FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 17429

FusionGeneSummary for ILF3_SMARCA4

check button Fusion gene summary
Fusion gene informationFusion gene name: ILF3_SMARCA4
Fusion gene ID: 17429
HgeneTgene
Gene symbol

ILF3

SMARCA4

Gene ID

3609

6597

Gene nameinterleukin enhancer binding factor 3SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4
SynonymsCBTF|DRBF|DRBP76|MMP4|MPHOSPH4|MPP4|NF-AT-90|NF110|NF110b|NF90|NF90a|NF90b|NFAR|NFAR-1|NFAR2|TCP110|TCP80BAF190|BAF190A|BRG1|CSS4|MRD16|RTPS2|SNF2|SNF2L4|SNF2LB|SWI2|hSNF2b
Cytomap

19p13.2

19p13.2

Type of geneprotein-codingprotein-coding
Descriptioninterleukin enhancer-binding factor 3M-phase phosphoprotein 4double-stranded RNA-binding protein, 76 kDdsRNA binding protein NFAR-2/MPP4interleukin enhancer binding factor 3, 90kDinterleukin enhancer binding factor 3, 90kDanuclear factor associated transcription activator BRG1ATP-dependent helicase SMARCA4BRG1-associated factor 190ABRM/SWI2-related gene 1SNF2-betaSNF2-like 4brahma protein-like 1global transcription activator homologous sequencehomeotic gene regulatormitotic growth and trans
Modification date2018052320180523
UniProtAcc

Q12906

P51532

Ensembl transtripts involved in fusion geneENST00000420083, ENST00000449870, 
ENST00000318511, ENST00000407004, 
ENST00000589998, ENST00000250241, 
ENST00000592763, ENST00000588657, 
ENST00000590261, ENST00000586544, 
ENST00000358026, ENST00000344626, 
ENST00000429416, ENST00000541122, 
ENST00000589677, ENST00000444061, 
ENST00000590574, ENST00000413806, 
ENST00000450717, ENST00000538456, 
Fusion gene scores* DoF score16 X 9 X 10=144012 X 14 X 8=1344
# samples 1815
** MAII scorelog2(18/1440*10)=-3
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(15/1344*10)=-3.16349873228288
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: ILF3 [Title/Abstract] AND SMARCA4 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneILF3

GO:0006468

protein phosphorylation

21123651

HgeneILF3

GO:0045892

negative regulation of transcription, DNA-templated

11739746

HgeneILF3

GO:0045893

positive regulation of transcription, DNA-templated

11739746

TgeneSMARCA4

GO:0006337

nucleosome disassembly

8895581

TgeneSMARCA4

GO:0006338

chromatin remodeling

10943845|11726552

TgeneSMARCA4

GO:0045892

negative regulation of transcription, DNA-templated

12065415

TgeneSMARCA4

GO:0045944

positive regulation of transcription by RNA polymerase II

15774904|17938176

TgeneSMARCA4

GO:0051091

positive regulation of DNA binding transcription factor activity

11950834|17938176

TgeneSMARCA4

GO:1902661

positive regulation of glucose mediated signaling pathway

22368283


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDLIHCTCGA-CC-A7IE-01AILF3chr19

10782211

+SMARCA4chr19

11134194

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000420083ENST00000358026ILF3chr19

10782211

+SMARCA4chr19

11134194

+
In-frameENST00000420083ENST00000344626ILF3chr19

10782211

+SMARCA4chr19

11134194

+
In-frameENST00000420083ENST00000429416ILF3chr19

10782211

+SMARCA4chr19

11134194

+
In-frameENST00000420083ENST00000541122ILF3chr19

10782211

+SMARCA4chr19

11134194

+
In-frameENST00000420083ENST00000589677ILF3chr19

10782211

+SMARCA4chr19

11134194

+
In-frameENST00000420083ENST00000444061ILF3chr19

10782211

+SMARCA4chr19

11134194

+
In-frameENST00000420083ENST00000590574ILF3chr19

10782211

+SMARCA4chr19

11134194

+
In-frameENST00000420083ENST00000413806ILF3chr19

10782211

+SMARCA4chr19

11134194

+
In-frameENST00000420083ENST00000450717ILF3chr19

10782211

+SMARCA4chr19

11134194

+
5CDS-intronENST00000420083ENST00000538456ILF3chr19

10782211

+SMARCA4chr19

11134194

+
In-frameENST00000449870ENST00000358026ILF3chr19

10782211

+SMARCA4chr19

11134194

+
In-frameENST00000449870ENST00000344626ILF3chr19

10782211

+SMARCA4chr19

11134194

+
In-frameENST00000449870ENST00000429416ILF3chr19

10782211

+SMARCA4chr19

11134194

+
In-frameENST00000449870ENST00000541122ILF3chr19

10782211

+SMARCA4chr19

11134194

+
In-frameENST00000449870ENST00000589677ILF3chr19

10782211

+SMARCA4chr19

11134194

+
In-frameENST00000449870ENST00000444061ILF3chr19

10782211

+SMARCA4chr19

11134194

+
In-frameENST00000449870ENST00000590574ILF3chr19

10782211

+SMARCA4chr19

11134194

+
In-frameENST00000449870ENST00000413806ILF3chr19

10782211

+SMARCA4chr19

11134194

+
In-frameENST00000449870ENST00000450717ILF3chr19

10782211

+SMARCA4chr19

11134194

+
5CDS-intronENST00000449870ENST00000538456ILF3chr19

10782211

+SMARCA4chr19

11134194

+
In-frameENST00000318511ENST00000358026ILF3chr19

10782211

+SMARCA4chr19

11134194

+
In-frameENST00000318511ENST00000344626ILF3chr19

10782211

+SMARCA4chr19

11134194

+
In-frameENST00000318511ENST00000429416ILF3chr19

10782211

+SMARCA4chr19

11134194

+
In-frameENST00000318511ENST00000541122ILF3chr19

10782211

+SMARCA4chr19

11134194

+
In-frameENST00000318511ENST00000589677ILF3chr19

10782211

+SMARCA4chr19

11134194

+
In-frameENST00000318511ENST00000444061ILF3chr19

10782211

+SMARCA4chr19

11134194

+
In-frameENST00000318511ENST00000590574ILF3chr19

10782211

+SMARCA4chr19

11134194

+
In-frameENST00000318511ENST00000413806ILF3chr19

10782211

+SMARCA4chr19

11134194

+
In-frameENST00000318511ENST00000450717ILF3chr19

10782211

+SMARCA4chr19

11134194

+
5CDS-intronENST00000318511ENST00000538456ILF3chr19

10782211

+SMARCA4chr19

11134194

+
In-frameENST00000407004ENST00000358026ILF3chr19

10782211

+SMARCA4chr19

11134194

+
In-frameENST00000407004ENST00000344626ILF3chr19

10782211

+SMARCA4chr19

11134194

+
In-frameENST00000407004ENST00000429416ILF3chr19

10782211

+SMARCA4chr19

11134194

+
In-frameENST00000407004ENST00000541122ILF3chr19

10782211

+SMARCA4chr19

11134194

+
In-frameENST00000407004ENST00000589677ILF3chr19

10782211

+SMARCA4chr19

11134194

+
In-frameENST00000407004ENST00000444061ILF3chr19

10782211

+SMARCA4chr19

11134194

+
In-frameENST00000407004ENST00000590574ILF3chr19

10782211

+SMARCA4chr19

11134194

+
In-frameENST00000407004ENST00000413806ILF3chr19

10782211

+SMARCA4chr19

11134194

+
In-frameENST00000407004ENST00000450717ILF3chr19

10782211

+SMARCA4chr19

11134194

+
5CDS-intronENST00000407004ENST00000538456ILF3chr19

10782211

+SMARCA4chr19

11134194

+
In-frameENST00000589998ENST00000358026ILF3chr19

10782211

+SMARCA4chr19

11134194

+
In-frameENST00000589998ENST00000344626ILF3chr19

10782211

+SMARCA4chr19

11134194

+
In-frameENST00000589998ENST00000429416ILF3chr19

10782211

+SMARCA4chr19

11134194

+
In-frameENST00000589998ENST00000541122ILF3chr19

10782211

+SMARCA4chr19

11134194

+
In-frameENST00000589998ENST00000589677ILF3chr19

10782211

+SMARCA4chr19

11134194

+
In-frameENST00000589998ENST00000444061ILF3chr19

10782211

+SMARCA4chr19

11134194

+
In-frameENST00000589998ENST00000590574ILF3chr19

10782211

+SMARCA4chr19

11134194

+
In-frameENST00000589998ENST00000413806ILF3chr19

10782211

+SMARCA4chr19

11134194

+
In-frameENST00000589998ENST00000450717ILF3chr19

10782211

+SMARCA4chr19

11134194

+
5CDS-intronENST00000589998ENST00000538456ILF3chr19

10782211

+SMARCA4chr19

11134194

+
In-frameENST00000250241ENST00000358026ILF3chr19

10782211

+SMARCA4chr19

11134194

+
In-frameENST00000250241ENST00000344626ILF3chr19

10782211

+SMARCA4chr19

11134194

+
In-frameENST00000250241ENST00000429416ILF3chr19

10782211

+SMARCA4chr19

11134194

+
In-frameENST00000250241ENST00000541122ILF3chr19

10782211

+SMARCA4chr19

11134194

+
In-frameENST00000250241ENST00000589677ILF3chr19

10782211

+SMARCA4chr19

11134194

+
In-frameENST00000250241ENST00000444061ILF3chr19

10782211

+SMARCA4chr19

11134194

+
In-frameENST00000250241ENST00000590574ILF3chr19

10782211

+SMARCA4chr19

11134194

+
In-frameENST00000250241ENST00000413806ILF3chr19

10782211

+SMARCA4chr19

11134194

+
In-frameENST00000250241ENST00000450717ILF3chr19

10782211

+SMARCA4chr19

11134194

+
5CDS-intronENST00000250241ENST00000538456ILF3chr19

10782211

+SMARCA4chr19

11134194

+
In-frameENST00000592763ENST00000358026ILF3chr19

10782211

+SMARCA4chr19

11134194

+
In-frameENST00000592763ENST00000344626ILF3chr19

10782211

+SMARCA4chr19

11134194

+
In-frameENST00000592763ENST00000429416ILF3chr19

10782211

+SMARCA4chr19

11134194

+
In-frameENST00000592763ENST00000541122ILF3chr19

10782211

+SMARCA4chr19

11134194

+
In-frameENST00000592763ENST00000589677ILF3chr19

10782211

+SMARCA4chr19

11134194

+
In-frameENST00000592763ENST00000444061ILF3chr19

10782211

+SMARCA4chr19

11134194

+
In-frameENST00000592763ENST00000590574ILF3chr19

10782211

+SMARCA4chr19

11134194

+
In-frameENST00000592763ENST00000413806ILF3chr19

10782211

+SMARCA4chr19

11134194

+
In-frameENST00000592763ENST00000450717ILF3chr19

10782211

+SMARCA4chr19

11134194

+
5CDS-intronENST00000592763ENST00000538456ILF3chr19

10782211

+SMARCA4chr19

11134194

+
In-frameENST00000588657ENST00000358026ILF3chr19

10782211

+SMARCA4chr19

11134194

+
In-frameENST00000588657ENST00000344626ILF3chr19

10782211

+SMARCA4chr19

11134194

+
In-frameENST00000588657ENST00000429416ILF3chr19

10782211

+SMARCA4chr19

11134194

+
In-frameENST00000588657ENST00000541122ILF3chr19

10782211

+SMARCA4chr19

11134194

+
In-frameENST00000588657ENST00000589677ILF3chr19

10782211

+SMARCA4chr19

11134194

+
In-frameENST00000588657ENST00000444061ILF3chr19

10782211

+SMARCA4chr19

11134194

+
In-frameENST00000588657ENST00000590574ILF3chr19

10782211

+SMARCA4chr19

11134194

+
In-frameENST00000588657ENST00000413806ILF3chr19

10782211

+SMARCA4chr19

11134194

+
In-frameENST00000588657ENST00000450717ILF3chr19

10782211

+SMARCA4chr19

11134194

+
5CDS-intronENST00000588657ENST00000538456ILF3chr19

10782211

+SMARCA4chr19

11134194

+
In-frameENST00000590261ENST00000358026ILF3chr19

10782211

+SMARCA4chr19

11134194

+
In-frameENST00000590261ENST00000344626ILF3chr19

10782211

+SMARCA4chr19

11134194

+
In-frameENST00000590261ENST00000429416ILF3chr19

10782211

+SMARCA4chr19

11134194

+
In-frameENST00000590261ENST00000541122ILF3chr19

10782211

+SMARCA4chr19

11134194

+
In-frameENST00000590261ENST00000589677ILF3chr19

10782211

+SMARCA4chr19

11134194

+
In-frameENST00000590261ENST00000444061ILF3chr19

10782211

+SMARCA4chr19

11134194

+
In-frameENST00000590261ENST00000590574ILF3chr19

10782211

+SMARCA4chr19

11134194

+
In-frameENST00000590261ENST00000413806ILF3chr19

10782211

+SMARCA4chr19

11134194

+
In-frameENST00000590261ENST00000450717ILF3chr19

10782211

+SMARCA4chr19

11134194

+
5CDS-intronENST00000590261ENST00000538456ILF3chr19

10782211

+SMARCA4chr19

11134194

+
intron-3CDSENST00000586544ENST00000358026ILF3chr19

10782211

+SMARCA4chr19

11134194

+
intron-3CDSENST00000586544ENST00000344626ILF3chr19

10782211

+SMARCA4chr19

11134194

+
intron-3CDSENST00000586544ENST00000429416ILF3chr19

10782211

+SMARCA4chr19

11134194

+
intron-3CDSENST00000586544ENST00000541122ILF3chr19

10782211

+SMARCA4chr19

11134194

+
intron-3CDSENST00000586544ENST00000589677ILF3chr19

10782211

+SMARCA4chr19

11134194

+
intron-3CDSENST00000586544ENST00000444061ILF3chr19

10782211

+SMARCA4chr19

11134194

+
intron-3CDSENST00000586544ENST00000590574ILF3chr19

10782211

+SMARCA4chr19

11134194

+
intron-3CDSENST00000586544ENST00000413806ILF3chr19

10782211

+SMARCA4chr19

11134194

+
intron-3CDSENST00000586544ENST00000450717ILF3chr19

10782211

+SMARCA4chr19

11134194

+
intron-intronENST00000586544ENST00000538456ILF3chr19

10782211

+SMARCA4chr19

11134194

+

Top

FusionProtFeatures for ILF3_SMARCA4


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ILF3

Q12906

SMARCA4

P51532

Involved in transcriptional activation and repression ofselect genes by chromatin remodeling (alteration of DNA-nucleosometopology). Component of SWI/SNF chromatin remodeling complexesthat carry out key enzymatic activities, changing chromatinstructure by altering DNA-histone contacts within a nucleosome inan ATP-dependent manner. Component of the CREST-BRG1 complex, amultiprotein complex that regulates promoter activation byorchestrating the calcium-dependent release of a repressor complexand the recruitment of an activator complex. In resting neurons,transcription of the c-FOS promoter is inhibited by SMARCA4-dependent recruitment of a phospho-RB1-HDAC repressor complex.Upon calcium influx, RB1 is dephosphorylated by calcineurin, whichleads to release of the repressor complex. At the same time, thereis increased recruitment of CREBBP to the promoter by a CREST-dependent mechanism, which leads to transcