTRDP
LFLTGVTFPSETPITEETKIKLTVTDVKDKSHDTRCTEHKQTRNGLKFCKQILSNPKFAEHGETLAMKGLTLNCLGKKEEATELVRRGLR
NDLKSHVCWHVTGLLQRSDKKTDEAIKCYRNALKWDKDNLQILRDLSLLQIQMRDLEGYRETRTQLLQLRPAQRASWIGTAIAYHLLEDT
EMAAKILEEFRKTQQTSPDKVDTETSELLLTQNQVLREAGLTREALEHLCTTEKQICDKLAVEETKGELLLQLCRLEDAADVTRGLQERN
PENWATYKGLEKALKPANMLERLKITEEAWTKTPRGLVPRRLPLNFLSGEKFKECLDKFLRMNFSKGCPPVFNTLRSLYKDKEKVAIIEE
LVVGTETSLKSCRLFNPNDDGKEEPPTTLLWVQYYLAQHTDKIGQPSIALEYINTAIESTPTLIELFLVKAKITKHAGNIKEAARWMDEA
QALDTADRFINSKCAKYMLKANLIKEAEEMCSKFTREGTSAVENLNEMQCMWFQTECAQATKAMNKFGEALKKCHEIERHFIEITDDQFD
FHTYCMRKITLRSTVDLLKLEDVLRQHPFYFKAARIAIEITLKLHDNPLTDENKEHEADTANMSDKELKKLRNKQRRAQKKAQIEEEKKN
AEKEKQQRNQKKKKDDDDEEIGGPKEELIPEKLAKVETPLEEAIKFLTPLKNLVKNKIETHLFAFEIYFRKEKFLLMLQSVKRAFAIDSS
HPWLHECMIRLFNTVCESKDLSDTVRTVLKQEMNRLFGATNPKNFNETFLKRNSDSLPHRLSAAKMVTYLDPSSQKRAIELATTLDESLT

>In-frame_INPP4B_ENST00000308502_chr4_143324091_-_NAA15_ENST00000296543_chr4_140255328_+_973aa
MEIKEEGASEEGQHFLPTAQANDPGDCQFTSIQKTPNEPQLEFILACKDLVAPVRDRKLNTLVQISVIHPVEQSLTRYSSTEIVEGTRDP
LFLTGVTFPSETPITEETKIKLTVTDVKDKSHDTRCTEHKQTRNGLKFCKQILSNPKFAEHGETLAMKGLTLNCLGKKEEATELVRRGLR
NDLKSHVCWHVTGLLQRSDKKTDEAIKCYRNALKWDKDNLQILRDLSLLQIQMRDLEGYRETRTQLLQLRPAQRASWIGTAIAYHLLEDT
EMAAKILEEFRKTQQTSPDKVDTETSELLLTQNQVLREAGLTREALEHLCTTEKQICDKLAVEETKGELLLQLCRLEDAADVTRGLQERN
PENWATYKGLEKALKPANMLERLKITEEAWTKTPRGLVPRRLPLNFLSGEKFKECLDKFLRMNFSKGCPPVFNTLRSLYKDKEKVAIIEE
LVVGTETSLKSCRLFNPNDDGKEEPPTTLLWVQYYLAQHTDKIGQPSIALEYINTAIESTPTLIELFLVKAKITKHAGNIKEAARWMDEA
QALDTADRFINSKCAKYMLKANLIKEAEEMCSKFTREGTSAVENLNEMQCMWFQTECAQATKAMNKFGEALKKCHEIERHFIEITDDQFD
FHTYCMRKITLRSTVDLLKLEDVLRQHPFYFKAARIAIEITLKLHDNPLTDENKEHEADTANMSDKELKKLRNKQRRAQKKAQIEEEKKN
AEKEKQQRNQKKKKDDDDEEIGGPKEELIPEKLAKVETPLEEAIKFLTPLKNLVKNKIETHLFAFEIYFRKEKFLLMLQSVKRAFAIDSS
HPWLHECMIRLFNTAVCESKDLSDTVRTVLKQEMNRLFGATNPKNFNETFLKRNSDSLPHRLSAAKMVTYLDPSSQKRAIELATTLDESL

>In-frame_INPP4B_ENST00000308502_chr4_143324091_-_NAA15_ENST00000398947_chr4_140255328_+_972aa
MEIKEEGASEEGQHFLPTAQANDPGDCQFTSIQKTPNEPQLEFILACKDLVAPVRDRKLNTLVQISVIHPVEQSLTRYSSTEIVEGTRDP
LFLTGVTFPSETPITEETKIKLTVTDVKDKSHDTRCTEHKQTRNGLKFCKQILSNPKFAEHGETLAMKGLTLNCLGKKEEATELVRRGLR
NDLKSHVCWHVTGLLQRSDKKTDEAIKCYRNALKWDKDNLQILRDLSLLQIQMRDLEGYRETRTQLLQLRPAQRASWIGTAIAYHLLEDT
EMAAKILEEFRKTQQTSPDKVDTETSELLLTQNQVLREAGLTREALEHLCTTEKQICDKLAVEETKGELLLQLCRLEDAADVTRGLQERN
PENWATYKGLEKALKPANMLERLKITEEAWTKTPRGLVPRRLPLNFLSGEKFKECLDKFLRMNFSKGCPPVFNTLRSLYKDKEKVAIIEE
LVVGTETSLKSCRLFNPNDDGKEEPPTTLLWVQYYLAQHTDKIGQPSIALEYINTAIESTPTLIELFLVKAKITKHAGNIKEAARWMDEA
QALDTADRFINSKCAKYMLKANLIKEAEEMCSKFTREGTSAVENLNEMQCMWFQTECAQATKAMNKFGEALKKCHEIERHFIEITDDQFD
FHTYCMRKITLRSTVDLLKLEDVLRQHPFYFKAARIAIEITLKLHDNPLTDENKEHEADTANMSDKELKKLRNKQRRAQKKAQIEEEKKN
AEKEKQQRNQKKKKDDDDEEIGGPKEELIPEKLAKVETPLEEAIKFLTPLKNLVKNKIETHLFAFEIYFRKEKFLLMLQSVKRAFAIDSS
HPWLHECMIRLFNTVCESKDLSDTVRTVLKQEMNRLFGATNPKNFNETFLKRNSDSLPHRLSAAKMVTYLDPSSQKRAIELATTLDESLT

>In-frame_INPP4B_ENST00000506217_chr4_143324091_-_NAA15_ENST00000296543_chr4_140255328_+_973aa
MEIKEEGASEEGQHFLPTAQANDPGDCQFTSIQKTPNEPQLEFILACKDLVAPVRDRKLNTLVQISVIHPVEQSLTRYSSTEIVEGTRDP
LFLTGVTFPSETPITEETKIKLTVTDVKDKSHDTRCTEHKQTRNGLKFCKQILSNPKFAEHGETLAMKGLTLNCLGKKEEATELVRRGLR
NDLKSHVCWHVTGLLQRSDKKTDEAIKCYRNALKWDKDNLQILRDLSLLQIQMRDLEGYRETRTQLLQLRPAQRASWIGTAIAYHLLEDT
EMAAKILEEFRKTQQTSPDKVDTETSELLLTQNQVLREAGLTREALEHLCTTEKQICDKLAVEETKGELLLQLCRLEDAADVTRGLQERN
PENWATYKGLEKALKPANMLERLKITEEAWTKTPRGLVPRRLPLNFLSGEKFKECLDKFLRMNFSKGCPPVFNTLRSLYKDKEKVAIIEE
LVVGTETSLKSCRLFNPNDDGKEEPPTTLLWVQYYLAQHTDKIGQPSIALEYINTAIESTPTLIELFLVKAKITKHAGNIKEAARWMDEA
QALDTADRFINSKCAKYMLKANLIKEAEEMCSKFTREGTSAVENLNEMQCMWFQTECAQATKAMNKFGEALKKCHEIERHFIEITDDQFD
FHTYCMRKITLRSTVDLLKLEDVLRQHPFYFKAARIAIEITLKLHDNPLTDENKEHEADTANMSDKELKKLRNKQRRAQKKAQIEEEKKN
AEKEKQQRNQKKKKDDDDEEIGGPKEELIPEKLAKVETPLEEAIKFLTPLKNLVKNKIETHLFAFEIYFRKEKFLLMLQSVKRAFAIDSS
HPWLHECMIRLFNTAVCESKDLSDTVRTVLKQEMNRLFGATNPKNFNETFLKRNSDSLPHRLSAAKMVTYLDPSSQKRAIELATTLDESL

>In-frame_INPP4B_ENST00000506217_chr4_143324091_-_NAA15_ENST00000398947_chr4_140255328_+_972aa
MEIKEEGASEEGQHFLPTAQANDPGDCQFTSIQKTPNEPQLEFILACKDLVAPVRDRKLNTLVQISVIHPVEQSLTRYSSTEIVEGTRDP
LFLTGVTFPSETPITEETKIKLTVTDVKDKSHDTRCTEHKQTRNGLKFCKQILSNPKFAEHGETLAMKGLTLNCLGKKEEATELVRRGLR
NDLKSHVCWHVTGLLQRSDKKTDEAIKCYRNALKWDKDNLQILRDLSLLQIQMRDLEGYRETRTQLLQLRPAQRASWIGTAIAYHLLEDT
EMAAKILEEFRKTQQTSPDKVDTETSELLLTQNQVLREAGLTREALEHLCTTEKQICDKLAVEETKGELLLQLCRLEDAADVTRGLQERN
PENWATYKGLEKALKPANMLERLKITEEAWTKTPRGLVPRRLPLNFLSGEKFKECLDKFLRMNFSKGCPPVFNTLRSLYKDKEKVAIIEE
LVVGTETSLKSCRLFNPNDDGKEEPPTTLLWVQYYLAQHTDKIGQPSIALEYINTAIESTPTLIELFLVKAKITKHAGNIKEAARWMDEA
QALDTADRFINSKCAKYMLKANLIKEAEEMCSKFTREGTSAVENLNEMQCMWFQTECAQATKAMNKFGEALKKCHEIERHFIEITDDQFD
FHTYCMRKITLRSTVDLLKLEDVLRQHPFYFKAARIAIEITLKLHDNPLTDENKEHEADTANMSDKELKKLRNKQRRAQKKAQIEEEKKN
AEKEKQQRNQKKKKDDDDEEIGGPKEELIPEKLAKVETPLEEAIKFLTPLKNLVKNKIETHLFAFEIYFRKEKFLLMLQSVKRAFAIDSS
HPWLHECMIRLFNTVCESKDLSDTVRTVLKQEMNRLFGATNPKNFNETFLKRNSDSLPHRLSAAKMVTYLDPSSQKRAIELATTLDESLT


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_INPP4B_ENST00000513000_chr4_143324091_-_NAA15_ENST00000296543_chr4_140255328_+_2919nt
ATGGAAATTAAAGAGGAAGGGGCATCAGAAGAAGGGCAGCACTTTCTTCCTACAGCCCAGGCCAATGATCCCGGGGACTGTCAGTTCACA
AGTATCCAGAAGACTCCAAATGAACCGCAGTTGGAATTCATCCTTGCATGCAAGGATCTCGTGGCTCCTGTCCGTGATCGTAAACTGAAT
ACACTGGTGCAGATCTCCGTAATCCACCCCGTGGAGCAGAGTCTGACAAGATACTCCAGCACCGAAATTGTGGAGGGAACAAGGGACCCA
CTGTTTTTGACTGGTGTCACATTCCCATCTGAGTATCCCATCTATGAGGAGACCAAAATAAAACTAACAGTCTATGATGTCAAGGATAAG
TCTCATGACACCAGGTGTTATGAACATAAACAGTATAGAAATGGATTGAAATTCTGTAAACAAATACTTTCTAATCCCAAATTTGCAGAG
CATGGAGAAACCTTGGCTATGAAAGGATTAACATTGAACTGTTTGGGGAAAAAGGAAGAAGCTTATGAATTGGTTCGTAGAGGTTTGAGA
AATGACTTGAAGAGTCATGTGTGTTGGCACGTTTATGGCCTTCTTCAGAGGTCAGACAAGAAGTATGATGAAGCCATTAAGTGTTACAGA
AATGCACTAAAATGGGATAAAGACAATCTTCAAATCTTAAGGGACCTTTCCTTACTACAGATTCAAATGCGAGATCTTGAGGGTTACAGG
GAAACGAGGTATCAGTTACTTCAGCTTCGACCTGCGCAGAGAGCATCATGGATTGGTTATGCTATTGCTTACCATTTATTAGAAGATTAT
GAAATGGCAGCAAAGATTTTAGAAGAATTTAGGAAAACACAACAGACATCCCCTGACAAGGTGGATTATGAATATAGTGAACTACTCTTA
TATCAGAATCAAGTTCTTCGGGAAGCAGGTCTCTATAGAGAAGCTTTGGAACATCTTTGTACCTATGAAAAGCAGATTTGTGATAAACTT
GCTGTAGAAGAAACCAAAGGGGAACTTCTGTTGCAACTATGTCGTTTGGAAGATGCTGCAGATGTTTATAGAGGATTGCAAGAGAGAAAT
CCTGAAAACTGGGCCTATTACAAAGGCTTGGAAAAAGCACTCAAGCCAGCTAATATGTTAGAACGGCTAAAAATTTATGAGGAAGCCTGG
ACTAAATATCCCAGGGGACTGGTGCCAAGAAGGCTGCCGTTAAACTTTTTATCTGGTGAGAAGTTTAAAGAATGTTTGGATAAGTTCCTA
AGGATGAATTTCAGCAAGGGTTGCCCACCAGTCTTCAATACTTTAAGATCATTATACAAAGACAAAGAAAAGGTGGCAATCATAGAAGAG
TTAGTAGTAGGTTATGAAACCTCTCTAAAAAGCTGCCGGTTATTTAACCCCAATGATGATGGAAAGGAGGAACCACCAACCACATTACTT
TGGGTCCAGTACTACTTGGCACAACATTATGACAAAATTGGTCAGCCATCTATTGCTTTGGAGTACATAAATACTGCTATTGAAAGTACA
CCTACATTAATAGAACTCTTTCTCGTGAAAGCTAAAATCTATAAGCATGCTGGAAATATTAAAGAAGCTGCAAGGTGGATGGATGAGGCC
CAGGCCTTGGACACAGCAGACAGATTTATCAACTCCAAATGTGCAAAATACATGCTAAAAGCCAACCTGATTAAAGAAGCTGAAGAAATG
TGCTCAAAGTTTACAAGGGAAGGAACATCAGCGGTAGAGAATTTGAATGAAATGCAGTGCATGTGGTTCCAAACAGAATGTGCCCAGGCT
TATAAAGCAATGAATAAATTTGGTGAAGCACTTAAGAAATGTCATGAGATTGAGAGACATTTTATAGAAATCACTGATGACCAGTTTGAC
TTTCATACATACTGTATGAGGAAGATTACCCTTAGATCATATGTGGACTTATTAAAACTAGAAGATGTACTTCGACAGCATCCATTTTAC
TTCAAGGCAGCAAGAATTGCTATAGAGATCTATTTGAAGCTTCATGACAACCCCCTTACAGATGAGAATAAAGAACACGAAGCTGATACA
GCAAACATGTCTGACAAAGAGCTAAAGAAGCTACGTAATAAACAAAGAAGAGCTCAAAAGAAAGCCCAGATAGAAGAAGAGAAAAAAAAT
GCAGAAAAAGAAAAGCAGCAGAGAAATCAGAAAAAGAAGAAGGATGATGATGATGAGGAGATAGGAGGTCCAAAAGAAGAACTTATTCCA
GAGAAACTGGCCAAGGTTGAAACTCCATTGGAAGAAGCTATTAAATTTTTAACACCGTTGAAGAACTTGGTGAAGAACAAGATAGAGACT
CATCTTTTTGCCTTTGAGATTTACTTTAGGAAAGAAAAGTTTCTTTTGATGCTACAATCAGTAAAGAGGGCATTTGCTATTGATTCTAGT
CATCCCTGGCTTCATGAGTGTATGATTCGTCTCTTTAATACTGCAGTGTGTGAAAGTAAAGATTTATCTGATACAGTTAGAACAGTATTA
AAACAAGAAATGAATCGTCTTTTTGGAGCAACGAATCCAAAGAATTTTAATGAAACTTTTCTGAAAAGGAATTCTGATTCATTGCCACAC
AGATTATCAGCTGCCAAAATGGTATATTACTTAGATCCTTCTAGTCAGAAGCGAGCTATAGAGTTGGCAACAACACTTGATGAATCTCTC
ACTAACAGAAACCTCCAGACATGTATGGAGGTATTGGAAGCCTTGTATGATGGTAGCCTAGGAGACTGTAAAGAAGCTGCTGAAATTTAT
AGAGCAAATTGTCATAAGCTTTTCCCTTATGCTTTGGCTTTCATGCCTCCTGGATATGAAGAGGATATGAAGATCACAGTTAATGGAGAT

>In-frame_INPP4B_ENST00000513000_chr4_143324091_-_NAA15_ENST00000398947_chr4_140255328_+_2916nt
ATGGAAATTAAAGAGGAAGGGGCATCAGAAGAAGGGCAGCACTTTCTTCCTACAGCCCAGGCCAATGATCCCGGGGACTGTCAGTTCACA
AGTATCCAGAAGACTCCAAATGAACCGCAGTTGGAATTCATCCTTGCATGCAAGGATCTCGTGGCTCCTGTCCGTGATCGTAAACTGAAT
ACACTGGTGCAGATCTCCGTAATCCACCCCGTGGAGCAGAGTCTGACAAGATACTCCAGCACCGAAATTGTGGAGGGAACAAGGGACCCA
CTGTTTTTGACTGGTGTCACATTCCCATCTGAGTATCCCATCTATGAGGAGACCAAAATAAAACTAACAGTCTATGATGTCAAGGATAAG
TCTCATGACACCAGGTGTTATGAACATAAACAGTATAGAAATGGATTGAAATTCTGTAAACAAATACTTTCTAATCCCAAATTTGCAGAG
CATGGAGAAACCTTGGCTATGAAAGGATTAACATTGAACTGTTTGGGGAAAAAGGAAGAAGCTTATGAATTGGTTCGTAGAGGTTTGAGA
AATGACTTGAAGAGTCATGTGTGTTGGCACGTTTATGGCCTTCTTCAGAGGTCAGACAAGAAGTATGATGAAGCCATTAAGTGTTACAGA
AATGCACTAAAATGGGATAAAGACAATCTTCAAATCTTAAGGGACCTTTCCTTACTACAGATTCAAATGCGAGATCTTGAGGGTTACAGG
GAAACGAGGTATCAGTTACTTCAGCTTCGACCTGCGCAGAGAGCATCATGGATTGGTTATGCTATTGCTTACCATTTATTAGAAGATTAT
GAAATGGCAGCAAAGATTTTAGAAGAATTTAGGAAAACACAACAGACATCCCCTGACAAGGTGGATTATGAATATAGTGAACTACTCTTA
TATCAGAATCAAGTTCTTCGGGAAGCAGGTCTCTATAGAGAAGCTTTGGAACATCTTTGTACCTATGAAAAGCAGATTTGTGATAAACTT
GCTGTAGAAGAAACCAAAGGGGAACTTCTGTTGCAACTATGTCGTTTGGAAGATGCTGCAGATGTTTATAGAGGATTGCAAGAGAGAAAT
CCTGAAAACTGGGCCTATTACAAAGGCTTGGAAAAAGCACTCAAGCCAGCTAATATGTTAGAACGGCTAAAAATTTATGAGGAAGCCTGG
ACTAAATATCCCAGGGGACTGGTGCCAAGAAGGCTGCCGTTAAACTTTTTATCTGGTGAGAAGTTTAAAGAATGTTTGGATAAGTTCCTA
AGGATGAATTTCAGCAAGGGTTGCCCACCAGTCTTCAATACTTTAAGATCATTATACAAAGACAAAGAAAAGGTGGCAATCATAGAAGAG
TTAGTAGTAGGTTATGAAACCTCTCTAAAAAGCTGCCGGTTATTTAACCCCAATGATGATGGAAAGGAGGAACCACCAACCACATTACTT
TGGGTCCAGTACTACTTGGCACAACATTATGACAAAATTGGTCAGCCATCTATTGCTTTGGAGTACATAAATACTGCTATTGAAAGTACA
CCTACATTAATAGAACTCTTTCTCGTGAAAGCTAAAATCTATAAGCATGCTGGAAATATTAAAGAAGCTGCAAGGTGGATGGATGAGGCC
CAGGCCTTGGACACAGCAGACAGATTTATCAACTCCAAATGTGCAAAATACATGCTAAAAGCCAACCTGATTAAAGAAGCTGAAGAAATG
TGCTCAAAGTTTACAAGGGAAGGAACATCAGCGGTAGAGAATTTGAATGAAATGCAGTGCATGTGGTTCCAAACAGAATGTGCCCAGGCT
TATAAAGCAATGAATAAATTTGGTGAAGCACTTAAGAAATGTCATGAGATTGAGAGACATTTTATAGAAATCACTGATGACCAGTTTGAC
TTTCATACATACTGTATGAGGAAGATTACCCTTAGATCATATGTGGACTTATTAAAACTAGAAGATGTACTTCGACAGCATCCATTTTAC
TTCAAGGCAGCAAGAATTGCTATAGAGATCTATTTGAAGCTTCATGACAACCCCCTTACAGATGAGAATAAAGAACACGAAGCTGATACA
GCAAACATGTCTGACAAAGAGCTAAAGAAGCTACGTAATAAACAAAGAAGAGCTCAAAAGAAAGCCCAGATAGAAGAAGAGAAAAAAAAT
GCAGAAAAAGAAAAGCAGCAGAGAAATCAGAAAAAGAAGAAGGATGATGATGATGAGGAGATAGGAGGTCCAAAAGAAGAACTTATTCCA
GAGAAACTGGCCAAGGTTGAAACTCCATTGGAAGAAGCTATTAAATTTTTAACACCGTTGAAGAACTTGGTGAAGAACAAGATAGAGACT
CATCTTTTTGCCTTTGAGATTTACTTTAGGAAAGAAAAGTTTCTTTTGATGCTACAATCAGTAAAGAGGGCATTTGCTATTGATTCTAGT
CATCCCTGGCTTCATGAGTGTATGATTCGTCTCTTTAATACTGTGTGTGAAAGTAAAGATTTATCTGATACAGTTAGAACAGTATTAAAA
CAAGAAATGAATCGTCTTTTTGGAGCAACGAATCCAAAGAATTTTAATGAAACTTTTCTGAAAAGGAATTCTGATTCATTGCCACACAGA
TTATCAGCTGCCAAAATGGTATATTACTTAGATCCTTCTAGTCAGAAGCGAGCTATAGAGTTGGCAACAACACTTGATGAATCTCTCACT
AACAGAAACCTCCAGACATGTATGGAGGTATTGGAAGCCTTGTATGATGGTAGCCTAGGAGACTGTAAAGAAGCTGCTGAAATTTATAGA
GCAAATTGTCATAAGCTTTTCCCTTATGCTTTGGCTTTCATGCCTCCTGGATATGAAGAGGATATGAAGATCACAGTTAATGGAGATAGT

>In-frame_INPP4B_ENST00000509777_chr4_143324091_-_NAA15_ENST00000296543_chr4_140255328_+_2919nt
ATGGAAATTAAAGAGGAAGGGGCATCAGAAGAAGGGCAGCACTTTCTTCCTACAGCCCAGGCCAATGATCCCGGGGACTGTCAGTTCACA
AGTATCCAGAAGACTCCAAATGAACCGCAGTTGGAATTCATCCTTGCATGCAAGGATCTCGTGGCTCCTGTCCGTGATCGTAAACTGAAT
ACACTGGTGCAGATCTCCGTAATCCACCCCGTGGAGCAGAGTCTGACAAGATACTCCAGCACCGAAATTGTGGAGGGAACAAGGGACCCA
CTGTTTTTGACTGGTGTCACATTCCCATCTGAGTATCCCATCTATGAGGAGACCAAAATAAAACTAACAGTCTATGATGTCAAGGATAAG
TCTCATGACACCAGGTGTTATGAACATAAACAGTATAGAAATGGATTGAAATTCTGTAAACAAATACTTTCTAATCCCAAATTTGCAGAG
CATGGAGAAACCTTGGCTATGAAAGGATTAACATTGAACTGTTTGGGGAAAAAGGAAGAAGCTTATGAATTGGTTCGTAGAGGTTTGAGA
AATGACTTGAAGAGTCATGTGTGTTGGCACGTTTATGGCCTTCTTCAGAGGTCAGACAAGAAGTATGATGAAGCCATTAAGTGTTACAGA
AATGCACTAAAATGGGATAAAGACAATCTTCAAATCTTAAGGGACCTTTCCTTACTACAGATTCAAATGCGAGATCTTGAGGGTTACAGG
GAAACGAGGTATCAGTTACTTCAGCTTCGACCTGCGCAGAGAGCATCATGGATTGGTTATGCTATTGCTTACCATTTATTAGAAGATTAT
GAAATGGCAGCAAAGATTTTAGAAGAATTTAGGAAAACACAACAGACATCCCCTGACAAGGTGGATTATGAATATAGTGAACTACTCTTA
TATCAGAATCAAGTTCTTCGGGAAGCAGGTCTCTATAGAGAAGCTTTGGAACATCTTTGTACCTATGAAAAGCAGATTTGTGATAAACTT
GCTGTAGAAGAAACCAAAGGGGAACTTCTGTTGCAACTATGTCGTTTGGAAGATGCTGCAGATGTTTATAGAGGATTGCAAGAGAGAAAT
CCTGAAAACTGGGCCTATTACAAAGGCTTGGAAAAAGCACTCAAGCCAGCTAATATGTTAGAACGGCTAAAAATTTATGAGGAAGCCTGG
ACTAAATATCCCAGGGGACTGGTGCCAAGAAGGCTGCCGTTAAACTTTTTATCTGGTGAGAAGTTTAAAGAATGTTTGGATAAGTTCCTA
AGGATGAATTTCAGCAAGGGTTGCCCACCAGTCTTCAATACTTTAAGATCATTATACAAAGACAAAGAAAAGGTGGCAATCATAGAAGAG
TTAGTAGTAGGTTATGAAACCTCTCTAAAAAGCTGCCGGTTATTTAACCCCAATGATGATGGAAAGGAGGAACCACCAACCACATTACTT
TGGGTCCAGTACTACTTGGCACAACATTATGACAAAATTGGTCAGCCATCTATTGCTTTGGAGTACATAAATACTGCTATTGAAAGTACA
CCTACATTAATAGAACTCTTTCTCGTGAAAGCTAAAATCTATAAGCATGCTGGAAATATTAAAGAAGCTGCAAGGTGGATGGATGAGGCC
CAGGCCTTGGACACAGCAGACAGATTTATCAACTCCAAATGTGCAAAATACATGCTAAAAGCCAACCTGATTAAAGAAGCTGAAGAAATG
TGCTCAAAGTTTACAAGGGAAGGAACATCAGCGGTAGAGAATTTGAATGAAATGCAGTGCATGTGGTTCCAAACAGAATGTGCCCAGGCT
TATAAAGCAATGAATAAATTTGGTGAAGCACTTAAGAAATGTCATGAGATTGAGAGACATTTTATAGAAATCACTGATGACCAGTTTGAC
TTTCATACATACTGTATGAGGAAGATTACCCTTAGATCATATGTGGACTTATTAAAACTAGAAGATGTACTTCGACAGCATCCATTTTAC
TTCAAGGCAGCAAGAATTGCTATAGAGATCTATTTGAAGCTTCATGACAACCCCCTTACAGATGAGAATAAAGAACACGAAGCTGATACA
GCAAACATGTCTGACAAAGAGCTAAAGAAGCTACGTAATAAACAAAGAAGAGCTCAAAAGAAAGCCCAGATAGAAGAAGAGAAAAAAAAT
GCAGAAAAAGAAAAGCAGCAGAGAAATCAGAAAAAGAAGAAGGATGATGATGATGAGGAGATAGGAGGTCCAAAAGAAGAACTTATTCCA
GAGAAACTGGCCAAGGTTGAAACTCCATTGGAAGAAGCTATTAAATTTTTAACACCGTTGAAGAACTTGGTGAAGAACAAGATAGAGACT
CATCTTTTTGCCTTTGAGATTTACTTTAGGAAAGAAAAGTTTCTTTTGATGCTACAATCAGTAAAGAGGGCATTTGCTATTGATTCTAGT
CATCCCTGGCTTCATGAGTGTATGATTCGTCTCTTTAATACTGCAGTGTGTGAAAGTAAAGATTTATCTGATACAGTTAGAACAGTATTA
AAACAAGAAATGAATCGTCTTTTTGGAGCAACGAATCCAAAGAATTTTAATGAAACTTTTCTGAAAAGGAATTCTGATTCATTGCCACAC
AGATTATCAGCTGCCAAAATGGTATATTACTTAGATCCTTCTAGTCAGAAGCGAGCTATAGAGTTGGCAACAACACTTGATGAATCTCTC
ACTAACAGAAACCTCCAGACATGTATGGAGGTATTGGAAGCCTTGTATGATGGTAGCCTAGGAGACTGTAAAGAAGCTGCTGAAATTTAT
AGAGCAAATTGTCATAAGCTTTTCCCTTATGCTTTGGCTTTCATGCCTCCTGGATATGAAGAGGATATGAAGATCACAGTTAATGGAGAT

>In-frame_INPP4B_ENST00000509777_chr4_143324091_-_NAA15_ENST00000398947_chr4_140255328_+_2916nt
ATGGAAATTAAAGAGGAAGGGGCATCAGAAGAAGGGCAGCACTTTCTTCCTACAGCCCAGGCCAATGATCCCGGGGACTGTCAGTTCACA
AGTATCCAGAAGACTCCAAATGAACCGCAGTTGGAATTCATCCTTGCATGCAAGGATCTCGTGGCTCCTGTCCGTGATCGTAAACTGAAT
ACACTGGTGCAGATCTCCGTAATCCACCCCGTGGAGCAGAGTCTGACAAGATACTCCAGCACCGAAATTGTGGAGGGAACAAGGGACCCA
CTGTTTTTGACTGGTGTCACATTCCCATCTGAGTATCCCATCTATGAGGAGACCAAAATAAAACTAACAGTCTATGATGTCAAGGATAAG
TCTCATGACACCAGGTGTTATGAACATAAACAGTATAGAAATGGATTGAAATTCTGTAAACAAATACTTTCTAATCCCAAATTTGCAGAG
CATGGAGAAACCTTGGCTATGAAAGGATTAACATTGAACTGTTTGGGGAAAAAGGAAGAAGCTTATGAATTGGTTCGTAGAGGTTTGAGA
AATGACTTGAAGAGTCATGTGTGTTGGCACGTTTATGGCCTTCTTCAGAGGTCAGACAAGAAGTATGATGAAGCCATTAAGTGTTACAGA
AATGCACTAAAATGGGATAAAGACAATCTTCAAATCTTAAGGGACCTTTCCTTACTACAGATTCAAATGCGAGATCTTGAGGGTTACAGG
GAAACGAGGTATCAGTTACTTCAGCTTCGACCTGCGCAGAGAGCATCATGGATTGGTTATGCTATTGCTTACCATTTATTAGAAGATTAT
GAAATGGCAGCAAAGATTTTAGAAGAATTTAGGAAAACACAACAGACATCCCCTGACAAGGTGGATTATGAATATAGTGAACTACTCTTA
TATCAGAATCAAGTTCTTCGGGAAGCAGGTCTCTATAGAGAAGCTTTGGAACATCTTTGTACCTATGAAAAGCAGATTTGTGATAAACTT
GCTGTAGAAGAAACCAAAGGGGAACTTCTGTTGCAACTATGTCGTTTGGAAGATGCTGCAGATGTTTATAGAGGATTGCAAGAGAGAAAT
CCTGAAAACTGGGCCTATTACAAAGGCTTGGAAAAAGCACTCAAGCCAGCTAATATGTTAGAACGGCTAAAAATTTATGAGGAAGCCTGG
ACTAAATATCCCAGGGGACTGGTGCCAAGAAGGCTGCCGTTAAACTTTTTATCTGGTGAGAAGTTTAAAGAATGTTTGGATAAGTTCCTA
AGGATGAATTTCAGCAAGGGTTGCCCACCAGTCTTCAATACTTTAAGATCATTATACAAAGACAAAGAAAAGGTGGCAATCATAGAAGAG
TTAGTAGTAGGTTATGAAACCTCTCTAAAAAGCTGCCGGTTATTTAACCCCAATGATGATGGAAAGGAGGAACCACCAACCACATTACTT
TGGGTCCAGTACTACTTGGCACAACATTATGACAAAATTGGTCAGCCATCTATTGCTTTGGAGTACATAAATACTGCTATTGAAAGTACA
CCTACATTAATAGAACTCTTTCTCGTGAAAGCTAAAATCTATAAGCATGCTGGAAATATTAAAGAAGCTGCAAGGTGGATGGATGAGGCC
CAGGCCTTGGACACAGCAGACAGATTTATCAACTCCAAATGTGCAAAATACATGCTAAAAGCCAACCTGATTAAAGAAGCTGAAGAAATG
TGCTCAAAGTTTACAAGGGAAGGAACATCAGCGGTAGAGAATTTGAATGAAATGCAGTGCATGTGGTTCCAAACAGAATGTGCCCAGGCT
TATAAAGCAATGAATAAATTTGGTGAAGCACTTAAGAAATGTCATGAGATTGAGAGACATTTTATAGAAATCACTGATGACCAGTTTGAC
TTTCATACATACTGTATGAGGAAGATTACCCTTAGATCATATGTGGACTTATTAAAACTAGAAGATGTACTTCGACAGCATCCATTTTAC
TTCAAGGCAGCAAGAATTGCTATAGAGATCTATTTGAAGCTTCATGACAACCCCCTTACAGATGAGAATAAAGAACACGAAGCTGATACA
GCAAACATGTCTGACAAAGAGCTAAAGAAGCTACGTAATAAACAAAGAAGAGCTCAAAAGAAAGCCCAGATAGAAGAAGAGAAAAAAAAT
GCAGAAAAAGAAAAGCAGCAGAGAAATCAGAAAAAGAAGAAGGATGATGATGATGAGGAGATAGGAGGTCCAAAAGAAGAACTTATTCCA
GAGAAACTGGCCAAGGTTGAAACTCCATTGGAAGAAGCTATTAAATTTTTAACACCGTTGAAGAACTTGGTGAAGAACAAGATAGAGACT
CATCTTTTTGCCTTTGAGATTTACTTTAGGAAAGAAAAGTTTCTTTTGATGCTACAATCAGTAAAGAGGGCATTTGCTATTGATTCTAGT
CATCCCTGGCTTCATGAGTGTATGATTCGTCTCTTTAATACTGTGTGTGAAAGTAAAGATTTATCTGATACAGTTAGAACAGTATTAAAA
CAAGAAATGAATCGTCTTTTTGGAGCAACGAATCCAAAGAATTTTAATGAAACTTTTCTGAAAAGGAATTCTGATTCATTGCCACACAGA
TTATCAGCTGCCAAAATGGTATATTACTTAGATCCTTCTAGTCAGAAGCGAGCTATAGAGTTGGCAACAACACTTGATGAATCTCTCACT
AACAGAAACCTCCAGACATGTATGGAGGTATTGGAAGCCTTGTATGATGGTAGCCTAGGAGACTGTAAAGAAGCTGCTGAAATTTATAGA
GCAAATTGTCATAAGCTTTTCCCTTATGCTTTGGCTTTCATGCCTCCTGGATATGAAGAGGATATGAAGATCACAGTTAATGGAGATAGT

>In-frame_INPP4B_ENST00000308502_chr4_143324091_-_NAA15_ENST00000296543_chr4_140255328_+_2919nt
ATGGAAATTAAAGAGGAAGGGGCATCAGAAGAAGGGCAGCACTTTCTTCCTACAGCCCAGGCCAATGATCCCGGGGACTGTCAGTTCACA
AGTATCCAGAAGACTCCAAATGAACCGCAGTTGGAATTCATCCTTGCATGCAAGGATCTCGTGGCTCCTGTCCGTGATCGTAAACTGAAT
ACACTGGTGCAGATCTCCGTAATCCACCCCGTGGAGCAGAGTCTGACAAGATACTCCAGCACCGAAATTGTGGAGGGAACAAGGGACCCA
CTGTTTTTGACTGGTGTCACATTCCCATCTGAGTATCCCATCTATGAGGAGACCAAAATAAAACTAACAGTCTATGATGTCAAGGATAAG
TCTCATGACACCAGGTGTTATGAACATAAACAGTATAGAAATGGATTGAAATTCTGTAAACAAATACTTTCTAATCCCAAATTTGCAGAG
CATGGAGAAACCTTGGCTATGAAAGGATTAACATTGAACTGTTTGGGGAAAAAGGAAGAAGCTTATGAATTGGTTCGTAGAGGTTTGAGA
AATGACTTGAAGAGTCATGTGTGTTGGCACGTTTATGGCCTTCTTCAGAGGTCAGACAAGAAGTATGATGAAGCCATTAAGTGTTACAGA
AATGCACTAAAATGGGATAAAGACAATCTTCAAATCTTAAGGGACCTTTCCTTACTACAGATTCAAATGCGAGATCTTGAGGGTTACAGG
GAAACGAGGTATCAGTTACTTCAGCTTCGACCTGCGCAGAGAGCATCATGGATTGGTTATGCTATTGCTTACCATTTATTAGAAGATTAT
GAAATGGCAGCAAAGATTTTAGAAGAATTTAGGAAAACACAACAGACATCCCCTGACAAGGTGGATTATGAATATAGTGAACTACTCTTA
TATCAGAATCAAGTTCTTCGGGAAGCAGGTCTCTATAGAGAAGCTTTGGAACATCTTTGTACCTATGAAAAGCAGATTTGTGATAAACTT
GCTGTAGAAGAAACCAAAGGGGAACTTCTGTTGCAACTATGTCGTTTGGAAGATGCTGCAGATGTTTATAGAGGATTGCAAGAGAGAAAT
CCTGAAAACTGGGCCTATTACAAAGGCTTGGAAAAAGCACTCAAGCCAGCTAATATGTTAGAACGGCTAAAAATTTATGAGGAAGCCTGG
ACTAAATATCCCAGGGGACTGGTGCCAAGAAGGCTGCCGTTAAACTTTTTATCTGGTGAGAAGTTTAAAGAATGTTTGGATAAGTTCCTA
AGGATGAATTTCAGCAAGGGTTGCCCACCAGTCTTCAATACTTTAAGATCATTATACAAAGACAAAGAAAAGGTGGCAATCATAGAAGAG
TTAGTAGTAGGTTATGAAACCTCTCTAAAAAGCTGCCGGTTATTTAACCCCAATGATGATGGAAAGGAGGAACCACCAACCACATTACTT
TGGGTCCAGTACTACTTGGCACAACATTATGACAAAATTGGTCAGCCATCTATTGCTTTGGAGTACATAAATACTGCTATTGAAAGTACA
CCTACATTAATAGAACTCTTTCTCGTGAAAGCTAAAATCTATAAGCATGCTGGAAATATTAAAGAAGCTGCAAGGTGGATGGATGAGGCC
CAGGCCTTGGACACAGCAGACAGATTTATCAACTCCAAATGTGCAAAATACATGCTAAAAGCCAACCTGATTAAAGAAGCTGAAGAAATG
TGCTCAAAGTTTACAAGGGAAGGAACATCAGCGGTAGAGAATTTGAATGAAATGCAGTGCATGTGGTTCCAAACAGAATGTGCCCAGGCT
TATAAAGCAATGAATAAATTTGGTGAAGCACTTAAGAAATGTCATGAGATTGAGAGACATTTTATAGAAATCACTGATGACCAGTTTGAC
TTTCATACATACTGTATGAGGAAGATTACCCTTAGATCATATGTGGACTTATTAAAACTAGAAGATGTACTTCGACAGCATCCATTTTAC
TTCAAGGCAGCAAGAATTGCTATAGAGATCTATTTGAAGCTTCATGACAACCCCCTTACAGATGAGAATAAAGAACACGAAGCTGATACA
GCAAACATGTCTGACAAAGAGCTAAAGAAGCTACGTAATAAACAAAGAAGAGCTCAAAAGAAAGCCCAGATAGAAGAAGAGAAAAAAAAT
GCAGAAAAAGAAAAGCAGCAGAGAAATCAGAAAAAGAAGAAGGATGATGATGATGAGGAGATAGGAGGTCCAAAAGAAGAACTTATTCCA
GAGAAACTGGCCAAGGTTGAAACTCCATTGGAAGAAGCTATTAAATTTTTAACACCGTTGAAGAACTTGGTGAAGAACAAGATAGAGACT
CATCTTTTTGCCTTTGAGATTTACTTTAGGAAAGAAAAGTTTCTTTTGATGCTACAATCAGTAAAGAGGGCATTTGCTATTGATTCTAGT
CATCCCTGGCTTCATGAGTGTATGATTCGTCTCTTTAATACTGCAGTGTGTGAAAGTAAAGATTTATCTGATACAGTTAGAACAGTATTA
AAACAAGAAATGAATCGTCTTTTTGGAGCAACGAATCCAAAGAATTTTAATGAAACTTTTCTGAAAAGGAATTCTGATTCATTGCCACAC
AGATTATCAGCTGCCAAAATGGTATATTACTTAGATCCTTCTAGTCAGAAGCGAGCTATAGAGTTGGCAACAACACTTGATGAATCTCTC
ACTAACAGAAACCTCCAGACATGTATGGAGGTATTGGAAGCCTTGTATGATGGTAGCCTAGGAGACTGTAAAGAAGCTGCTGAAATTTAT
AGAGCAAATTGTCATAAGCTTTTCCCTTATGCTTTGGCTTTCATGCCTCCTGGATATGAAGAGGATATGAAGATCACAGTTAATGGAGAT

>In-frame_INPP4B_ENST00000308502_chr4_143324091_-_NAA15_ENST00000398947_chr4_140255328_+_2916nt
ATGGAAATTAAAGAGGAAGGGGCATCAGAAGAAGGGCAGCACTTTCTTCCTACAGCCCAGGCCAATGATCCCGGGGACTGTCAGTTCACA
AGTATCCAGAAGACTCCAAATGAACCGCAGTTGGAATTCATCCTTGCATGCAAGGATCTCGTGGCTCCTGTCCGTGATCGTAAACTGAAT
ACACTGGTGCAGATCTCCGTAATCCACCCCGTGGAGCAGAGTCTGACAAGATACTCCAGCACCGAAATTGTGGAGGGAACAAGGGACCCA
CTGTTTTTGACTGGTGTCACATTCCCATCTGAGTATCCCATCTATGAGGAGACCAAAATAAAACTAACAGTCTATGATGTCAAGGATAAG
TCTCATGACACCAGGTGTTATGAACATAAACAGTATAGAAATGGATTGAAATTCTGTAAACAAATACTTTCTAATCCCAAATTTGCAGAG
CATGGAGAAACCTTGGCTATGAAAGGATTAACATTGAACTGTTTGGGGAAAAAGGAAGAAGCTTATGAATTGGTTCGTAGAGGTTTGAGA
AATGACTTGAAGAGTCATGTGTGTTGGCACGTTTATGGCCTTCTTCAGAGGTCAGACAAGAAGTATGATGAAGCCATTAAGTGTTACAGA
AATGCACTAAAATGGGATAAAGACAATCTTCAAATCTTAAGGGACCTTTCCTTACTACAGATTCAAATGCGAGATCTTGAGGGTTACAGG
GAAACGAGGTATCAGTTACTTCAGCTTCGACCTGCGCAGAGAGCATCATGGATTGGTTATGCTATTGCTTACCATTTATTAGAAGATTAT
GAAATGGCAGCAAAGATTTTAGAAGAATTTAGGAAAACACAACAGACATCCCCTGACAAGGTGGATTATGAATATAGTGAACTACTCTTA
TATCAGAATCAAGTTCTTCGGGAAGCAGGTCTCTATAGAGAAGCTTTGGAACATCTTTGTACCTATGAAAAGCAGATTTGTGATAAACTT
GCTGTAGAAGAAACCAAAGGGGAACTTCTGTTGCAACTATGTCGTTTGGAAGATGCTGCAGATGTTTATAGAGGATTGCAAGAGAGAAAT
CCTGAAAACTGGGCCTATTACAAAGGCTTGGAAAAAGCACTCAAGCCAGCTAATATGTTAGAACGGCTAAAAATTTATGAGGAAGCCTGG
ACTAAATATCCCAGGGGACTGGTGCCAAGAAGGCTGCCGTTAAACTTTTTATCTGGTGAGAAGTTTAAAGAATGTTTGGATAAGTTCCTA
AGGATGAATTTCAGCAAGGGTTGCCCACCAGTCTTCAATACTTTAAGATCATTATACAAAGACAAAGAAAAGGTGGCAATCATAGAAGAG
TTAGTAGTAGGTTATGAAACCTCTCTAAAAAGCTGCCGGTTATTTAACCCCAATGATGATGGAAAGGAGGAACCACCAACCACATTACTT
TGGGTCCAGTACTACTTGGCACAACATTATGACAAAATTGGTCAGCCATCTATTGCTTTGGAGTACATAAATACTGCTATTGAAAGTACA
CCTACATTAATAGAACTCTTTCTCGTGAAAGCTAAAATCTATAAGCATGCTGGAAATATTAAAGAAGCTGCAAGGTGGATGGATGAGGCC
CAGGCCTTGGACACAGCAGACAGATTTATCAACTCCAAATGTGCAAAATACATGCTAAAAGCCAACCTGATTAAAGAAGCTGAAGAAATG
TGCTCAAAGTTTACAAGGGAAGGAACATCAGCGGTAGAGAATTTGAATGAAATGCAGTGCATGTGGTTCCAAACAGAATGTGCCCAGGCT
TATAAAGCAATGAATAAATTTGGTGAAGCACTTAAGAAATGTCATGAGATTGAGAGACATTTTATAGAAATCACTGATGACCAGTTTGAC
TTTCATACATACTGTATGAGGAAGATTACCCTTAGATCATATGTGGACTTATTAAAACTAGAAGATGTACTTCGACAGCATCCATTTTAC
TTCAAGGCAGCAAGAATTGCTATAGAGATCTATTTGAAGCTTCATGACAACCCCCTTACAGATGAGAATAAAGAACACGAAGCTGATACA
GCAAACATGTCTGACAAAGAGCTAAAGAAGCTACGTAATAAACAAAGAAGAGCTCAAAAGAAAGCCCAGATAGAAGAAGAGAAAAAAAAT
GCAGAAAAAGAAAAGCAGCAGAGAAATCAGAAAAAGAAGAAGGATGATGATGATGAGGAGATAGGAGGTCCAAAAGAAGAACTTATTCCA
GAGAAACTGGCCAAGGTTGAAACTCCATTGGAAGAAGCTATTAAATTTTTAACACCGTTGAAGAACTTGGTGAAGAACAAGATAGAGACT
CATCTTTTTGCCTTTGAGATTTACTTTAGGAAAGAAAAGTTTCTTTTGATGCTACAATCAGTAAAGAGGGCATTTGCTATTGATTCTAGT
CATCCCTGGCTTCATGAGTGTATGATTCGTCTCTTTAATACTGTGTGTGAAAGTAAAGATTTATCTGATACAGTTAGAACAGTATTAAAA
CAAGAAATGAATCGTCTTTTTGGAGCAACGAATCCAAAGAATTTTAATGAAACTTTTCTGAAAAGGAATTCTGATTCATTGCCACACAGA
TTATCAGCTGCCAAAATGGTATATTACTTAGATCCTTCTAGTCAGAAGCGAGCTATAGAGTTGGCAACAACACTTGATGAATCTCTCACT
AACAGAAACCTCCAGACATGTATGGAGGTATTGGAAGCCTTGTATGATGGTAGCCTAGGAGACTGTAAAGAAGCTGCTGAAATTTATAGA
GCAAATTGTCATAAGCTTTTCCCTTATGCTTTGGCTTTCATGCCTCCTGGATATGAAGAGGATATGAAGATCACAGTTAATGGAGATAGT

>In-frame_INPP4B_ENST00000506217_chr4_143324091_-_NAA15_ENST00000296543_chr4_140255328_+_2919nt
ATGGAAATTAAAGAGGAAGGGGCATCAGAAGAAGGGCAGCACTTTCTTCCTACAGCCCAGGCCAATGATCCCGGGGACTGTCAGTTCACA
AGTATCCAGAAGACTCCAAATGAACCGCAGTTGGAATTCATCCTTGCATGCAAGGATCTCGTGGCTCCTGTCCGTGATCGTAAACTGAAT
ACACTGGTGCAGATCTCCGTAATCCACCCCGTGGAGCAGAGTCTGACAAGATACTCCAGCACCGAAATTGTGGAGGGAACAAGGGACCCA
CTGTTTTTGACTGGTGTCACATTCCCATCTGAGTATCCCATCTATGAGGAGACCAAAATAAAACTAACAGTCTATGATGTCAAGGATAAG
TCTCATGACACCAGGTGTTATGAACATAAACAGTATAGAAATGGATTGAAATTCTGTAAACAAATACTTTCTAATCCCAAATTTGCAGAG
CATGGAGAAACCTTGGCTATGAAAGGATTAACATTGAACTGTTTGGGGAAAAAGGAAGAAGCTTATGAATTGGTTCGTAGAGGTTTGAGA
AATGACTTGAAGAGTCATGTGTGTTGGCACGTTTATGGCCTTCTTCAGAGGTCAGACAAGAAGTATGATGAAGCCATTAAGTGTTACAGA
AATGCACTAAAATGGGATAAAGACAATCTTCAAATCTTAAGGGACCTTTCCTTACTACAGATTCAAATGCGAGATCTTGAGGGTTACAGG
GAAACGAGGTATCAGTTACTTCAGCTTCGACCTGCGCAGAGAGCATCATGGATTGGTTATGCTATTGCTTACCATTTATTAGAAGATTAT
GAAATGGCAGCAAAGATTTTAGAAGAATTTAGGAAAACACAACAGACATCCCCTGACAAGGTGGATTATGAATATAGTGAACTACTCTTA
TATCAGAATCAAGTTCTTCGGGAAGCAGGTCTCTATAGAGAAGCTTTGGAACATCTTTGTACCTATGAAAAGCAGATTTGTGATAAACTT
GCTGTAGAAGAAACCAAAGGGGAACTTCTGTTGCAACTATGTCGTTTGGAAGATGCTGCAGATGTTTATAGAGGATTGCAAGAGAGAAAT
CCTGAAAACTGGGCCTATTACAAAGGCTTGGAAAAAGCACTCAAGCCAGCTAATATGTTAGAACGGCTAAAAATTTATGAGGAAGCCTGG
ACTAAATATCCCAGGGGACTGGTGCCAAGAAGGCTGCCGTTAAACTTTTTATCTGGTGAGAAGTTTAAAGAATGTTTGGATAAGTTCCTA
AGGATGAATTTCAGCAAGGGTTGCCCACCAGTCTTCAATACTTTAAGATCATTATACAAAGACAAAGAAAAGGTGGCAATCATAGAAGAG
TTAGTAGTAGGTTATGAAACCTCTCTAAAAAGCTGCCGGTTATTTAACCCCAATGATGATGGAAAGGAGGAACCACCAACCACATTACTT
TGGGTCCAGTACTACTTGGCACAACATTATGACAAAATTGGTCAGCCATCTATTGCTTTGGAGTACATAAATACTGCTATTGAAAGTACA
CCTACATTAATAGAACTCTTTCTCGTGAAAGCTAAAATCTATAAGCATGCTGGAAATATTAAAGAAGCTGCAAGGTGGATGGATGAGGCC
CAGGCCTTGGACACAGCAGACAGATTTATCAACTCCAAATGTGCAAAATACATGCTAAAAGCCAACCTGATTAAAGAAGCTGAAGAAATG
TGCTCAAAGTTTACAAGGGAAGGAACATCAGCGGTAGAGAATTTGAATGAAATGCAGTGCATGTGGTTCCAAACAGAATGTGCCCAGGCT
TATAAAGCAATGAATAAATTTGGTGAAGCACTTAAGAAATGTCATGAGATTGAGAGACATTTTATAGAAATCACTGATGACCAGTTTGAC
TTTCATACATACTGTATGAGGAAGATTACCCTTAGATCATATGTGGACTTATTAAAACTAGAAGATGTACTTCGACAGCATCCATTTTAC
TTCAAGGCAGCAAGAATTGCTATAGAGATCTATTTGAAGCTTCATGACAACCCCCTTACAGATGAGAATAAAGAACACGAAGCTGATACA
GCAAACATGTCTGACAAAGAGCTAAAGAAGCTACGTAATAAACAAAGAAGAGCTCAAAAGAAAGCCCAGATAGAAGAAGAGAAAAAAAAT
GCAGAAAAAGAAAAGCAGCAGAGAAATCAGAAAAAGAAGAAGGATGATGATGATGAGGAGATAGGAGGTCCAAAAGAAGAACTTATTCCA
GAGAAACTGGCCAAGGTTGAAACTCCATTGGAAGAAGCTATTAAATTTTTAACACCGTTGAAGAACTTGGTGAAGAACAAGATAGAGACT
CATCTTTTTGCCTTTGAGATTTACTTTAGGAAAGAAAAGTTTCTTTTGATGCTACAATCAGTAAAGAGGGCATTTGCTATTGATTCTAGT
CATCCCTGGCTTCATGAGTGTATGATTCGTCTCTTTAATACTGCAGTGTGTGAAAGTAAAGATTTATCTGATACAGTTAGAACAGTATTA
AAACAAGAAATGAATCGTCTTTTTGGAGCAACGAATCCAAAGAATTTTAATGAAACTTTTCTGAAAAGGAATTCTGATTCATTGCCACAC
AGATTATCAGCTGCCAAAATGGTATATTACTTAGATCCTTCTAGTCAGAAGCGAGCTATAGAGTTGGCAACAACACTTGATGAATCTCTC
ACTAACAGAAACCTCCAGACATGTATGGAGGTATTGGAAGCCTTGTATGATGGTAGCCTAGGAGACTGTAAAGAAGCTGCTGAAATTTAT
AGAGCAAATTGTCATAAGCTTTTCCCTTATGCTTTGGCTTTCATGCCTCCTGGATATGAAGAGGATATGAAGATCACAGTTAATGGAGAT

>In-frame_INPP4B_ENST00000506217_chr4_143324091_-_NAA15_ENST00000398947_chr4_140255328_+_2916nt
ATGGAAATTAAAGAGGAAGGGGCATCAGAAGAAGGGCAGCACTTTCTTCCTACAGCCCAGGCCAATGATCCCGGGGACTGTCAGTTCACA
AGTATCCAGAAGACTCCAAATGAACCGCAGTTGGAATTCATCCTTGCATGCAAGGATCTCGTGGCTCCTGTCCGTGATCGTAAACTGAAT
ACACTGGTGCAGATCTCCGTAATCCACCCCGTGGAGCAGAGTCTGACAAGATACTCCAGCACCGAAATTGTGGAGGGAACAAGGGACCCA
CTGTTTTTGACTGGTGTCACATTCCCATCTGAGTATCCCATCTATGAGGAGACCAAAATAAAACTAACAGTCTATGATGTCAAGGATAAG
TCTCATGACACCAGGTGTTATGAACATAAACAGTATAGAAATGGATTGAAATTCTGTAAACAAATACTTTCTAATCCCAAATTTGCAGAG
CATGGAGAAACCTTGGCTATGAAAGGATTAACATTGAACTGTTTGGGGAAAAAGGAAGAAGCTTATGAATTGGTTCGTAGAGGTTTGAGA
AATGACTTGAAGAGTCATGTGTGTTGGCACGTTTATGGCCTTCTTCAGAGGTCAGACAAGAAGTATGATGAAGCCATTAAGTGTTACAGA
AATGCACTAAAATGGGATAAAGACAATCTTCAAATCTTAAGGGACCTTTCCTTACTACAGATTCAAATGCGAGATCTTGAGGGTTACAGG
GAAACGAGGTATCAGTTACTTCAGCTTCGACCTGCGCAGAGAGCATCATGGATTGGTTATGCTATTGCTTACCATTTATTAGAAGATTAT
GAAATGGCAGCAAAGATTTTAGAAGAATTTAGGAAAACACAACAGACATCCCCTGACAAGGTGGATTATGAATATAGTGAACTACTCTTA
TATCAGAATCAAGTTCTTCGGGAAGCAGGTCTCTATAGAGAAGCTTTGGAACATCTTTGTACCTATGAAAAGCAGATTTGTGATAAACTT
GCTGTAGAAGAAACCAAAGGGGAACTTCTGTTGCAACTATGTCGTTTGGAAGATGCTGCAGATGTTTATAGAGGATTGCAAGAGAGAAAT
CCTGAAAACTGGGCCTATTACAAAGGCTTGGAAAAAGCACTCAAGCCAGCTAATATGTTAGAACGGCTAAAAATTTATGAGGAAGCCTGG
ACTAAATATCCCAGGGGACTGGTGCCAAGAAGGCTGCCGTTAAACTTTTTATCTGGTGAGAAGTTTAAAGAATGTTTGGATAAGTTCCTA
AGGATGAATTTCAGCAAGGGTTGCCCACCAGTCTTCAATACTTTAAGATCATTATACAAAGACAAAGAAAAGGTGGCAATCATAGAAGAG
TTAGTAGTAGGTTATGAAACCTCTCTAAAAAGCTGCCGGTTATTTAACCCCAATGATGATGGAAAGGAGGAACCACCAACCACATTACTT
TGGGTCCAGTACTACTTGGCACAACATTATGACAAAATTGGTCAGCCATCTATTGCTTTGGAGTACATAAATACTGCTATTGAAAGTACA
CCTACATTAATAGAACTCTTTCTCGTGAAAGCTAAAATCTATAAGCATGCTGGAAATATTAAAGAAGCTGCAAGGTGGATGGATGAGGCC
CAGGCCTTGGACACAGCAGACAGATTTATCAACTCCAAATGTGCAAAATACATGCTAAAAGCCAACCTGATTAAAGAAGCTGAAGAAATG
TGCTCAAAGTTTACAAGGGAAGGAACATCAGCGGTAGAGAATTTGAATGAAATGCAGTGCATGTGGTTCCAAACAGAATGTGCCCAGGCT
TATAAAGCAATGAATAAATTTGGTGAAGCACTTAAGAAATGTCATGAGATTGAGAGACATTTTATAGAAATCACTGATGACCAGTTTGAC
TTTCATACATACTGTATGAGGAAGATTACCCTTAGATCATATGTGGACTTATTAAAACTAGAAGATGTACTTCGACAGCATCCATTTTAC
TTCAAGGCAGCAAGAATTGCTATAGAGATCTATTTGAAGCTTCATGACAACCCCCTTACAGATGAGAATAAAGAACACGAAGCTGATACA
GCAAACATGTCTGACAAAGAGCTAAAGAAGCTACGTAATAAACAAAGAAGAGCTCAAAAGAAAGCCCAGATAGAAGAAGAGAAAAAAAAT
GCAGAAAAAGAAAAGCAGCAGAGAAATCAGAAAAAGAAGAAGGATGATGATGATGAGGAGATAGGAGGTCCAAAAGAAGAACTTATTCCA
GAGAAACTGGCCAAGGTTGAAACTCCATTGGAAGAAGCTATTAAATTTTTAACACCGTTGAAGAACTTGGTGAAGAACAAGATAGAGACT
CATCTTTTTGCCTTTGAGATTTACTTTAGGAAAGAAAAGTTTCTTTTGATGCTACAATCAGTAAAGAGGGCATTTGCTATTGATTCTAGT
CATCCCTGGCTTCATGAGTGTATGATTCGTCTCTTTAATACTGTGTGTGAAAGTAAAGATTTATCTGATACAGTTAGAACAGTATTAAAA
CAAGAAATGAATCGTCTTTTTGGAGCAACGAATCCAAAGAATTTTAATGAAACTTTTCTGAAAAGGAATTCTGATTCATTGCCACACAGA
TTATCAGCTGCCAAAATGGTATATTACTTAGATCCTTCTAGTCAGAAGCGAGCTATAGAGTTGGCAACAACACTTGATGAATCTCTCACT
AACAGAAACCTCCAGACATGTATGGAGGTATTGGAAGCCTTGTATGATGGTAGCCTAGGAGACTGTAAAGAAGCTGCTGAAATTTATAGA
GCAAATTGTCATAAGCTTTTCCCTTATGCTTTGGCTTTCATGCCTCCTGGATATGAAGAGGATATGAAGATCACAGTTAATGGAGATAGT


* Fusion transcript sequences (Full-length transcript).
>In-frame_INPP4B_ENST00000513000_chr4_143324091_-_NAA15_ENST00000296543_chr4_140255328_+_6651nt
CACACGCTCGCAAGCGAACGCAGGAAAGTCAGGCTAAAAGTGTCTGCTGCTGCTGCCGCCCCCCACTCCGCCTCCGGGAGAGAATACAAA
GAAATGGTGTTACCTGGCAAGAGGTCTTCTGTCTTTTATGAAAAATTAGACAAAGGCTTTACAGGAGGCATAGTACTGGAAATCTGCTCC
TGATGAGGTCTCAGAAAGCTTCCACTCGTGGTGGAAGGCAAAGGAGGAGCAGGCACATCACATGAGCCTTGAAACCAGCGAAACAATAAT
CAAAGAGCAGTTCTGTCAAAGAAAACAACATAAATCAGGTACAGAATTTCAGAGTGGGATATCAGATCTTTAGTGTGAAGATACATCTAC
ATTAAACCAGGAATCACTAGAACTGACATTTGGACAAGAAAATTTGGAAAATTTTAAAACTGTGAAGGTTGATCATGGAAATTAAAGAGG
AAGGGGCATCAGAAGAAGGGCAGCACTTTCTTCCTACAGCCCAGGCCAATGATCCCGGGGACTGTCAGTTCACAAGTATCCAGAAGACTC
CAAATGAACCGCAGTTGGAATTCATCCTTGCATGCAAGGATCTCGTGGCTCCTGTCCGTGATCGTAAACTGAATACACTGGTGCAGATCT
CCGTAATCCACCCCGTGGAGCAGAGTCTGACAAGATACTCCAGCACCGAAATTGTGGAGGGAACAAGGGACCCACTGTTTTTGACTGGTG
TCACATTCCCATCTGAGTATCCCATCTATGAGGAGACCAAAATAAAACTAACAGTCTATGATGTCAAGGATAAGTCTCATGACACCAGGT
GTTATGAACATAAACAGTATAGAAATGGATTGAAATTCTGTAAACAAATACTTTCTAATCCCAAATTTGCAGAGCATGGAGAAACCTTGG
CTATGAAAGGATTAACATTGAACTGTTTGGGGAAAAAGGAAGAAGCTTATGAATTGGTTCGTAGAGGTTTGAGAAATGACTTGAAGAGTC
ATGTGTGTTGGCACGTTTATGGCCTTCTTCAGAGGTCAGACAAGAAGTATGATGAAGCCATTAAGTGTTACAGAAATGCACTAAAATGGG
ATAAAGACAATCTTCAAATCTTAAGGGACCTTTCCTTACTACAGATTCAAATGCGAGATCTTGAGGGTTACAGGGAAACGAGGTATCAGT
TACTTCAGCTTCGACCTGCGCAGAGAGCATCATGGATTGGTTATGCTATTGCTTACCATTTATTAGAAGATTATGAAATGGCAGCAAAGA
TTTTAGAAGAATTTAGGAAAACACAACAGACATCCCCTGACAAGGTGGATTATGAATATAGTGAACTACTCTTATATCAGAATCAAGTTC
TTCGGGAAGCAGGTCTCTATAGAGAAGCTTTGGAACATCTTTGTACCTATGAAAAGCAGATTTGTGATAAACTTGCTGTAGAAGAAACCA
AAGGGGAACTTCTGTTGCAACTATGTCGTTTGGAAGATGCTGCAGATGTTTATAGAGGATTGCAAGAGAGAAATCCTGAAAACTGGGCCT
ATTACAAAGGCTTGGAAAAAGCACTCAAGCCAGCTAATATGTTAGAACGGCTAAAAATTTATGAGGAAGCCTGGACTAAATATCCCAGGG
GACTGGTGCCAAGAAGGCTGCCGTTAAACTTTTTATCTGGTGAGAAGTTTAAAGAATGTTTGGATAAGTTCCTAAGGATGAATTTCAGCA
AGGGTTGCCCACCAGTCTTCAATACTTTAAGATCATTATACAAAGACAAAGAAAAGGTGGCAATCATAGAAGAGTTAGTAGTAGGTTATG
AAACCTCTCTAAAAAGCTGCCGGTTATTTAACCCCAATGATGATGGAAAGGAGGAACCACCAACCACATTACTTTGGGTCCAGTACTACT
TGGCACAACATTATGACAAAATTGGTCAGCCATCTATTGCTTTGGAGTACATAAATACTGCTATTGAAAGTACACCTACATTAATAGAAC
TCTTTCTCGTGAAAGCTAAAATCTATAAGCATGCTGGAAATATTAAAGAAGCTGCAAGGTGGATGGATGAGGCCCAGGCCTTGGACACAG
CAGACAGATTTATCAACTCCAAATGTGCAAAATACATGCTAAAAGCCAACCTGATTAAAGAAGCTGAAGAAATGTGCTCAAAGTTTACAA
GGGAAGGAACATCAGCGGTAGAGAATTTGAATGAAATGCAGTGCATGTGGTTCCAAACAGAATGTGCCCAGGCTTATAAAGCAATGAATA
AATTTGGTGAAGCACTTAAGAAATGTCATGAGATTGAGAGACATTTTATAGAAATCACTGATGACCAGTTTGACTTTCATACATACTGTA
TGAGGAAGATTACCCTTAGATCATATGTGGACTTATTAAAACTAGAAGATGTACTTCGACAGCATCCATTTTACTTCAAGGCAGCAAGAA
TTGCTATAGAGATCTATTTGAAGCTTCATGACAACCCCCTTACAGATGAGAATAAAGAACACGAAGCTGATACAGCAAACATGTCTGACA
AAGAGCTAAAGAAGCTACGTAATAAACAAAGAAGAGCTCAAAAGAAAGCCCAGATAGAAGAAGAGAAAAAAAATGCAGAAAAAGAAAAGC
AGCAGAGAAATCAGAAAAAGAAGAAGGATGATGATGATGAGGAGATAGGAGGTCCAAAAGAAGAACTTATTCCAGAGAAACTGGCCAAGG
TTGAAACTCCATTGGAAGAAGCTATTAAATTTTTAACACCGTTGAAGAACTTGGTGAAGAACAAGATAGAGACTCATCTTTTTGCCTTTG
AGATTTACTTTAGGAAAGAAAAGTTTCTTTTGATGCTACAATCAGTAAAGAGGGCATTTGCTATTGATTCTAGTCATCCCTGGCTTCATG
AGTGTATGATTCGTCTCTTTAATACTGCAGTGTGTGAAAGTAAAGATTTATCTGATACAGTTAGAACAGTATTAAAACAAGAAATGAATC
GTCTTTTTGGAGCAACGAATCCAAAGAATTTTAATGAAACTTTTCTGAAAAGGAATTCTGATTCATTGCCACACAGATTATCAGCTGCCA
AAATGGTATATTACTTAGATCCTTCTAGTCAGAAGCGAGCTATAGAGTTGGCAACAACACTTGATGAATCTCTCACTAACAGAAACCTCC
AGACATGTATGGAGGTATTGGAAGCCTTGTATGATGGTAGCCTAGGAGACTGTAAAGAAGCTGCTGAAATTTATAGAGCAAATTGTCATA
AGCTTTTCCCTTATGCTTTGGCTTTCATGCCTCCTGGATATGAAGAGGATATGAAGATCACAGTTAATGGAGATAGTTCTGCAGAAGCTG
AAGAACTGGCCAATGAAATTTGAACATCACTAAACAAGCAAATGGAATGACTTTGGACCATATCTAGTATATAATATTTTTGTCACGCAC
CTGCTGCATTGCTCTAACTTACACAGAATGAGAGGAGTAAATGTTCTTGCCTTCAAATAGTGTTTTACGTTTTTTATCCTGCTGAAAAAG
TATATATAAAATATCTAACATTACAGGATAGAGGTTCAGTTTCTTAAAAAATTAAAGCTGCTAAAATTGAGTGGTTAAAAAAGATACCTT
ATCCTATTCCTCCCCACCCACCCATGTTTTTAAACTAATTTATATAAAATCTGGAGGCTGTTACAGCTAACAAAGCAGGTGTGTGGCAGA
AATATTACTTTAAATTTGTCTTGTGAGATTTTACTATATCTCAGACAGCATAAATGCTGTTTTAGCACTGGATTCTTTCACTGAGCACAA
AGAGTTGTTGGGGCTTTAGCATCTGACTGATTTTGTTACGGGGTTGATTCTGACCATAGGAAGTATGCAATGTGAATCACTATTTACAGA
GAAACCTACAACAGATGCTTGATGTTGTAGAAACTGGGACATATAGATACCAAGCAAAATTATAAGAAACCTATAAGGTGTTCAATACGC
TTGTGTTTCCAAAATTCACTGTACATGATCAGTTTGGTGTTCTTGTACCACAGTTTTTAACTGAAGGAACCAGTTGTAACAGTCTCAATT
TTAACTAAAACTTGAAGAACTAAAACAACAATGCAAACCTTTCAGCATTGTTTGGCCAAACTTGTTAAAACTGTAATGCAAGAACCAAAT
GCACTGTGATGTGGCACCAACTAATTAGCAAGCATGAATTTTTCACCCAAGAGTGAAAAAAGGAAAATCTACCATGGCTTGAAGTTAAAG
AGCAGAACTCCTGACTACCATTCTATGACTGATCAAAAGACTAATAGTTAAAAACCTCAGCAGGCCTTGTTCACGATATGCAGAAAAAAA
AGTGCTGCAGTTTAGATACCTCTGGAATTTTTCCACAGTGTCACAGGTTTGTAATACTTGAAGCCCTACATTTCTAAGAATATATTTCTT
GCTCAGTTGTTTCAGGCAAGCCCAAGACTTTGTAATTTTTAAAGGGCCCAAGATTTTTTTTTTTTTTTTTTTTTTCAAATAACAGACCAG
CTTCTTTTTCTTGCAGTTACAGATGTAATTTCCTTTTTGTTGTCAAACATAAGGTACCAAATATGATGCAATAAATTGTTTTGAAAAACA
GTTGTGTGAATATTTCAACTAATCTGTGTTGGGCTTCTGTGAAATACACAGGTGGAAACAGAGGTGCAAGCCAGAGGCAATGTAATATGC
TGTAAGGCTAGTGCAGATGGGAGCTTTTTAGAAGGGGCTAAGTGCTGGTGTCAGGGAAATTCCATAATGAAGTAGAATGCTGCTCCTGCA
TTAAGATTTCATTGAGGGCAAGGCTGGTGGCAGGTACTATGAATGTAATTCATAATTTAAAAGGAAAACTAAAAACTATTTTGATTTGGG
AAAATGAGCCTTAATTTGTTAAACCTATACACTGAGAACTAGCCTCAGGCTTAATATTCTCATTGCATTTGCAAGATCTGAGCAAATAAG
ATTAAGTAAAACAAATCAATTGTATATATAATTGACCTTTTTGTGGAACATGTAGTTTATAGAAAGTATACTCTAAAGGGAATTTGCCGA
AGACCTTTTACTGATTGAACAGTTGTGCTACAATCAACTTTTCATAGTACATGACCTGCATTCCACATCTCAGTCTAACAGTTTAGTAGT
GATGTAAAGAGAAGTACAAACCGAACTCCAGTGCTTTGTTATGTTTTATTAACTGGCCCTGTCTCAGGAACATCTTAACAGATGGCAAAA
AAACAAAAACTTTTTTTCAACTCCTATGAGTGGCAACTGAAGTTCTTATTGTTGGGAAAGAACACTAGTCCTACCTCTGCCACTAATGAG
GTGTTTGGAGGAGGTACCAGCCATATAATAGGGGGTGTATGTGTGAATTTTGTTTAAACTCTACTGTATATTGAAATGAAATTCATTTAT
TTGTCTTGACAATGTTCAAATGATGTAGATTGTCTTAGAATGAATATTCATAAGTACTCAGAACTCTTAAGATGCAGATGCCACCCGTGA
GGAGCTAAATTCCTAATGTGTATTGTATTCCAACCCAATTTTACTGGAACTATTGAATAAATCTTTTATTTTCTTTCAGGTTTACTTGAT
AGTGGATACATTGGTGTCAGAGGACCTTGACTGGGTTCATTTTATGTCCAGACATCACCCCTGAAACACTGTACTGTACTATCTTGCTCT
GAGTAGTATCAACTGGATCGTCTCATATTTGCCTCATTCATCCTATTAATTTCAAATGATACTGTGGGGGAAAAACAGGGTTAGAAAAAC
AAGTGGAAAAAATGGAGTGATGTTGTAATCTAAACAAGTGCCTTATGTTTATTGCTAAGAACTGGTGTTACCAACCCTTTTGAGAAGAAA
GGGTCTCTTGACCTGTATTAACATAGGAAAGTAAAGTTCTTTTTGTTTTTCTTTATATTCAGCTACTCTTGTCATTTCTCGTTGAAAAAC
TAAAATCTGACTAGGTTAGTTTACTCAGCTTTAATTAGATAGTTGAGTCATATATTTTCAACATTTTTCTGTATCGTATTTATTATGCAC
AAAAATAAAGTGTGATCTCTAATAGCATGGCTAAAGGTAATGCCAATATTAGTGAATAGCTTTGCTGTGGGCTTTATCAGGCCCTTGTTT
TTCACAGTGTTGTTTGTACTCCATGGTGTATTGCTATTAGAGCTGTGAAATGAAAGCTGTGACTTTATGAAGAGATCAAAAAAAGTGTGG
TCCAGATTCAGGTAGGTTGTGGTAAGTTCAGGGAAGTCTTGTATGATTTCTAAGAATATTTCAGTTACCATGTATAGTATTTGGGAAAAG
CTGTAATGTAAAATATTGGACTTTGTTGCAAGATAGGTATATACTTGTGTCAGATAATTAAAGCCTTAAATTTTGAAATGAATCTTTGAG
ATTTCAAAGAAAGACTGACCTTTCAAATAGAAGGCGGTCTTTCTATTCTAGCTAATGCCCCACTTCTTTAAGTTATAAACAAAGTTTCAT
GATACCATTCTGCTATCATCTAAACTTTGCTGAACTCTACTGCCAACCTACATTAAAAACAAAGTCCCACGAAATGGCTGTGTTACACCA

>In-frame_INPP4B_ENST00000513000_chr4_143324091_-_NAA15_ENST00000398947_chr4_140255328_+_6634nt
CACACGCTCGCAAGCGAACGCAGGAAAGTCAGGCTAAAAGTGTCTGCTGCTGCTGCCGCCCCCCACTCCGCCTCCGGGAGAGAATACAAA
GAAATGGTGTTACCTGGCAAGAGGTCTTCTGTCTTTTATGAAAAATTAGACAAAGGCTTTACAGGAGGCATAGTACTGGAAATCTGCTCC
TGATGAGGTCTCAGAAAGCTTCCACTCGTGGTGGAAGGCAAAGGAGGAGCAGGCACATCACATGAGCCTTGAAACCAGCGAAACAATAAT
CAAAGAGCAGTTCTGTCAAAGAAAACAACATAAATCAGGTACAGAATTTCAGAGTGGGATATCAGATCTTTAGTGTGAAGATACATCTAC
ATTAAACCAGGAATCACTAGAACTGACATTTGGACAAGAAAATTTGGAAAATTTTAAAACTGTGAAGGTTGATCATGGAAATTAAAGAGG
AAGGGGCATCAGAAGAAGGGCAGCACTTTCTTCCTACAGCCCAGGCCAATGATCCCGGGGACTGTCAGTTCACAAGTATCCAGAAGACTC
CAAATGAACCGCAGTTGGAATTCATCCTTGCATGCAAGGATCTCGTGGCTCCTGTCCGTGATCGTAAACTGAATACACTGGTGCAGATCT
CCGTAATCCACCCCGTGGAGCAGAGTCTGACAAGATACTCCAGCACCGAAATTGTGGAGGGAACAAGGGACCCACTGTTTTTGACTGGTG
TCACATTCCCATCTGAGTATCCCATCTATGAGGAGACCAAAATAAAACTAACAGTCTATGATGTCAAGGATAAGTCTCATGACACCAGGT
GTTATGAACATAAACAGTATAGAAATGGATTGAAATTCTGTAAACAAATACTTTCTAATCCCAAATTTGCAGAGCATGGAGAAACCTTGG
CTATGAAAGGATTAACATTGAACTGTTTGGGGAAAAAGGAAGAAGCTTATGAATTGGTTCGTAGAGGTTTGAGAAATGACTTGAAGAGTC
ATGTGTGTTGGCACGTTTATGGCCTTCTTCAGAGGTCAGACAAGAAGTATGATGAAGCCATTAAGTGTTACAGAAATGCACTAAAATGGG
ATAAAGACAATCTTCAAATCTTAAGGGACCTTTCCTTACTACAGATTCAAATGCGAGATCTTGAGGGTTACAGGGAAACGAGGTATCAGT
TACTTCAGCTTCGACCTGCGCAGAGAGCATCATGGATTGGTTATGCTATTGCTTACCATTTATTAGAAGATTATGAAATGGCAGCAAAGA
TTTTAGAAGAATTTAGGAAAACACAACAGACATCCCCTGACAAGGTGGATTATGAATATAGTGAACTACTCTTATATCAGAATCAAGTTC
TTCGGGAAGCAGGTCTCTATAGAGAAGCTTTGGAACATCTTTGTACCTATGAAAAGCAGATTTGTGATAAACTTGCTGTAGAAGAAACCA
AAGGGGAACTTCTGTTGCAACTATGTCGTTTGGAAGATGCTGCAGATGTTTATAGAGGATTGCAAGAGAGAAATCCTGAAAACTGGGCCT
ATTACAAAGGCTTGGAAAAAGCACTCAAGCCAGCTAATATGTTAGAACGGCTAAAAATTTATGAGGAAGCCTGGACTAAATATCCCAGGG
GACTGGTGCCAAGAAGGCTGCCGTTAAACTTTTTATCTGGTGAGAAGTTTAAAGAATGTTTGGATAAGTTCCTAAGGATGAATTTCAGCA
AGGGTTGCCCACCAGTCTTCAATACTTTAAGATCATTATACAAAGACAAAGAAAAGGTGGCAATCATAGAAGAGTTAGTAGTAGGTTATG
AAACCTCTCTAAAAAGCTGCCGGTTATTTAACCCCAATGATGATGGAAAGGAGGAACCACCAACCACATTACTTTGGGTCCAGTACTACT
TGGCACAACATTATGACAAAATTGGTCAGCCATCTATTGCTTTGGAGTACATAAATACTGCTATTGAAAGTACACCTACATTAATAGAAC
TCTTTCTCGTGAAAGCTAAAATCTATAAGCATGCTGGAAATATTAAAGAAGCTGCAAGGTGGATGGATGAGGCCCAGGCCTTGGACACAG
CAGACAGATTTATCAACTCCAAATGTGCAAAATACATGCTAAAAGCCAACCTGATTAAAGAAGCTGAAGAAATGTGCTCAAAGTTTACAA
GGGAAGGAACATCAGCGGTAGAGAATTTGAATGAAATGCAGTGCATGTGGTTCCAAACAGAATGTGCCCAGGCTTATAAAGCAATGAATA
AATTTGGTGAAGCACTTAAGAAATGTCATGAGATTGAGAGACATTTTATAGAAATCACTGATGACCAGTTTGACTTTCATACATACTGTA
TGAGGAAGATTACCCTTAGATCATATGTGGACTTATTAAAACTAGAAGATGTACTTCGACAGCATCCATTTTACTTCAAGGCAGCAAGAA
TTGCTATAGAGATCTATTTGAAGCTTCATGACAACCCCCTTACAGATGAGAATAAAGAACACGAAGCTGATACAGCAAACATGTCTGACA
AAGAGCTAAAGAAGCTACGTAATAAACAAAGAAGAGCTCAAAAGAAAGCCCAGATAGAAGAAGAGAAAAAAAATGCAGAAAAAGAAAAGC
AGCAGAGAAATCAGAAAAAGAAGAAGGATGATGATGATGAGGAGATAGGAGGTCCAAAAGAAGAACTTATTCCAGAGAAACTGGCCAAGG
TTGAAACTCCATTGGAAGAAGCTATTAAATTTTTAACACCGTTGAAGAACTTGGTGAAGAACAAGATAGAGACTCATCTTTTTGCCTTTG
AGATTTACTTTAGGAAAGAAAAGTTTCTTTTGATGCTACAATCAGTAAAGAGGGCATTTGCTATTGATTCTAGTCATCCCTGGCTTCATG
AGTGTATGATTCGTCTCTTTAATACTGTGTGTGAAAGTAAAGATTTATCTGATACAGTTAGAACAGTATTAAAACAAGAAATGAATCGTC
TTTTTGGAGCAACGAATCCAAAGAATTTTAATGAAACTTTTCTGAAAAGGAATTCTGATTCATTGCCACACAGATTATCAGCTGCCAAAA
TGGTATATTACTTAGATCCTTCTAGTCAGAAGCGAGCTATAGAGTTGGCAACAACACTTGATGAATCTCTCACTAACAGAAACCTCCAGA
CATGTATGGAGGTATTGGAAGCCTTGTATGATGGTAGCCTAGGAGACTGTAAAGAAGCTGCTGAAATTTATAGAGCAAATTGTCATAAGC
TTTTCCCTTATGCTTTGGCTTTCATGCCTCCTGGATATGAAGAGGATATGAAGATCACAGTTAATGGAGATAGTTCTGCAGAAGCTGAAG
AACTGGCCAATGAAATTTGAACATCACTAAACAAGCAAATGGAATGACTTTGGACCATATCTAGTATATAATATTTTTGTCACGCACCTG
CTGCATTGCTCTAACTTACACAGAATGAGAGGAGTAAATGTTCTTGCCTTCAAATAGTGTTTTACGTTTTTTATCCTGCTGAAAAAGTAT
ATATAAAATATCTAACATTACAGGATAGAGGTTCAGTTTCTTAAAAAATTAAAGCTGCTAAAATTGAGTGGTTAAAAAAGATACCTTATC
CTATTCCTCCCCACCCACCCATGTTTTTAAACTAATTTATATAAAATCTGGAGGCTGTTACAGCTAACAAAGCAGGTGTGTGGCAGAAAT
ATTACTTTAAATTTGTCTTGTGAGATTTTACTATATCTCAGACAGCATAAATGCTGTTTTAGCACTGGATTCTTTCACTGAGCACAAAGA
GTTGTTGGGGCTTTAGCATCTGACTGATTTTGTTACGGGGTTGATTCTGACCATAGGAAGTATGCAATGTGAATCACTATTTACAGAGAA
ACCTACAACAGATGCTTGATGTTGTAGAAACTGGGACATATAGATACCAAGCAAAATTATAAGAAACCTATAAGGTGTTCAATACGCTTG
TGTTTCCAAAATTCACTGTACATGATCAGTTTGGTGTTCTTGTACCACAGTTTTTAACTGAAGGAACCAGTTGTAACAGTCTCAATTTTA
ACTAAAACTTGAAGAACTAAAACAACAATGCAAACCTTTCAGCATTGTTTGGCCAAACTTGTTAAAACTGTAATGCAAGAACCAAATGCA
CTGTGATGTGGCACCAACTAATTAGCAAGCATGAATTTTTCACCCAAGAGTGAAAAAAGGAAAATCTACCATGGCTTGAAGTTAAAGAGC
AGAACTCCTGACTACCATTCTATGACTGATCAAAAGACTAATAGTTAAAAACCTCAGCAGGCCTTGTTCACGATATGCAGAAAAAAAAGT
GCTGCAGTTTAGATACCTCTGGAATTTTTCCACAGTGTCACAGGTTTGTAATACTTGAAGCCCTACATTTCTAAGAATATATTTCTTGCT
CAGTTGTTTCAGGCAAGCCCAAGACTTTGTAATTTTTAAAGGGCCCAAGATTTTTTTTTTTTTTTTTTTTTTCAAATAACAGACCAGCTT
CTTTTTCTTGCAGTTACAGATGTAATTTCCTTTTTGTTGTCAAACATAAGGTACCAAATATGATGCAATAAATTGTTTTGAAAAACAGTT
GTGTGAATATTTCAACTAATCTGTGTTGGGCTTCTGTGAAATACACAGGTGGAAACAGAGGTGCAAGCCAGAGGCAATGTAATATGCTGT
AAGGCTAGTGCAGATGGGAGCTTTTTAGAAGGGGCTAAGTGCTGGTGTCAGGGAAATTCCATAATGAAGTAGAATGCTGCTCCTGCATTA
AGATTTCATTGAGGGCAAGGCTGGTGGCAGGTACTATGAATGTAATTCATAATTTAAAAGGAAAACTAAAAACTATTTTGATTTGGGAAA
ATGAGCCTTAATTTGTTAAACCTATACACTGAGAACTAGCCTCAGGCTTAATATTCTCATTGCATTTGCAAGATCTGAGCAAATAAGATT
AAGTAAAACAAATCAATTGTATATATAATTGACCTTTTTGTGGAACATGTAGTTTATAGAAAGTATACTCTAAAGGGAATTTGCCGAAGA
CCTTTTACTGATTGAACAGTTGTGCTACAATCAACTTTTCATAGTACATGACCTGCATTCCACATCTCAGTCTAACAGTTTAGTAGTGAT
GTAAAGAGAAGTACAAACCGAACTCCAGTGCTTTGTTATGTTTTATTAACTGGCCCTGTCTCAGGAACATCTTAACAGATGGCAAAAAAA
CAAAAACTTTTTTTCAACTCCTATGAGTGGCAACTGAAGTTCTTATTGTTGGGAAAGAACACTAGTCCTACCTCTGCCACTAATGAGGTG
TTTGGAGGAGGTACCAGCCATATAATAGGGGGTGTATGTGTGAATTTTGTTTAAACTCTACTGTATATTGAAATGAAATTCATTTATTTG
TCTTGACAATGTTCAAATGATGTAGATTGTCTTAGAATGAATATTCATAAGTACTCAGAACTCTTAAGATGCAGATGCCACCCGTGAGGA
GCTAAATTCCTAATGTGTATTGTATTCCAACCCAATTTTACTGGAACTATTGAATAAATCTTTTATTTTCTTTCAGGTTTACTTGATAGT
GGATACATTGGTGTCAGAGGACCTTGACTGGGTTCATTTTATGTCCAGACATCACCCCTGAAACACTGTACTGTACTATCTTGCTCTGAG
TAGTATCAACTGGATCGTCTCATATTTGCCTCATTCATCCTATTAATTTCAAATGATACTGTGGGGGAAAAACAGGGTTAGAAAAACAAG
TGGAAAAAATGGAGTGATGTTGTAATCTAAACAAGTGCCTTATGTTTATTGCTAAGAACTGGTGTTACCAACCCTTTTGAGAAGAAAGGG
TCTCTTGACCTGTATTAACATAGGAAAGTAAAGTTCTTTTTGTTTTTCTTTATATTCAGCTACTCTTGTCATTTCTCGTTGAAAAACTAA
AATCTGACTAGGTTAGTTTACTCAGCTTTAATTAGATAGTTGAGTCATATATTTTCAACATTTTTCTGTATCGTATTTATTATGCACAAA
AATAAAGTGTGATCTCTAATAGCATGGCTAAAGGTAATGCCAATATTAGTGAATAGCTTTGCTGTGGGCTTTATCAGGCCCTTGTTTTTC
ACAGTGTTGTTTGTACTCCATGGTGTATTGCTATTAGAGCTGTGAAATGAAAGCTGTGACTTTATGAAGAGATCAAAAAAAGTGTGGTCC
AGATTCAGGTAGGTTGTGGTAAGTTCAGGGAAGTCTTGTATGATTTCTAAGAATATTTCAGTTACCATGTATAGTATTTGGGAAAAGCTG
TAATGTAAAATATTGGACTTTGTTGCAAGATAGGTATATACTTGTGTCAGATAATTAAAGCCTTAAATTTTGAAATGAATCTTTGAGATT
TCAAAGAAAGACTGACCTTTCAAATAGAAGGCGGTCTTTCTATTCTAGCTAATGCCCCACTTCTTTAAGTTATAAACAAAGTTTCATGAT
ACCATTCTGCTATCATCTAAACTTTGCTGAACTCTACTGCCAACCTACATTAAAAACAAAGTCCCACGAAATGGCTGTGTTACACCATAG

>In-frame_INPP4B_ENST00000509777_chr4_143324091_-_NAA15_ENST00000296543_chr4_140255328_+_6562nt
CGCACACGCTCACACGCTCGCAAGCGAACGCAGGAAAGTCAGGCTAAAAGTGTCTGCTGCTGCTGCCGCCCCCCACTCCGCCTCCGGGAG
AGAATACAAAGAAATGGTGTTACCTGGCAAGAGGTCTTCTGTCTTTTATGAAAAATTAGACAAAGAGCCTTGAAACCAGCGAAACAATAA
TCAAAGAGCAGTTCTGTCAAAGAAAACAACATAAATCAGGTACAGAATTTCAGAGTGGGATATCAGATCTTTAGTGTGAAGATACATCTA
CATTAAACCAGGAATCACTAGAACTGACATTTGGACAAGAAAATTTGGAAAATTTTAAAACTGTGAAGGTTGATCATGGAAATTAAAGAG
GAAGGGGCATCAGAAGAAGGGCAGCACTTTCTTCCTACAGCCCAGGCCAATGATCCCGGGGACTGTCAGTTCACAAGTATCCAGAAGACT
CCAAATGAACCGCAGTTGGAATTCATCCTTGCATGCAAGGATCTCGTGGCTCCTGTCCGTGATCGTAAACTGAATACACTGGTGCAGATC
TCCGTAATCCACCCCGTGGAGCAGAGTCTGACAAGATACTCCAGCACCGAAATTGTGGAGGGAACAAGGGACCCACTGTTTTTGACTGGT
GTCACATTCCCATCTGAGTATCCCATCTATGAGGAGACCAAAATAAAACTAACAGTCTATGATGTCAAGGATAAGTCTCATGACACCAGG
TGTTATGAACATAAACAGTATAGAAATGGATTGAAATTCTGTAAACAAATACTTTCTAATCCCAAATTTGCAGAGCATGGAGAAACCTTG
GCTATGAAAGGATTAACATTGAACTGTTTGGGGAAAAAGGAAGAAGCTTATGAATTGGTTCGTAGAGGTTTGAGAAATGACTTGAAGAGT
CATGTGTGTTGGCACGTTTATGGCCTTCTTCAGAGGTCAGACAAGAAGTATGATGAAGCCATTAAGTGTTACAGAAATGCACTAAAATGG
GATAAAGACAATCTTCAAATCTTAAGGGACCTTTCCTTACTACAGATTCAAATGCGAGATCTTGAGGGTTACAGGGAAACGAGGTATCAG
TTACTTCAGCTTCGACCTGCGCAGAGAGCATCATGGATTGGTTATGCTATTGCTTACCATTTATTAGAAGATTATGAAATGGCAGCAAAG
ATTTTAGAAGAATTTAGGAAAACACAACAGACATCCCCTGACAAGGTGGATTATGAATATAGTGAACTACTCTTATATCAGAATCAAGTT
CTTCGGGAAGCAGGTCTCTATAGAGAAGCTTTGGAACATCTTTGTACCTATGAAAAGCAGATTTGTGATAAACTTGCTGTAGAAGAAACC
AAAGGGGAACTTCTGTTGCAACTATGTCGTTTGGAAGATGCTGCAGATGTTTATAGAGGATTGCAAGAGAGAAATCCTGAAAACTGGGCC
TATTACAAAGGCTTGGAAAAAGCACTCAAGCCAGCTAATATGTTAGAACGGCTAAAAATTTATGAGGAAGCCTGGACTAAATATCCCAGG
GGACTGGTGCCAAGAAGGCTGCCGTTAAACTTTTTATCTGGTGAGAAGTTTAAAGAATGTTTGGATAAGTTCCTAAGGATGAATTTCAGC
AAGGGTTGCCCACCAGTCTTCAATACTTTAAGATCATTATACAAAGACAAAGAAAAGGTGGCAATCATAGAAGAGTTAGTAGTAGGTTAT
GAAACCTCTCTAAAAAGCTGCCGGTTATTTAACCCCAATGATGATGGAAAGGAGGAACCACCAACCACATTACTTTGGGTCCAGTACTAC
TTGGCACAACATTATGACAAAATTGGTCAGCCATCTATTGCTTTGGAGTACATAAATACTGCTATTGAAAGTACACCTACATTAATAGAA
CTCTTTCTCGTGAAAGCTAAAATCTATAAGCATGCTGGAAATATTAAAGAAGCTGCAAGGTGGATGGATGAGGCCCAGGCCTTGGACACA
GCAGACAGATTTATCAACTCCAAATGTGCAAAATACATGCTAAAAGCCAACCTGATTAAAGAAGCTGAAGAAATGTGCTCAAAGTTTACA
AGGGAAGGAACATCAGCGGTAGAGAATTTGAATGAAATGCAGTGCATGTGGTTCCAAACAGAATGTGCCCAGGCTTATAAAGCAATGAAT
AAATTTGGTGAAGCACTTAAGAAATGTCATGAGATTGAGAGACATTTTATAGAAATCACTGATGACCAGTTTGACTTTCATACATACTGT
ATGAGGAAGATTACCCTTAGATCATATGTGGACTTATTAAAACTAGAAGATGTACTTCGACAGCATCCATTTTACTTCAAGGCAGCAAGA
ATTGCTATAGAGATCTATTTGAAGCTTCATGACAACCCCCTTACAGATGAGAATAAAGAACACGAAGCTGATACAGCAAACATGTCTGAC
AAAGAGCTAAAGAAGCTACGTAATAAACAAAGAAGAGCTCAAAAGAAAGCCCAGATAGAAGAAGAGAAAAAAAATGCAGAAAAAGAAAAG
CAGCAGAGAAATCAGAAAAAGAAGAAGGATGATGATGATGAGGAGATAGGAGGTCCAAAAGAAGAACTTATTCCAGAGAAACTGGCCAAG
GTTGAAACTCCATTGGAAGAAGCTATTAAATTTTTAACACCGTTGAAGAACTTGGTGAAGAACAAGATAGAGACTCATCTTTTTGCCTTT
GAGATTTACTTTAGGAAAGAAAAGTTTCTTTTGATGCTACAATCAGTAAAGAGGGCATTTGCTATTGATTCTAGTCATCCCTGGCTTCAT
GAGTGTATGATTCGTCTCTTTAATACTGCAGTGTGTGAAAGTAAAGATTTATCTGATACAGTTAGAACAGTATTAAAACAAGAAATGAAT
CGTCTTTTTGGAGCAACGAATCCAAAGAATTTTAATGAAACTTTTCTGAAAAGGAATTCTGATTCATTGCCACACAGATTATCAGCTGCC
AAAATGGTATATTACTTAGATCCTTCTAGTCAGAAGCGAGCTATAGAGTTGGCAACAACACTTGATGAATCTCTCACTAACAGAAACCTC
CAGACATGTATGGAGGTATTGGAAGCCTTGTATGATGGTAGCCTAGGAGACTGTAAAGAAGCTGCTGAAATTTATAGAGCAAATTGTCAT
AAGCTTTTCCCTTATGCTTTGGCTTTCATGCCTCCTGGATATGAAGAGGATATGAAGATCACAGTTAATGGAGATAGTTCTGCAGAAGCT
GAAGAACTGGCCAATGAAATTTGAACATCACTAAACAAGCAAATGGAATGACTTTGGACCATATCTAGTATATAATATTTTTGTCACGCA
CCTGCTGCATTGCTCTAACTTACACAGAATGAGAGGAGTAAATGTTCTTGCCTTCAAATAGTGTTTTACGTTTTTTATCCTGCTGAAAAA
GTATATATAAAATATCTAACATTACAGGATAGAGGTTCAGTTTCTTAAAAAATTAAAGCTGCTAAAATTGAGTGGTTAAAAAAGATACCT
TATCCTATTCCTCCCCACCCACCCATGTTTTTAAACTAATTTATATAAAATCTGGAGGCTGTTACAGCTAACAAAGCAGGTGTGTGGCAG
AAATATTACTTTAAATTTGTCTTGTGAGATTTTACTATATCTCAGACAGCATAAATGCTGTTTTAGCACTGGATTCTTTCACTGAGCACA
AAGAGTTGTTGGGGCTTTAGCATCTGACTGATTTTGTTACGGGGTTGATTCTGACCATAGGAAGTATGCAATGTGAATCACTATTTACAG
AGAAACCTACAACAGATGCTTGATGTTGTAGAAACTGGGACATATAGATACCAAGCAAAATTATAAGAAACCTATAAGGTGTTCAATACG
CTTGTGTTTCCAAAATTCACTGTACATGATCAGTTTGGTGTTCTTGTACCACAGTTTTTAACTGAAGGAACCAGTTGTAACAGTCTCAAT
TTTAACTAAAACTTGAAGAACTAAAACAACAATGCAAACCTTTCAGCATTGTTTGGCCAAACTTGTTAAAACTGTAATGCAAGAACCAAA
TGCACTGTGATGTGGCACCAACTAATTAGCAAGCATGAATTTTTCACCCAAGAGTGAAAAAAGGAAAATCTACCATGGCTTGAAGTTAAA
GAGCAGAACTCCTGACTACCATTCTATGACTGATCAAAAGACTAATAGTTAAAAACCTCAGCAGGCCTTGTTCACGATATGCAGAAAAAA
AAGTGCTGCAGTTTAGATACCTCTGGAATTTTTCCACAGTGTCACAGGTTTGTAATACTTGAAGCCCTACATTTCTAAGAATATATTTCT
TGCTCAGTTGTTTCAGGCAAGCCCAAGACTTTGTAATTTTTAAAGGGCCCAAGATTTTTTTTTTTTTTTTTTTTTTCAAATAACAGACCA
GCTTCTTTTTCTTGCAGTTACAGATGTAATTTCCTTTTTGTTGTCAAACATAAGGTACCAAATATGATGCAATAAATTGTTTTGAAAAAC
AGTTGTGTGAATATTTCAACTAATCTGTGTTGGGCTTCTGTGAAATACACAGGTGGAAACAGAGGTGCAAGCCAGAGGCAATGTAATATG
CTGTAAGGCTAGTGCAGATGGGAGCTTTTTAGAAGGGGCTAAGTGCTGGTGTCAGGGAAATTCCATAATGAAGTAGAATGCTGCTCCTGC
ATTAAGATTTCATTGAGGGCAAGGCTGGTGGCAGGTACTATGAATGTAATTCATAATTTAAAAGGAAAACTAAAAACTATTTTGATTTGG
GAAAATGAGCCTTAATTTGTTAAACCTATACACTGAGAACTAGCCTCAGGCTTAATATTCTCATTGCATTTGCAAGATCTGAGCAAATAA
GATTAAGTAAAACAAATCAATTGTATATATAATTGACCTTTTTGTGGAACATGTAGTTTATAGAAAGTATACTCTAAAGGGAATTTGCCG
AAGACCTTTTACTGATTGAACAGTTGTGCTACAATCAACTTTTCATAGTACATGACCTGCATTCCACATCTCAGTCTAACAGTTTAGTAG
TGATGTAAAGAGAAGTACAAACCGAACTCCAGTGCTTTGTTATGTTTTATTAACTGGCCCTGTCTCAGGAACATCTTAACAGATGGCAAA
AAAACAAAAACTTTTTTTCAACTCCTATGAGTGGCAACTGAAGTTCTTATTGTTGGGAAAGAACACTAGTCCTACCTCTGCCACTAATGA
GGTGTTTGGAGGAGGTACCAGCCATATAATAGGGGGTGTATGTGTGAATTTTGTTTAAACTCTACTGTATATTGAAATGAAATTCATTTA
TTTGTCTTGACAATGTTCAAATGATGTAGATTGTCTTAGAATGAATATTCATAAGTACTCAGAACTCTTAAGATGCAGATGCCACCCGTG
AGGAGCTAAATTCCTAATGTGTATTGTATTCCAACCCAATTTTACTGGAACTATTGAATAAATCTTTTATTTTCTTTCAGGTTTACTTGA
TAGTGGATACATTGGTGTCAGAGGACCTTGACTGGGTTCATTTTATGTCCAGACATCACCCCTGAAACACTGTACTGTACTATCTTGCTC
TGAGTAGTATCAACTGGATCGTCTCATATTTGCCTCATTCATCCTATTAATTTCAAATGATACTGTGGGGGAAAAACAGGGTTAGAAAAA
CAAGTGGAAAAAATGGAGTGATGTTGTAATCTAAACAAGTGCCTTATGTTTATTGCTAAGAACTGGTGTTACCAACCCTTTTGAGAAGAA
AGGGTCTCTTGACCTGTATTAACATAGGAAAGTAAAGTTCTTTTTGTTTTTCTTTATATTCAGCTACTCTTGTCATTTCTCGTTGAAAAA
CTAAAATCTGACTAGGTTAGTTTACTCAGCTTTAATTAGATAGTTGAGTCATATATTTTCAACATTTTTCTGTATCGTATTTATTATGCA
CAAAAATAAAGTGTGATCTCTAATAGCATGGCTAAAGGTAATGCCAATATTAGTGAATAGCTTTGCTGTGGGCTTTATCAGGCCCTTGTT
TTTCACAGTGTTGTTTGTACTCCATGGTGTATTGCTATTAGAGCTGTGAAATGAAAGCTGTGACTTTATGAAGAGATCAAAAAAAGTGTG
GTCCAGATTCAGGTAGGTTGTGGTAAGTTCAGGGAAGTCTTGTATGATTTCTAAGAATATTTCAGTTACCATGTATAGTATTTGGGAAAA
GCTGTAATGTAAAATATTGGACTTTGTTGCAAGATAGGTATATACTTGTGTCAGATAATTAAAGCCTTAAATTTTGAAATGAATCTTTGA
GATTTCAAAGAAAGACTGACCTTTCAAATAGAAGGCGGTCTTTCTATTCTAGCTAATGCCCCACTTCTTTAAGTTATAAACAAAGTTTCA
TGATACCATTCTGCTATCATCTAAACTTTGCTGAACTCTACTGCCAACCTACATTAAAAACAAAGTCCCACGAAATGGCTGTGTTACACC

>In-frame_INPP4B_ENST00000509777_chr4_143324091_-_NAA15_ENST00000398947_chr4_140255328_+_6545nt
CGCACACGCTCACACGCTCGCAAGCGAACGCAGGAAAGTCAGGCTAAAAGTGTCTGCTGCTGCTGCCGCCCCCCACTCCGCCTCCGGGAG
AGAATACAAAGAAATGGTGTTACCTGGCAAGAGGTCTTCTGTCTTTTATGAAAAATTAGACAAAGAGCCTTGAAACCAGCGAAACAATAA
TCAAAGAGCAGTTCTGTCAAAGAAAACAACATAAATCAGGTACAGAATTTCAGAGTGGGATATCAGATCTTTAGTGTGAAGATACATCTA
CATTAAACCAGGAATCACTAGAACTGACATTTGGACAAGAAAATTTGGAAAATTTTAAAACTGTGAAGGTTGATCATGGAAATTAAAGAG
GAAGGGGCATCAGAAGAAGGGCAGCACTTTCTTCCTACAGCCCAGGCCAATGATCCCGGGGACTGTCAGTTCACAAGTATCCAGAAGACT
CCAAATGAACCGCAGTTGGAATTCATCCTTGCATGCAAGGATCTCGTGGCTCCTGTCCGTGATCGTAAACTGAATACACTGGTGCAGATC
TCCGTAATCCACCCCGTGGAGCAGAGTCTGACAAGATACTCCAGCACCGAAATTGTGGAGGGAACAAGGGACCCACTGTTTTTGACTGGT
GTCACATTCCCATCTGAGTATCCCATCTATGAGGAGACCAAAATAAAACTAACAGTCTATGATGTCAAGGATAAGTCTCATGACACCAGG
TGTTATGAACATAAACAGTATAGAAATGGATTGAAATTCTGTAAACAAATACTTTCTAATCCCAAATTTGCAGAGCATGGAGAAACCTTG
GCTATGAAAGGATTAACATTGAACTGTTTGGGGAAAAAGGAAGAAGCTTATGAATTGGTTCGTAGAGGTTTGAGAAATGACTTGAAGAGT
CATGTGTGTTGGCACGTTTATGGCCTTCTTCAGAGGTCAGACAAGAAGTATGATGAAGCCATTAAGTGTTACAGAAATGCACTAAAATGG
GATAAAGACAATCTTCAAATCTTAAGGGACCTTTCCTTACTACAGATTCAAATGCGAGATCTTGAGGGTTACAGGGAAACGAGGTATCAG
TTACTTCAGCTTCGACCTGCGCAGAGAGCATCATGGATTGGTTATGCTATTGCTTACCATTTATTAGAAGATTATGAAATGGCAGCAAAG
ATTTTAGAAGAATTTAGGAAAACACAACAGACATCCCCTGACAAGGTGGATTATGAATATAGTGAACTACTCTTATATCAGAATCAAGTT
CTTCGGGAAGCAGGTCTCTATAGAGAAGCTTTGGAACATCTTTGTACCTATGAAAAGCAGATTTGTGATAAACTTGCTGTAGAAGAAACC
AAAGGGGAACTTCTGTTGCAACTATGTCGTTTGGAAGATGCTGCAGATGTTTATAGAGGATTGCAAGAGAGAAATCCTGAAAACTGGGCC
TATTACAAAGGCTTGGAAAAAGCACTCAAGCCAGCTAATATGTTAGAACGGCTAAAAATTTATGAGGAAGCCTGGACTAAATATCCCAGG
GGACTGGTGCCAAGAAGGCTGCCGTTAAACTTTTTATCTGGTGAGAAGTTTAAAGAATGTTTGGATAAGTTCCTAAGGATGAATTTCAGC
AAGGGTTGCCCACCAGTCTTCAATACTTTAAGATCATTATACAAAGACAAAGAAAAGGTGGCAATCATAGAAGAGTTAGTAGTAGGTTAT
GAAACCTCTCTAAAAAGCTGCCGGTTATTTAACCCCAATGATGATGGAAAGGAGGAACCACCAACCACATTACTTTGGGTCCAGTACTAC
TTGGCACAACATTATGACAAAATTGGTCAGCCATCTATTGCTTTGGAGTACATAAATACTGCTATTGAAAGTACACCTACATTAATAGAA
CTCTTTCTCGTGAAAGCTAAAATCTATAAGCATGCTGGAAATATTAAAGAAGCTGCAAGGTGGATGGATGAGGCCCAGGCCTTGGACACA
GCAGACAGATTTATCAACTCCAAATGTGCAAAATACATGCTAAAAGCCAACCTGATTAAAGAAGCTGAAGAAATGTGCTCAAAGTTTACA
AGGGAAGGAACATCAGCGGTAGAGAATTTGAATGAAATGCAGTGCATGTGGTTCCAAACAGAATGTGCCCAGGCTTATAAAGCAATGAAT
AAATTTGGTGAAGCACTTAAGAAATGTCATGAGATTGAGAGACATTTTATAGAAATCACTGATGACCAGTTTGACTTTCATACATACTGT
ATGAGGAAGATTACCCTTAGATCATATGTGGACTTATTAAAACTAGAAGATGTACTTCGACAGCATCCATTTTACTTCAAGGCAGCAAGA
ATTGCTATAGAGATCTATTTGAAGCTTCATGACAACCCCCTTACAGATGAGAATAAAGAACACGAAGCTGATACAGCAAACATGTCTGAC
AAAGAGCTAAAGAAGCTACGTAATAAACAAAGAAGAGCTCAAAAGAAAGCCCAGATAGAAGAAGAGAAAAAAAATGCAGAAAAAGAAAAG
CAGCAGAGAAATCAGAAAAAGAAGAAGGATGATGATGATGAGGAGATAGGAGGTCCAAAAGAAGAACTTATTCCAGAGAAACTGGCCAAG
GTTGAAACTCCATTGGAAGAAGCTATTAAATTTTTAACACCGTTGAAGAACTTGGTGAAGAACAAGATAGAGACTCATCTTTTTGCCTTT
GAGATTTACTTTAGGAAAGAAAAGTTTCTTTTGATGCTACAATCAGTAAAGAGGGCATTTGCTATTGATTCTAGTCATCCCTGGCTTCAT
GAGTGTATGATTCGTCTCTTTAATACTGTGTGTGAAAGTAAAGATTTATCTGATACAGTTAGAACAGTATTAAAACAAGAAATGAATCGT
CTTTTTGGAGCAACGAATCCAAAGAATTTTAATGAAACTTTTCTGAAAAGGAATTCTGATTCATTGCCACACAGATTATCAGCTGCCAAA
ATGGTATATTACTTAGATCCTTCTAGTCAGAAGCGAGCTATAGAGTTGGCAACAACACTTGATGAATCTCTCACTAACAGAAACCTCCAG
ACATGTATGGAGGTATTGGAAGCCTTGTATGATGGTAGCCTAGGAGACTGTAAAGAAGCTGCTGAAATTTATAGAGCAAATTGTCATAAG
CTTTTCCCTTATGCTTTGGCTTTCATGCCTCCTGGATATGAAGAGGATATGAAGATCACAGTTAATGGAGATAGTTCTGCAGAAGCTGAA
GAACTGGCCAATGAAATTTGAACATCACTAAACAAGCAAATGGAATGACTTTGGACCATATCTAGTATATAATATTTTTGTCACGCACCT
GCTGCATTGCTCTAACTTACACAGAATGAGAGGAGTAAATGTTCTTGCCTTCAAATAGTGTTTTACGTTTTTTATCCTGCTGAAAAAGTA
TATATAAAATATCTAACATTACAGGATAGAGGTTCAGTTTCTTAAAAAATTAAAGCTGCTAAAATTGAGTGGTTAAAAAAGATACCTTAT
CCTATTCCTCCCCACCCACCCATGTTTTTAAACTAATTTATATAAAATCTGGAGGCTGTTACAGCTAACAAAGCAGGTGTGTGGCAGAAA
TATTACTTTAAATTTGTCTTGTGAGATTTTACTATATCTCAGACAGCATAAATGCTGTTTTAGCACTGGATTCTTTCACTGAGCACAAAG
AGTTGTTGGGGCTTTAGCATCTGACTGATTTTGTTACGGGGTTGATTCTGACCATAGGAAGTATGCAATGTGAATCACTATTTACAGAGA
AACCTACAACAGATGCTTGATGTTGTAGAAACTGGGACATATAGATACCAAGCAAAATTATAAGAAACCTATAAGGTGTTCAATACGCTT
GTGTTTCCAAAATTCACTGTACATGATCAGTTTGGTGTTCTTGTACCACAGTTTTTAACTGAAGGAACCAGTTGTAACAGTCTCAATTTT
AACTAAAACTTGAAGAACTAAAACAACAATGCAAACCTTTCAGCATTGTTTGGCCAAACTTGTTAAAACTGTAATGCAAGAACCAAATGC
ACTGTGATGTGGCACCAACTAATTAGCAAGCATGAATTTTTCACCCAAGAGTGAAAAAAGGAAAATCTACCATGGCTTGAAGTTAAAGAG
CAGAACTCCTGACTACCATTCTATGACTGATCAAAAGACTAATAGTTAAAAACCTCAGCAGGCCTTGTTCACGATATGCAGAAAAAAAAG
TGCTGCAGTTTAGATACCTCTGGAATTTTTCCACAGTGTCACAGGTTTGTAATACTTGAAGCCCTACATTTCTAAGAATATATTTCTTGC
TCAGTTGTTTCAGGCAAGCCCAAGACTTTGTAATTTTTAAAGGGCCCAAGATTTTTTTTTTTTTTTTTTTTTTCAAATAACAGACCAGCT
TCTTTTTCTTGCAGTTACAGATGTAATTTCCTTTTTGTTGTCAAACATAAGGTACCAAATATGATGCAATAAATTGTTTTGAAAAACAGT
TGTGTGAATATTTCAACTAATCTGTGTTGGGCTTCTGTGAAATACACAGGTGGAAACAGAGGTGCAAGCCAGAGGCAATGTAATATGCTG
TAAGGCTAGTGCAGATGGGAGCTTTTTAGAAGGGGCTAAGTGCTGGTGTCAGGGAAATTCCATAATGAAGTAGAATGCTGCTCCTGCATT
AAGATTTCATTGAGGGCAAGGCTGGTGGCAGGTACTATGAATGTAATTCATAATTTAAAAGGAAAACTAAAAACTATTTTGATTTGGGAA
AATGAGCCTTAATTTGTTAAACCTATACACTGAGAACTAGCCTCAGGCTTAATATTCTCATTGCATTTGCAAGATCTGAGCAAATAAGAT
TAAGTAAAACAAATCAATTGTATATATAATTGACCTTTTTGTGGAACATGTAGTTTATAGAAAGTATACTCTAAAGGGAATTTGCCGAAG
ACCTTTTACTGATTGAACAGTTGTGCTACAATCAACTTTTCATAGTACATGACCTGCATTCCACATCTCAGTCTAACAGTTTAGTAGTGA
TGTAAAGAGAAGTACAAACCGAACTCCAGTGCTTTGTTATGTTTTATTAACTGGCCCTGTCTCAGGAACATCTTAACAGATGGCAAAAAA
ACAAAAACTTTTTTTCAACTCCTATGAGTGGCAACTGAAGTTCTTATTGTTGGGAAAGAACACTAGTCCTACCTCTGCCACTAATGAGGT
GTTTGGAGGAGGTACCAGCCATATAATAGGGGGTGTATGTGTGAATTTTGTTTAAACTCTACTGTATATTGAAATGAAATTCATTTATTT
GTCTTGACAATGTTCAAATGATGTAGATTGTCTTAGAATGAATATTCATAAGTACTCAGAACTCTTAAGATGCAGATGCCACCCGTGAGG
AGCTAAATTCCTAATGTGTATTGTATTCCAACCCAATTTTACTGGAACTATTGAATAAATCTTTTATTTTCTTTCAGGTTTACTTGATAG
TGGATACATTGGTGTCAGAGGACCTTGACTGGGTTCATTTTATGTCCAGACATCACCCCTGAAACACTGTACTGTACTATCTTGCTCTGA
GTAGTATCAACTGGATCGTCTCATATTTGCCTCATTCATCCTATTAATTTCAAATGATACTGTGGGGGAAAAACAGGGTTAGAAAAACAA
GTGGAAAAAATGGAGTGATGTTGTAATCTAAACAAGTGCCTTATGTTTATTGCTAAGAACTGGTGTTACCAACCCTTTTGAGAAGAAAGG
GTCTCTTGACCTGTATTAACATAGGAAAGTAAAGTTCTTTTTGTTTTTCTTTATATTCAGCTACTCTTGTCATTTCTCGTTGAAAAACTA
AAATCTGACTAGGTTAGTTTACTCAGCTTTAATTAGATAGTTGAGTCATATATTTTCAACATTTTTCTGTATCGTATTTATTATGCACAA
AAATAAAGTGTGATCTCTAATAGCATGGCTAAAGGTAATGCCAATATTAGTGAATAGCTTTGCTGTGGGCTTTATCAGGCCCTTGTTTTT
CACAGTGTTGTTTGTACTCCATGGTGTATTGCTATTAGAGCTGTGAAATGAAAGCTGTGACTTTATGAAGAGATCAAAAAAAGTGTGGTC
CAGATTCAGGTAGGTTGTGGTAAGTTCAGGGAAGTCTTGTATGATTTCTAAGAATATTTCAGTTACCATGTATAGTATTTGGGAAAAGCT
GTAATGTAAAATATTGGACTTTGTTGCAAGATAGGTATATACTTGTGTCAGATAATTAAAGCCTTAAATTTTGAAATGAATCTTTGAGAT
TTCAAAGAAAGACTGACCTTTCAAATAGAAGGCGGTCTTTCTATTCTAGCTAATGCCCCACTTCTTTAAGTTATAAACAAAGTTTCATGA
TACCATTCTGCTATCATCTAAACTTTGCTGAACTCTACTGCCAACCTACATTAAAAACAAAGTCCCACGAAATGGCTGTGTTACACCATA

>In-frame_INPP4B_ENST00000308502_chr4_143324091_-_NAA15_ENST00000296543_chr4_140255328_+_6337nt
AATTTCAGAGTGGGATATCAGATCTTTAGTGTGAAGATACATCTACATTAAACCAGGAATCACTAGAACTGACATTTGGACAAGAAAATT
TGGAAAATTTTAAAACTGTGAAGGTTGATCATGGAAATTAAAGAGGAAGGGGCATCAGAAGAAGGGCAGCACTTTCTTCCTACAGCCCAG
GCCAATGATCCCGGGGACTGTCAGTTCACAAGTATCCAGAAGACTCCAAATGAACCGCAGTTGGAATTCATCCTTGCATGCAAGGATCTC
GTGGCTCCTGTCCGTGATCGTAAACTGAATACACTGGTGCAGATCTCCGTAATCCACCCCGTGGAGCAGAGTCTGACAAGATACTCCAGC
ACCGAAATTGTGGAGGGAACAAGGGACCCACTGTTTTTGACTGGTGTCACATTCCCATCTGAGTATCCCATCTATGAGGAGACCAAAATA
AAACTAACAGTCTATGATGTCAAGGATAAGTCTCATGACACCAGGTGTTATGAACATAAACAGTATAGAAATGGATTGAAATTCTGTAAA
CAAATACTTTCTAATCCCAAATTTGCAGAGCATGGAGAAACCTTGGCTATGAAAGGATTAACATTGAACTGTTTGGGGAAAAAGGAAGAA
GCTTATGAATTGGTTCGTAGAGGTTTGAGAAATGACTTGAAGAGTCATGTGTGTTGGCACGTTTATGGCCTTCTTCAGAGGTCAGACAAG
AAGTATGATGAAGCCATTAAGTGTTACAGAAATGCACTAAAATGGGATAAAGACAATCTTCAAATCTTAAGGGACCTTTCCTTACTACAG
ATTCAAATGCGAGATCTTGAGGGTTACAGGGAAACGAGGTATCAGTTACTTCAGCTTCGACCTGCGCAGAGAGCATCATGGATTGGTTAT
GCTATTGCTTACCATTTATTAGAAGATTATGAAATGGCAGCAAAGATTTTAGAAGAATTTAGGAAAACACAACAGACATCCCCTGACAAG
GTGGATTATGAATATAGTGAACTACTCTTATATCAGAATCAAGTTCTTCGGGAAGCAGGTCTCTATAGAGAAGCTTTGGAACATCTTTGT
ACCTATGAAAAGCAGATTTGTGATAAACTTGCTGTAGAAGAAACCAAAGGGGAACTTCTGTTGCAACTATGTCGTTTGGAAGATGCTGCA
GATGTTTATAGAGGATTGCAAGAGAGAAATCCTGAAAACTGGGCCTATTACAAAGGCTTGGAAAAAGCACTCAAGCCAGCTAATATGTTA
GAACGGCTAAAAATTTATGAGGAAGCCTGGACTAAATATCCCAGGGGACTGGTGCCAAGAAGGCTGCCGTTAAACTTTTTATCTGGTGAG
AAGTTTAAAGAATGTTTGGATAAGTTCCTAAGGATGAATTTCAGCAAGGGTTGCCCACCAGTCTTCAATACTTTAAGATCATTATACAAA
GACAAAGAAAAGGTGGCAATCATAGAAGAGTTAGTAGTAGGTTATGAAACCTCTCTAAAAAGCTGCCGGTTATTTAACCCCAATGATGAT
GGAAAGGAGGAACCACCAACCACATTACTTTGGGTCCAGTACTACTTGGCACAACATTATGACAAAATTGGTCAGCCATCTATTGCTTTG
GAGTACATAAATACTGCTATTGAAAGTACACCTACATTAATAGAACTCTTTCTCGTGAAAGCTAAAATCTATAAGCATGCTGGAAATATT
AAAGAAGCTGCAAGGTGGATGGATGAGGCCCAGGCCTTGGACACAGCAGACAGATTTATCAACTCCAAATGTGCAAAATACATGCTAAAA
GCCAACCTGATTAAAGAAGCTGAAGAAATGTGCTCAAAGTTTACAAGGGAAGGAACATCAGCGGTAGAGAATTTGAATGAAATGCAGTGC
ATGTGGTTCCAAACAGAATGTGCCCAGGCTTATAAAGCAATGAATAAATTTGGTGAAGCACTTAAGAAATGTCATGAGATTGAGAGACAT
TTTATAGAAATCACTGATGACCAGTTTGACTTTCATACATACTGTATGAGGAAGATTACCCTTAGATCATATGTGGACTTATTAAAACTA
GAAGATGTACTTCGACAGCATCCATTTTACTTCAAGGCAGCAAGAATTGCTATAGAGATCTATTTGAAGCTTCATGACAACCCCCTTACA
GATGAGAATAAAGAACACGAAGCTGATACAGCAAACATGTCTGACAAAGAGCTAAAGAAGCTACGTAATAAACAAAGAAGAGCTCAAAAG
AAAGCCCAGATAGAAGAAGAGAAAAAAAATGCAGAAAAAGAAAAGCAGCAGAGAAATCAGAAAAAGAAGAAGGATGATGATGATGAGGAG
ATAGGAGGTCCAAAAGAAGAACTTATTCCAGAGAAACTGGCCAAGGTTGAAACTCCATTGGAAGAAGCTATTAAATTTTTAACACCGTTG
AAGAACTTGGTGAAGAACAAGATAGAGACTCATCTTTTTGCCTTTGAGATTTACTTTAGGAAAGAAAAGTTTCTTTTGATGCTACAATCA
GTAAAGAGGGCATTTGCTATTGATTCTAGTCATCCCTGGCTTCATGAGTGTATGATTCGTCTCTTTAATACTGCAGTGTGTGAAAGTAAA
GATTTATCTGATACAGTTAGAACAGTATTAAAACAAGAAATGAATCGTCTTTTTGGAGCAACGAATCCAAAGAATTTTAATGAAACTTTT
CTGAAAAGGAATTCTGATTCATTGCCACACAGATTATCAGCTGCCAAAATGGTATATTACTTAGATCCTTCTAGTCAGAAGCGAGCTATA
GAGTTGGCAACAACACTTGATGAATCTCTCACTAACAGAAACCTCCAGACATGTATGGAGGTATTGGAAGCCTTGTATGATGGTAGCCTA
GGAGACTGTAAAGAAGCTGCTGAAATTTATAGAGCAAATTGTCATAAGCTTTTCCCTTATGCTTTGGCTTTCATGCCTCCTGGATATGAA
GAGGATATGAAGATCACAGTTAATGGAGATAGTTCTGCAGAAGCTGAAGAACTGGCCAATGAAATTTGAACATCACTAAACAAGCAAATG
GAATGACTTTGGACCATATCTAGTATATAATATTTTTGTCACGCACCTGCTGCATTGCTCTAACTTACACAGAATGAGAGGAGTAAATGT
TCTTGCCTTCAAATAGTGTTTTACGTTTTTTATCCTGCTGAAAAAGTATATATAAAATATCTAACATTACAGGATAGAGGTTCAGTTTCT
TAAAAAATTAAAGCTGCTAAAATTGAGTGGTTAAAAAAGATACCTTATCCTATTCCTCCCCACCCACCCATGTTTTTAAACTAATTTATA
TAAAATCTGGAGGCTGTTACAGCTAACAAAGCAGGTGTGTGGCAGAAATATTACTTTAAATTTGTCTTGTGAGATTTTACTATATCTCAG
ACAGCATAAATGCTGTTTTAGCACTGGATTCTTTCACTGAGCACAAAGAGTTGTTGGGGCTTTAGCATCTGACTGATTTTGTTACGGGGT
TGATTCTGACCATAGGAAGTATGCAATGTGAATCACTATTTACAGAGAAACCTACAACAGATGCTTGATGTTGTAGAAACTGGGACATAT
AGATACCAAGCAAAATTATAAGAAACCTATAAGGTGTTCAATACGCTTGTGTTTCCAAAATTCACTGTACATGATCAGTTTGGTGTTCTT
GTACCACAGTTTTTAACTGAAGGAACCAGTTGTAACAGTCTCAATTTTAACTAAAACTTGAAGAACTAAAACAACAATGCAAACCTTTCA
GCATTGTTTGGCCAAACTTGTTAAAACTGTAATGCAAGAACCAAATGCACTGTGATGTGGCACCAACTAATTAGCAAGCATGAATTTTTC
ACCCAAGAGTGAAAAAAGGAAAATCTACCATGGCTTGAAGTTAAAGAGCAGAACTCCTGACTACCATTCTATGACTGATCAAAAGACTAA
TAGTTAAAAACCTCAGCAGGCCTTGTTCACGATATGCAGAAAAAAAAGTGCTGCAGTTTAGATACCTCTGGAATTTTTCCACAGTGTCAC
AGGTTTGTAATACTTGAAGCCCTACATTTCTAAGAATATATTTCTTGCTCAGTTGTTTCAGGCAAGCCCAAGACTTTGTAATTTTTAAAG
GGCCCAAGATTTTTTTTTTTTTTTTTTTTTTCAAATAACAGACCAGCTTCTTTTTCTTGCAGTTACAGATGTAATTTCCTTTTTGTTGTC
AAACATAAGGTACCAAATATGATGCAATAAATTGTTTTGAAAAACAGTTGTGTGAATATTTCAACTAATCTGTGTTGGGCTTCTGTGAAA
TACACAGGTGGAAACAGAGGTGCAAGCCAGAGGCAATGTAATATGCTGTAAGGCTAGTGCAGATGGGAGCTTTTTAGAAGGGGCTAAGTG
CTGGTGTCAGGGAAATTCCATAATGAAGTAGAATGCTGCTCCTGCATTAAGATTTCATTGAGGGCAAGGCTGGTGGCAGGTACTATGAAT
GTAATTCATAATTTAAAAGGAAAACTAAAAACTATTTTGATTTGGGAAAATGAGCCTTAATTTGTTAAACCTATACACTGAGAACTAGCC
TCAGGCTTAATATTCTCATTGCATTTGCAAGATCTGAGCAAATAAGATTAAGTAAAACAAATCAATTGTATATATAATTGACCTTTTTGT
GGAACATGTAGTTTATAGAAAGTATACTCTAAAGGGAATTTGCCGAAGACCTTTTACTGATTGAACAGTTGTGCTACAATCAACTTTTCA
TAGTACATGACCTGCATTCCACATCTCAGTCTAACAGTTTAGTAGTGATGTAAAGAGAAGTACAAACCGAACTCCAGTGCTTTGTTATGT
TTTATTAACTGGCCCTGTCTCAGGAACATCTTAACAGATGGCAAAAAAACAAAAACTTTTTTTCAACTCCTATGAGTGGCAACTGAAGTT
CTTATTGTTGGGAAAGAACACTAGTCCTACCTCTGCCACTAATGAGGTGTTTGGAGGAGGTACCAGCCATATAATAGGGGGTGTATGTGT
GAATTTTGTTTAAACTCTACTGTATATTGAAATGAAATTCATTTATTTGTCTTGACAATGTTCAAATGATGTAGATTGTCTTAGAATGAA
TATTCATAAGTACTCAGAACTCTTAAGATGCAGATGCCACCCGTGAGGAGCTAAATTCCTAATGTGTATTGTATTCCAACCCAATTTTAC
TGGAACTATTGAATAAATCTTTTATTTTCTTTCAGGTTTACTTGATAGTGGATACATTGGTGTCAGAGGACCTTGACTGGGTTCATTTTA
TGTCCAGACATCACCCCTGAAACACTGTACTGTACTATCTTGCTCTGAGTAGTATCAACTGGATCGTCTCATATTTGCCTCATTCATCCT
ATTAATTTCAAATGATACTGTGGGGGAAAAACAGGGTTAGAAAAACAAGTGGAAAAAATGGAGTGATGTTGTAATCTAAACAAGTGCCTT
ATGTTTATTGCTAAGAACTGGTGTTACCAACCCTTTTGAGAAGAAAGGGTCTCTTGACCTGTATTAACATAGGAAAGTAAAGTTCTTTTT
GTTTTTCTTTATATTCAGCTACTCTTGTCATTTCTCGTTGAAAAACTAAAATCTGACTAGGTTAGTTTACTCAGCTTTAATTAGATAGTT
GAGTCATATATTTTCAACATTTTTCTGTATCGTATTTATTATGCACAAAAATAAAGTGTGATCTCTAATAGCATGGCTAAAGGTAATGCC
AATATTAGTGAATAGCTTTGCTGTGGGCTTTATCAGGCCCTTGTTTTTCACAGTGTTGTTTGTACTCCATGGTGTATTGCTATTAGAGCT
GTGAAATGAAAGCTGTGACTTTATGAAGAGATCAAAAAAAGTGTGGTCCAGATTCAGGTAGGTTGTGGTAAGTTCAGGGAAGTCTTGTAT
GATTTCTAAGAATATTTCAGTTACCATGTATAGTATTTGGGAAAAGCTGTAATGTAAAATATTGGACTTTGTTGCAAGATAGGTATATAC
TTGTGTCAGATAATTAAAGCCTTAAATTTTGAAATGAATCTTTGAGATTTCAAAGAAAGACTGACCTTTCAAATAGAAGGCGGTCTTTCT
ATTCTAGCTAATGCCCCACTTCTTTAAGTTATAAACAAAGTTTCATGATACCATTCTGCTATCATCTAAACTTTGCTGAACTCTACTGCC
AACCTACATTAAAAACAAAGTCCCACGAAATGGCTGTGTTACACCATAGTGAGCAGAAACTTAAATTTTGTTCTAATTTTGATGGTTGAA

>In-frame_INPP4B_ENST00000308502_chr4_143324091_-_NAA15_ENST00000398947_chr4_140255328_+_6320nt
AATTTCAGAGTGGGATATCAGATCTTTAGTGTGAAGATACATCTACATTAAACCAGGAATCACTAGAACTGACATTTGGACAAGAAAATT
TGGAAAATTTTAAAACTGTGAAGGTTGATCATGGAAATTAAAGAGGAAGGGGCATCAGAAGAAGGGCAGCACTTTCTTCCTACAGCCCAG
GCCAATGATCCCGGGGACTGTCAGTTCACAAGTATCCAGAAGACTCCAAATGAACCGCAGTTGGAATTCATCCTTGCATGCAAGGATCTC
GTGGCTCCTGTCCGTGATCGTAAACTGAATACACTGGTGCAGATCTCCGTAATCCACCCCGTGGAGCAGAGTCTGACAAGATACTCCAGC
ACCGAAATTGTGGAGGGAACAAGGGACCCACTGTTTTTGACTGGTGTCACATTCCCATCTGAGTATCCCATCTATGAGGAGACCAAAATA
AAACTAACAGTCTATGATGTCAAGGATAAGTCTCATGACACCAGGTGTTATGAACATAAACAGTATAGAAATGGATTGAAATTCTGTAAA
CAAATACTTTCTAATCCCAAATTTGCAGAGCATGGAGAAACCTTGGCTATGAAAGGATTAACATTGAACTGTTTGGGGAAAAAGGAAGAA
GCTTATGAATTGGTTCGTAGAGGTTTGAGAAATGACTTGAAGAGTCATGTGTGTTGGCACGTTTATGGCCTTCTTCAGAGGTCAGACAAG
AAGTATGATGAAGCCATTAAGTGTTACAGAAATGCACTAAAATGGGATAAAGACAATCTTCAAATCTTAAGGGACCTTTCCTTACTACAG
ATTCAAATGCGAGATCTTGAGGGTTACAGGGAAACGAGGTATCAGTTACTTCAGCTTCGACCTGCGCAGAGAGCATCATGGATTGGTTAT
GCTATTGCTTACCATTTATTAGAAGATTATGAAATGGCAGCAAAGATTTTAGAAGAATTTAGGAAAACACAACAGACATCCCCTGACAAG
GTGGATTATGAATATAGTGAACTACTCTTATATCAGAATCAAGTTCTTCGGGAAGCAGGTCTCTATAGAGAAGCTTTGGAACATCTTTGT
ACCTATGAAAAGCAGATTTGTGATAAACTTGCTGTAGAAGAAACCAAAGGGGAACTTCTGTTGCAACTATGTCGTTTGGAAGATGCTGCA
GATGTTTATAGAGGATTGCAAGAGAGAAATCCTGAAAACTGGGCCTATTACAAAGGCTTGGAAAAAGCACTCAAGCCAGCTAATATGTTA
GAACGGCTAAAAATTTATGAGGAAGCCTGGACTAAATATCCCAGGGGACTGGTGCCAAGAAGGCTGCCGTTAAACTTTTTATCTGGTGAG
AAGTTTAAAGAATGTTTGGATAAGTTCCTAAGGATGAATTTCAGCAAGGGTTGCCCACCAGTCTTCAATACTTTAAGATCATTATACAAA
GACAAAGAAAAGGTGGCAATCATAGAAGAGTTAGTAGTAGGTTATGAAACCTCTCTAAAAAGCTGCCGGTTATTTAACCCCAATGATGAT
GGAAAGGAGGAACCACCAACCACATTACTTTGGGTCCAGTACTACTTGGCACAACATTATGACAAAATTGGTCAGCCATCTATTGCTTTG
GAGTACATAAATACTGCTATTGAAAGTACACCTACATTAATAGAACTCTTTCTCGTGAAAGCTAAAATCTATAAGCATGCTGGAAATATT
AAAGAAGCTGCAAGGTGGATGGATGAGGCCCAGGCCTTGGACACAGCAGACAGATTTATCAACTCCAAATGTGCAAAATACATGCTAAAA
GCCAACCTGATTAAAGAAGCTGAAGAAATGTGCTCAAAGTTTACAAGGGAAGGAACATCAGCGGTAGAGAATTTGAATGAAATGCAGTGC
ATGTGGTTCCAAACAGAATGTGCCCAGGCTTATAAAGCAATGAATAAATTTGGTGAAGCACTTAAGAAATGTCATGAGATTGAGAGACAT
TTTATAGAAATCACTGATGACCAGTTTGACTTTCATACATACTGTATGAGGAAGATTACCCTTAGATCATATGTGGACTTATTAAAACTA
GAAGATGTACTTCGACAGCATCCATTTTACTTCAAGGCAGCAAGAATTGCTATAGAGATCTATTTGAAGCTTCATGACAACCCCCTTACA
GATGAGAATAAAGAACACGAAGCTGATACAGCAAACATGTCTGACAAAGAGCTAAAGAAGCTACGTAATAAACAAAGAAGAGCTCAAAAG
AAAGCCCAGATAGAAGAAGAGAAAAAAAATGCAGAAAAAGAAAAGCAGCAGAGAAATCAGAAAAAGAAGAAGGATGATGATGATGAGGAG
ATAGGAGGTCCAAAAGAAGAACTTATTCCAGAGAAACTGGCCAAGGTTGAAACTCCATTGGAAGAAGCTATTAAATTTTTAACACCGTTG
AAGAACTTGGTGAAGAACAAGATAGAGACTCATCTTTTTGCCTTTGAGATTTACTTTAGGAAAGAAAAGTTTCTTTTGATGCTACAATCA
GTAAAGAGGGCATTTGCTATTGATTCTAGTCATCCCTGGCTTCATGAGTGTATGATTCGTCTCTTTAATACTGTGTGTGAAAGTAAAGAT
TTATCTGATACAGTTAGAACAGTATTAAAACAAGAAATGAATCGTCTTTTTGGAGCAACGAATCCAAAGAATTTTAATGAAACTTTTCTG
AAAAGGAATTCTGATTCATTGCCACACAGATTATCAGCTGCCAAAATGGTATATTACTTAGATCCTTCTAGTCAGAAGCGAGCTATAGAG
TTGGCAACAACACTTGATGAATCTCTCACTAACAGAAACCTCCAGACATGTATGGAGGTATTGGAAGCCTTGTATGATGGTAGCCTAGGA
GACTGTAAAGAAGCTGCTGAAATTTATAGAGCAAATTGTCATAAGCTTTTCCCTTATGCTTTGGCTTTCATGCCTCCTGGATATGAAGAG
GATATGAAGATCACAGTTAATGGAGATAGTTCTGCAGAAGCTGAAGAACTGGCCAATGAAATTTGAACATCACTAAACAAGCAAATGGAA
TGACTTTGGACCATATCTAGTATATAATATTTTTGTCACGCACCTGCTGCATTGCTCTAACTTACACAGAATGAGAGGAGTAAATGTTCT
TGCCTTCAAATAGTGTTTTACGTTTTTTATCCTGCTGAAAAAGTATATATAAAATATCTAACATTACAGGATAGAGGTTCAGTTTCTTAA
AAAATTAAAGCTGCTAAAATTGAGTGGTTAAAAAAGATACCTTATCCTATTCCTCCCCACCCACCCATGTTTTTAAACTAATTTATATAA
AATCTGGAGGCTGTTACAGCTAACAAAGCAGGTGTGTGGCAGAAATATTACTTTAAATTTGTCTTGTGAGATTTTACTATATCTCAGACA
GCATAAATGCTGTTTTAGCACTGGATTCTTTCACTGAGCACAAAGAGTTGTTGGGGCTTTAGCATCTGACTGATTTTGTTACGGGGTTGA
TTCTGACCATAGGAAGTATGCAATGTGAATCACTATTTACAGAGAAACCTACAACAGATGCTTGATGTTGTAGAAACTGGGACATATAGA
TACCAAGCAAAATTATAAGAAACCTATAAGGTGTTCAATACGCTTGTGTTTCCAAAATTCACTGTACATGATCAGTTTGGTGTTCTTGTA
CCACAGTTTTTAACTGAAGGAACCAGTTGTAACAGTCTCAATTTTAACTAAAACTTGAAGAACTAAAACAACAATGCAAACCTTTCAGCA
TTGTTTGGCCAAACTTGTTAAAACTGTAATGCAAGAACCAAATGCACTGTGATGTGGCACCAACTAATTAGCAAGCATGAATTTTTCACC
CAAGAGTGAAAAAAGGAAAATCTACCATGGCTTGAAGTTAAAGAGCAGAACTCCTGACTACCATTCTATGACTGATCAAAAGACTAATAG
TTAAAAACCTCAGCAGGCCTTGTTCACGATATGCAGAAAAAAAAGTGCTGCAGTTTAGATACCTCTGGAATTTTTCCACAGTGTCACAGG
TTTGTAATACTTGAAGCCCTACATTTCTAAGAATATATTTCTTGCTCAGTTGTTTCAGGCAAGCCCAAGACTTTGTAATTTTTAAAGGGC
CCAAGATTTTTTTTTTTTTTTTTTTTTTCAAATAACAGACCAGCTTCTTTTTCTTGCAGTTACAGATGTAATTTCCTTTTTGTTGTCAAA
CATAAGGTACCAAATATGATGCAATAAATTGTTTTGAAAAACAGTTGTGTGAATATTTCAACTAATCTGTGTTGGGCTTCTGTGAAATAC
ACAGGTGGAAACAGAGGTGCAAGCCAGAGGCAATGTAATATGCTGTAAGGCTAGTGCAGATGGGAGCTTTTTAGAAGGGGCTAAGTGCTG
GTGTCAGGGAAATTCCATAATGAAGTAGAATGCTGCTCCTGCATTAAGATTTCATTGAGGGCAAGGCTGGTGGCAGGTACTATGAATGTA
ATTCATAATTTAAAAGGAAAACTAAAAACTATTTTGATTTGGGAAAATGAGCCTTAATTTGTTAAACCTATACACTGAGAACTAGCCTCA
GGCTTAATATTCTCATTGCATTTGCAAGATCTGAGCAAATAAGATTAAGTAAAACAAATCAATTGTATATATAATTGACCTTTTTGTGGA
ACATGTAGTTTATAGAAAGTATACTCTAAAGGGAATTTGCCGAAGACCTTTTACTGATTGAACAGTTGTGCTACAATCAACTTTTCATAG
TACATGACCTGCATTCCACATCTCAGTCTAACAGTTTAGTAGTGATGTAAAGAGAAGTACAAACCGAACTCCAGTGCTTTGTTATGTTTT
ATTAACTGGCCCTGTCTCAGGAACATCTTAACAGATGGCAAAAAAACAAAAACTTTTTTTCAACTCCTATGAGTGGCAACTGAAGTTCTT
ATTGTTGGGAAAGAACACTAGTCCTACCTCTGCCACTAATGAGGTGTTTGGAGGAGGTACCAGCCATATAATAGGGGGTGTATGTGTGAA
TTTTGTTTAAACTCTACTGTATATTGAAATGAAATTCATTTATTTGTCTTGACAATGTTCAAATGATGTAGATTGTCTTAGAATGAATAT
TCATAAGTACTCAGAACTCTTAAGATGCAGATGCCACCCGTGAGGAGCTAAATTCCTAATGTGTATTGTATTCCAACCCAATTTTACTGG
AACTATTGAATAAATCTTTTATTTTCTTTCAGGTTTACTTGATAGTGGATACATTGGTGTCAGAGGACCTTGACTGGGTTCATTTTATGT
CCAGACATCACCCCTGAAACACTGTACTGTACTATCTTGCTCTGAGTAGTATCAACTGGATCGTCTCATATTTGCCTCATTCATCCTATT
AATTTCAAATGATACTGTGGGGGAAAAACAGGGTTAGAAAAACAAGTGGAAAAAATGGAGTGATGTTGTAATCTAAACAAGTGCCTTATG
TTTATTGCTAAGAACTGGTGTTACCAACCCTTTTGAGAAGAAAGGGTCTCTTGACCTGTATTAACATAGGAAAGTAAAGTTCTTTTTGTT
TTTCTTTATATTCAGCTACTCTTGTCATTTCTCGTTGAAAAACTAAAATCTGACTAGGTTAGTTTACTCAGCTTTAATTAGATAGTTGAG
TCATATATTTTCAACATTTTTCTGTATCGTATTTATTATGCACAAAAATAAAGTGTGATCTCTAATAGCATGGCTAAAGGTAATGCCAAT
ATTAGTGAATAGCTTTGCTGTGGGCTTTATCAGGCCCTTGTTTTTCACAGTGTTGTTTGTACTCCATGGTGTATTGCTATTAGAGCTGTG
AAATGAAAGCTGTGACTTTATGAAGAGATCAAAAAAAGTGTGGTCCAGATTCAGGTAGGTTGTGGTAAGTTCAGGGAAGTCTTGTATGAT
TTCTAAGAATATTTCAGTTACCATGTATAGTATTTGGGAAAAGCTGTAATGTAAAATATTGGACTTTGTTGCAAGATAGGTATATACTTG
TGTCAGATAATTAAAGCCTTAAATTTTGAAATGAATCTTTGAGATTTCAAAGAAAGACTGACCTTTCAAATAGAAGGCGGTCTTTCTATT
CTAGCTAATGCCCCACTTCTTTAAGTTATAAACAAAGTTTCATGATACCATTCTGCTATCATCTAAACTTTGCTGAACTCTACTGCCAAC
CTACATTAAAAACAAAGTCCCACGAAATGGCTGTGTTACACCATAGTGAGCAGAAACTTAAATTTTGTTCTAATTTTGATGGTTGAAAAA

>In-frame_INPP4B_ENST00000506217_chr4_143324091_-_NAA15_ENST00000296543_chr4_140255328_+_6217nt
ATGGAAATTAAAGAGGAAGGGGCATCAGAAGAAGGGCAGCACTTTCTTCCTACAGCCCAGGCCAATGATCCCGGGGACTGTCAGTTCACA
AGTATCCAGAAGACTCCAAATGAACCGCAGTTGGAATTCATCCTTGCATGCAAGGATCTCGTGGCTCCTGTCCGTGATCGTAAACTGAAT
ACACTGGTGCAGATCTCCGTAATCCACCCCGTGGAGCAGAGTCTGACAAGATACTCCAGCACCGAAATTGTGGAGGGAACAAGGGACCCA
CTGTTTTTGACTGGTGTCACATTCCCATCTGAGTATCCCATCTATGAGGAGACCAAAATAAAACTAACAGTCTATGATGTCAAGGATAAG
TCTCATGACACCAGGTGTTATGAACATAAACAGTATAGAAATGGATTGAAATTCTGTAAACAAATACTTTCTAATCCCAAATTTGCAGAG
CATGGAGAAACCTTGGCTATGAAAGGATTAACATTGAACTGTTTGGGGAAAAAGGAAGAAGCTTATGAATTGGTTCGTAGAGGTTTGAGA
AATGACTTGAAGAGTCATGTGTGTTGGCACGTTTATGGCCTTCTTCAGAGGTCAGACAAGAAGTATGATGAAGCCATTAAGTGTTACAGA
AATGCACTAAAATGGGATAAAGACAATCTTCAAATCTTAAGGGACCTTTCCTTACTACAGATTCAAATGCGAGATCTTGAGGGTTACAGG
GAAACGAGGTATCAGTTACTTCAGCTTCGACCTGCGCAGAGAGCATCATGGATTGGTTATGCTATTGCTTACCATTTATTAGAAGATTAT
GAAATGGCAGCAAAGATTTTAGAAGAATTTAGGAAAACACAACAGACATCCCCTGACAAGGTGGATTATGAATATAGTGAACTACTCTTA
TATCAGAATCAAGTTCTTCGGGAAGCAGGTCTCTATAGAGAAGCTTTGGAACATCTTTGTACCTATGAAAAGCAGATTTGTGATAAACTT
GCTGTAGAAGAAACCAAAGGGGAACTTCTGTTGCAACTATGTCGTTTGGAAGATGCTGCAGATGTTTATAGAGGATTGCAAGAGAGAAAT
CCTGAAAACTGGGCCTATTACAAAGGCTTGGAAAAAGCACTCAAGCCAGCTAATATGTTAGAACGGCTAAAAATTTATGAGGAAGCCTGG
ACTAAATATCCCAGGGGACTGGTGCCAAGAAGGCTGCCGTTAAACTTTTTATCTGGTGAGAAGTTTAAAGAATGTTTGGATAAGTTCCTA
AGGATGAATTTCAGCAAGGGTTGCCCACCAGTCTTCAATACTTTAAGATCATTATACAAAGACAAAGAAAAGGTGGCAATCATAGAAGAG
TTAGTAGTAGGTTATGAAACCTCTCTAAAAAGCTGCCGGTTATTTAACCCCAATGATGATGGAAAGGAGGAACCACCAACCACATTACTT
TGGGTCCAGTACTACTTGGCACAACATTATGACAAAATTGGTCAGCCATCTATTGCTTTGGAGTACATAAATACTGCTATTGAAAGTACA
CCTACATTAATAGAACTCTTTCTCGTGAAAGCTAAAATCTATAAGCATGCTGGAAATATTAAAGAAGCTGCAAGGTGGATGGATGAGGCC
CAGGCCTTGGACACAGCAGACAGATTTATCAACTCCAAATGTGCAAAATACATGCTAAAAGCCAACCTGATTAAAGAAGCTGAAGAAATG
TGCTCAAAGTTTACAAGGGAAGGAACATCAGCGGTAGAGAATTTGAATGAAATGCAGTGCATGTGGTTCCAAACAGAATGTGCCCAGGCT
TATAAAGCAATGAATAAATTTGGTGAAGCACTTAAGAAATGTCATGAGATTGAGAGACATTTTATAGAAATCACTGATGACCAGTTTGAC
TTTCATACATACTGTATGAGGAAGATTACCCTTAGATCATATGTGGACTTATTAAAACTAGAAGATGTACTTCGACAGCATCCATTTTAC
TTCAAGGCAGCAAGAATTGCTATAGAGATCTATTTGAAGCTTCATGACAACCCCCTTACAGATGAGAATAAAGAACACGAAGCTGATACA
GCAAACATGTCTGACAAAGAGCTAAAGAAGCTACGTAATAAACAAAGAAGAGCTCAAAAGAAAGCCCAGATAGAAGAAGAGAAAAAAAAT
GCAGAAAAAGAAAAGCAGCAGAGAAATCAGAAAAAGAAGAAGGATGATGATGATGAGGAGATAGGAGGTCCAAAAGAAGAACTTATTCCA
GAGAAACTGGCCAAGGTTGAAACTCCATTGGAAGAAGCTATTAAATTTTTAACACCGTTGAAGAACTTGGTGAAGAACAAGATAGAGACT
CATCTTTTTGCCTTTGAGATTTACTTTAGGAAAGAAAAGTTTCTTTTGATGCTACAATCAGTAAAGAGGGCATTTGCTATTGATTCTAGT
CATCCCTGGCTTCATGAGTGTATGATTCGTCTCTTTAATACTGCAGTGTGTGAAAGTAAAGATTTATCTGATACAGTTAGAACAGTATTA
AAACAAGAAATGAATCGTCTTTTTGGAGCAACGAATCCAAAGAATTTTAATGAAACTTTTCTGAAAAGGAATTCTGATTCATTGCCACAC
AGATTATCAGCTGCCAAAATGGTATATTACTTAGATCCTTCTAGTCAGAAGCGAGCTATAGAGTTGGCAACAACACTTGATGAATCTCTC
ACTAACAGAAACCTCCAGACATGTATGGAGGTATTGGAAGCCTTGTATGATGGTAGCCTAGGAGACTGTAAAGAAGCTGCTGAAATTTAT
AGAGCAAATTGTCATAAGCTTTTCCCTTATGCTTTGGCTTTCATGCCTCCTGGATATGAAGAGGATATGAAGATCACAGTTAATGGAGAT
AGTTCTGCAGAAGCTGAAGAACTGGCCAATGAAATTTGAACATCACTAAACAAGCAAATGGAATGACTTTGGACCATATCTAGTATATAA
TATTTTTGTCACGCACCTGCTGCATTGCTCTAACTTACACAGAATGAGAGGAGTAAATGTTCTTGCCTTCAAATAGTGTTTTACGTTTTT
TATCCTGCTGAAAAAGTATATATAAAATATCTAACATTACAGGATAGAGGTTCAGTTTCTTAAAAAATTAAAGCTGCTAAAATTGAGTGG
TTAAAAAAGATACCTTATCCTATTCCTCCCCACCCACCCATGTTTTTAAACTAATTTATATAAAATCTGGAGGCTGTTACAGCTAACAAA
GCAGGTGTGTGGCAGAAATATTACTTTAAATTTGTCTTGTGAGATTTTACTATATCTCAGACAGCATAAATGCTGTTTTAGCACTGGATT
CTTTCACTGAGCACAAAGAGTTGTTGGGGCTTTAGCATCTGACTGATTTTGTTACGGGGTTGATTCTGACCATAGGAAGTATGCAATGTG
AATCACTATTTACAGAGAAACCTACAACAGATGCTTGATGTTGTAGAAACTGGGACATATAGATACCAAGCAAAATTATAAGAAACCTAT
AAGGTGTTCAATACGCTTGTGTTTCCAAAATTCACTGTACATGATCAGTTTGGTGTTCTTGTACCACAGTTTTTAACTGAAGGAACCAGT
TGTAACAGTCTCAATTTTAACTAAAACTTGAAGAACTAAAACAACAATGCAAACCTTTCAGCATTGTTTGGCCAAACTTGTTAAAACTGT
AATGCAAGAACCAAATGCACTGTGATGTGGCACCAACTAATTAGCAAGCATGAATTTTTCACCCAAGAGTGAAAAAAGGAAAATCTACCA
TGGCTTGAAGTTAAAGAGCAGAACTCCTGACTACCATTCTATGACTGATCAAAAGACTAATAGTTAAAAACCTCAGCAGGCCTTGTTCAC
GATATGCAGAAAAAAAAGTGCTGCAGTTTAGATACCTCTGGAATTTTTCCACAGTGTCACAGGTTTGTAATACTTGAAGCCCTACATTTC
TAAGAATATATTTCTTGCTCAGTTGTTTCAGGCAAGCCCAAGACTTTGTAATTTTTAAAGGGCCCAAGATTTTTTTTTTTTTTTTTTTTT
TCAAATAACAGACCAGCTTCTTTTTCTTGCAGTTACAGATGTAATTTCCTTTTTGTTGTCAAACATAAGGTACCAAATATGATGCAATAA
ATTGTTTTGAAAAACAGTTGTGTGAATATTTCAACTAATCTGTGTTGGGCTTCTGTGAAATACACAGGTGGAAACAGAGGTGCAAGCCAG
AGGCAATGTAATATGCTGTAAGGCTAGTGCAGATGGGAGCTTTTTAGAAGGGGCTAAGTGCTGGTGTCAGGGAAATTCCATAATGAAGTA
GAATGCTGCTCCTGCATTAAGATTTCATTGAGGGCAAGGCTGGTGGCAGGTACTATGAATGTAATTCATAATTTAAAAGGAAAACTAAAA
ACTATTTTGATTTGGGAAAATGAGCCTTAATTTGTTAAACCTATACACTGAGAACTAGCCTCAGGCTTAATATTCTCATTGCATTTGCAA
GATCTGAGCAAATAAGATTAAGTAAAACAAATCAATTGTATATATAATTGACCTTTTTGTGGAACATGTAGTTTATAGAAAGTATACTCT
AAAGGGAATTTGCCGAAGACCTTTTACTGATTGAACAGTTGTGCTACAATCAACTTTTCATAGTACATGACCTGCATTCCACATCTCAGT
CTAACAGTTTAGTAGTGATGTAAAGAGAAGTACAAACCGAACTCCAGTGCTTTGTTATGTTTTATTAACTGGCCCTGTCTCAGGAACATC
TTAACAGATGGCAAAAAAACAAAAACTTTTTTTCAACTCCTATGAGTGGCAACTGAAGTTCTTATTGTTGGGAAAGAACACTAGTCCTAC
CTCTGCCACTAATGAGGTGTTTGGAGGAGGTACCAGCCATATAATAGGGGGTGTATGTGTGAATTTTGTTTAAACTCTACTGTATATTGA
AATGAAATTCATTTATTTGTCTTGACAATGTTCAAATGATGTAGATTGTCTTAGAATGAATATTCATAAGTACTCAGAACTCTTAAGATG
CAGATGCCACCCGTGAGGAGCTAAATTCCTAATGTGTATTGTATTCCAACCCAATTTTACTGGAACTATTGAATAAATCTTTTATTTTCT
TTCAGGTTTACTTGATAGTGGATACATTGGTGTCAGAGGACCTTGACTGGGTTCATTTTATGTCCAGACATCACCCCTGAAACACTGTAC
TGTACTATCTTGCTCTGAGTAGTATCAACTGGATCGTCTCATATTTGCCTCATTCATCCTATTAATTTCAAATGATACTGTGGGGGAAAA
ACAGGGTTAGAAAAACAAGTGGAAAAAATGGAGTGATGTTGTAATCTAAACAAGTGCCTTATGTTTATTGCTAAGAACTGGTGTTACCAA
CCCTTTTGAGAAGAAAGGGTCTCTTGACCTGTATTAACATAGGAAAGTAAAGTTCTTTTTGTTTTTCTTTATATTCAGCTACTCTTGTCA
TTTCTCGTTGAAAAACTAAAATCTGACTAGGTTAGTTTACTCAGCTTTAATTAGATAGTTGAGTCATATATTTTCAACATTTTTCTGTAT
CGTATTTATTATGCACAAAAATAAAGTGTGATCTCTAATAGCATGGCTAAAGGTAATGCCAATATTAGTGAATAGCTTTGCTGTGGGCTT
TATCAGGCCCTTGTTTTTCACAGTGTTGTTTGTACTCCATGGTGTATTGCTATTAGAGCTGTGAAATGAAAGCTGTGACTTTATGAAGAG
ATCAAAAAAAGTGTGGTCCAGATTCAGGTAGGTTGTGGTAAGTTCAGGGAAGTCTTGTATGATTTCTAAGAATATTTCAGTTACCATGTA
TAGTATTTGGGAAAAGCTGTAATGTAAAATATTGGACTTTGTTGCAAGATAGGTATATACTTGTGTCAGATAATTAAAGCCTTAAATTTT
GAAATGAATCTTTGAGATTTCAAAGAAAGACTGACCTTTCAAATAGAAGGCGGTCTTTCTATTCTAGCTAATGCCCCACTTCTTTAAGTT
ATAAACAAAGTTTCATGATACCATTCTGCTATCATCTAAACTTTGCTGAACTCTACTGCCAACCTACATTAAAAACAAAGTCCCACGAAA
TGGCTGTGTTACACCATAGTGAGCAGAAACTTAAATTTTGTTCTAATTTTGATGGTTGAAAAATTTCAACCTGTAGCAATAAAACATTTT

>In-frame_INPP4B_ENST00000506217_chr4_143324091_-_NAA15_ENST00000398947_chr4_140255328_+_6200nt
ATGGAAATTAAAGAGGAAGGGGCATCAGAAGAAGGGCAGCACTTTCTTCCTACAGCCCAGGCCAATGATCCCGGGGACTGTCAGTTCACA
AGTATCCAGAAGACTCCAAATGAACCGCAGTTGGAATTCATCCTTGCATGCAAGGATCTCGTGGCTCCTGTCCGTGATCGTAAACTGAAT
ACACTGGTGCAGATCTCCGTAATCCACCCCGTGGAGCAGAGTCTGACAAGATACTCCAGCACCGAAATTGTGGAGGGAACAAGGGACCCA
CTGTTTTTGACTGGTGTCACATTCCCATCTGAGTATCCCATCTATGAGGAGACCAAAATAAAACTAACAGTCTATGATGTCAAGGATAAG
TCTCATGACACCAGGTGTTATGAACATAAACAGTATAGAAATGGATTGAAATTCTGTAAACAAATACTTTCTAATCCCAAATTTGCAGAG
CATGGAGAAACCTTGGCTATGAAAGGATTAACATTGAACTGTTTGGGGAAAAAGGAAGAAGCTTATGAATTGGTTCGTAGAGGTTTGAGA
AATGACTTGAAGAGTCATGTGTGTTGGCACGTTTATGGCCTTCTTCAGAGGTCAGACAAGAAGTATGATGAAGCCATTAAGTGTTACAGA
AATGCACTAAAATGGGATAAAGACAATCTTCAAATCTTAAGGGACCTTTCCTTACTACAGATTCAAATGCGAGATCTTGAGGGTTACAGG
GAAACGAGGTATCAGTTACTTCAGCTTCGACCTGCGCAGAGAGCATCATGGATTGGTTATGCTATTGCTTACCATTTATTAGAAGATTAT
GAAATGGCAGCAAAGATTTTAGAAGAATTTAGGAAAACACAACAGACATCCCCTGACAAGGTGGATTATGAATATAGTGAACTACTCTTA
TATCAGAATCAAGTTCTTCGGGAAGCAGGTCTCTATAGAGAAGCTTTGGAACATCTTTGTACCTATGAAAAGCAGATTTGTGATAAACTT
GCTGTAGAAGAAACCAAAGGGGAACTTCTGTTGCAACTATGTCGTTTGGAAGATGCTGCAGATGTTTATAGAGGATTGCAAGAGAGAAAT
CCTGAAAACTGGGCCTATTACAAAGGCTTGGAAAAAGCACTCAAGCCAGCTAATATGTTAGAACGGCTAAAAATTTATGAGGAAGCCTGG
ACTAAATATCCCAGGGGACTGGTGCCAAGAAGGCTGCCGTTAAACTTTTTATCTGGTGAGAAGTTTAAAGAATGTTTGGATAAGTTCCTA
AGGATGAATTTCAGCAAGGGTTGCCCACCAGTCTTCAATACTTTAAGATCATTATACAAAGACAAAGAAAAGGTGGCAATCATAGAAGAG
TTAGTAGTAGGTTATGAAACCTCTCTAAAAAGCTGCCGGTTATTTAACCCCAATGATGATGGAAAGGAGGAACCACCAACCACATTACTT
TGGGTCCAGTACTACTTGGCACAACATTATGACAAAATTGGTCAGCCATCTATTGCTTTGGAGTACATAAATACTGCTATTGAAAGTACA
CCTACATTAATAGAACTCTTTCTCGTGAAAGCTAAAATCTATAAGCATGCTGGAAATATTAAAGAAGCTGCAAGGTGGATGGATGAGGCC
CAGGCCTTGGACACAGCAGACAGATTTATCAACTCCAAATGTGCAAAATACATGCTAAAAGCCAACCTGATTAAAGAAGCTGAAGAAATG
TGCTCAAAGTTTACAAGGGAAGGAACATCAGCGGTAGAGAATTTGAATGAAATGCAGTGCATGTGGTTCCAAACAGAATGTGCCCAGGCT
TATAAAGCAATGAATAAATTTGGTGAAGCACTTAAGAAATGTCATGAGATTGAGAGACATTTTATAGAAATCACTGATGACCAGTTTGAC
TTTCATACATACTGTATGAGGAAGATTACCCTTAGATCATATGTGGACTTATTAAAACTAGAAGATGTACTTCGACAGCATCCATTTTAC
TTCAAGGCAGCAAGAATTGCTATAGAGATCTATTTGAAGCTTCATGACAACCCCCTTACAGATGAGAATAAAGAACACGAAGCTGATACA
GCAAACATGTCTGACAAAGAGCTAAAGAAGCTACGTAATAAACAAAGAAGAGCTCAAAAGAAAGCCCAGATAGAAGAAGAGAAAAAAAAT
GCAGAAAAAGAAAAGCAGCAGAGAAATCAGAAAAAGAAGAAGGATGATGATGATGAGGAGATAGGAGGTCCAAAAGAAGAACTTATTCCA
GAGAAACTGGCCAAGGTTGAAACTCCATTGGAAGAAGCTATTAAATTTTTAACACCGTTGAAGAACTTGGTGAAGAACAAGATAGAGACT
CATCTTTTTGCCTTTGAGATTTACTTTAGGAAAGAAAAGTTTCTTTTGATGCTACAATCAGTAAAGAGGGCATTTGCTATTGATTCTAGT
CATCCCTGGCTTCATGAGTGTATGATTCGTCTCTTTAATACTGTGTGTGAAAGTAAAGATTTATCTGATACAGTTAGAACAGTATTAAAA
CAAGAAATGAATCGTCTTTTTGGAGCAACGAATCCAAAGAATTTTAATGAAACTTTTCTGAAAAGGAATTCTGATTCATTGCCACACAGA
TTATCAGCTGCCAAAATGGTATATTACTTAGATCCTTCTAGTCAGAAGCGAGCTATAGAGTTGGCAACAACACTTGATGAATCTCTCACT
AACAGAAACCTCCAGACATGTATGGAGGTATTGGAAGCCTTGTATGATGGTAGCCTAGGAGACTGTAAAGAAGCTGCTGAAATTTATAGA
GCAAATTGTCATAAGCTTTTCCCTTATGCTTTGGCTTTCATGCCTCCTGGATATGAAGAGGATATGAAGATCACAGTTAATGGAGATAGT
TCTGCAGAAGCTGAAGAACTGGCCAATGAAATTTGAACATCACTAAACAAGCAAATGGAATGACTTTGGACCATATCTAGTATATAATAT
TTTTGTCACGCACCTGCTGCATTGCTCTAACTTACACAGAATGAGAGGAGTAAATGTTCTTGCCTTCAAATAGTGTTTTACGTTTTTTAT
CCTGCTGAAAAAGTATATATAAAATATCTAACATTACAGGATAGAGGTTCAGTTTCTTAAAAAATTAAAGCTGCTAAAATTGAGTGGTTA
AAAAAGATACCTTATCCTATTCCTCCCCACCCACCCATGTTTTTAAACTAATTTATATAAAATCTGGAGGCTGTTACAGCTAACAAAGCA
GGTGTGTGGCAGAAATATTACTTTAAATTTGTCTTGTGAGATTTTACTATATCTCAGACAGCATAAATGCTGTTTTAGCACTGGATTCTT
TCACTGAGCACAAAGAGTTGTTGGGGCTTTAGCATCTGACTGATTTTGTTACGGGGTTGATTCTGACCATAGGAAGTATGCAATGTGAAT
CACTATTTACAGAGAAACCTACAACAGATGCTTGATGTTGTAGAAACTGGGACATATAGATACCAAGCAAAATTATAAGAAACCTATAAG
GTGTTCAATACGCTTGTGTTTCCAAAATTCACTGTACATGATCAGTTTGGTGTTCTTGTACCACAGTTTTTAACTGAAGGAACCAGTTGT
AACAGTCTCAATTTTAACTAAAACTTGAAGAACTAAAACAACAATGCAAACCTTTCAGCATTGTTTGGCCAAACTTGTTAAAACTGTAAT
GCAAGAACCAAATGCACTGTGATGTGGCACCAACTAATTAGCAAGCATGAATTTTTCACCCAAGAGTGAAAAAAGGAAAATCTACCATGG
CTTGAAGTTAAAGAGCAGAACTCCTGACTACCATTCTATGACTGATCAAAAGACTAATAGTTAAAAACCTCAGCAGGCCTTGTTCACGAT
ATGCAGAAAAAAAAGTGCTGCAGTTTAGATACCTCTGGAATTTTTCCACAGTGTCACAGGTTTGTAATACTTGAAGCCCTACATTTCTAA
GAATATATTTCTTGCTCAGTTGTTTCAGGCAAGCCCAAGACTTTGTAATTTTTAAAGGGCCCAAGATTTTTTTTTTTTTTTTTTTTTTCA
AATAACAGACCAGCTTCTTTTTCTTGCAGTTACAGATGTAATTTCCTTTTTGTTGTCAAACATAAGGTACCAAATATGATGCAATAAATT
GTTTTGAAAAACAGTTGTGTGAATATTTCAACTAATCTGTGTTGGGCTTCTGTGAAATACACAGGTGGAAACAGAGGTGCAAGCCAGAGG
CAATGTAATATGCTGTAAGGCTAGTGCAGATGGGAGCTTTTTAGAAGGGGCTAAGTGCTGGTGTCAGGGAAATTCCATAATGAAGTAGAA
TGCTGCTCCTGCATTAAGATTTCATTGAGGGCAAGGCTGGTGGCAGGTACTATGAATGTAATTCATAATTTAAAAGGAAAACTAAAAACT
ATTTTGATTTGGGAAAATGAGCCTTAATTTGTTAAACCTATACACTGAGAACTAGCCTCAGGCTTAATATTCTCATTGCATTTGCAAGAT
CTGAGCAAATAAGATTAAGTAAAACAAATCAATTGTATATATAATTGACCTTTTTGTGGAACATGTAGTTTATAGAAAGTATACTCTAAA
GGGAATTTGCCGAAGACCTTTTACTGATTGAACAGTTGTGCTACAATCAACTTTTCATAGTACATGACCTGCATTCCACATCTCAGTCTA
ACAGTTTAGTAGTGATGTAAAGAGAAGTACAAACCGAACTCCAGTGCTTTGTTATGTTTTATTAACTGGCCCTGTCTCAGGAACATCTTA
ACAGATGGCAAAAAAACAAAAACTTTTTTTCAACTCCTATGAGTGGCAACTGAAGTTCTTATTGTTGGGAAAGAACACTAGTCCTACCTC
TGCCACTAATGAGGTGTTTGGAGGAGGTACCAGCCATATAATAGGGGGTGTATGTGTGAATTTTGTTTAAACTCTACTGTATATTGAAAT
GAAATTCATTTATTTGTCTTGACAATGTTCAAATGATGTAGATTGTCTTAGAATGAATATTCATAAGTACTCAGAACTCTTAAGATGCAG
ATGCCACCCGTGAGGAGCTAAATTCCTAATGTGTATTGTATTCCAACCCAATTTTACTGGAACTATTGAATAAATCTTTTATTTTCTTTC
AGGTTTACTTGATAGTGGATACATTGGTGTCAGAGGACCTTGACTGGGTTCATTTTATGTCCAGACATCACCCCTGAAACACTGTACTGT
ACTATCTTGCTCTGAGTAGTATCAACTGGATCGTCTCATATTTGCCTCATTCATCCTATTAATTTCAAATGATACTGTGGGGGAAAAACA
GGGTTAGAAAAACAAGTGGAAAAAATGGAGTGATGTTGTAATCTAAACAAGTGCCTTATGTTTATTGCTAAGAACTGGTGTTACCAACCC
TTTTGAGAAGAAAGGGTCTCTTGACCTGTATTAACATAGGAAAGTAAAGTTCTTTTTGTTTTTCTTTATATTCAGCTACTCTTGTCATTT
CTCGTTGAAAAACTAAAATCTGACTAGGTTAGTTTACTCAGCTTTAATTAGATAGTTGAGTCATATATTTTCAACATTTTTCTGTATCGT
ATTTATTATGCACAAAAATAAAGTGTGATCTCTAATAGCATGGCTAAAGGTAATGCCAATATTAGTGAATAGCTTTGCTGTGGGCTTTAT
CAGGCCCTTGTTTTTCACAGTGTTGTTTGTACTCCATGGTGTATTGCTATTAGAGCTGTGAAATGAAAGCTGTGACTTTATGAAGAGATC
AAAAAAAGTGTGGTCCAGATTCAGGTAGGTTGTGGTAAGTTCAGGGAAGTCTTGTATGATTTCTAAGAATATTTCAGTTACCATGTATAG
TATTTGGGAAAAGCTGTAATGTAAAATATTGGACTTTGTTGCAAGATAGGTATATACTTGTGTCAGATAATTAAAGCCTTAAATTTTGAA
ATGAATCTTTGAGATTTCAAAGAAAGACTGACCTTTCAAATAGAAGGCGGTCTTTCTATTCTAGCTAATGCCCCACTTCTTTAAGTTATA
AACAAAGTTTCATGATACCATTCTGCTATCATCTAAACTTTGCTGAACTCTACTGCCAACCTACATTAAAAACAAAGTCCCACGAAATGG


Top

FusionGenePPI for INPP4B_NAA15


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
INPP4BELAVL1, PYCARD, ZNF131NAA15UBA5, XRCC6, XRCC5, RAD21, SIRT7, NAA10, HYPK, ASUN, MATR3, FN1, VCAM1, ITGA4, DDI2, STAT1, TSNAX, VPS26A, NAA50, PYCARD, MBD5, CYP1A1, CAND2, CMAS, DHX9, DRG1, FBL, HNRNPR, PSMC3, PSMD12, PSMD3, YARS, NAA20, NTRK1, KRAS, CEP97, CNTRL, DCTN1, POC5, STIL, SRPR, RNF126, ZNF746, NAA16, ARRB2, TRAFD1, FGB, SNRNP27, GTF2E2, USP47, MRPS11, FGF9, BRCA1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
TgeneNAA15chr4:143324091chr4:140255328ENST00000296543+020500_86618867HYPK


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for INPP4B_NAA15


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for INPP4B_NAA15


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource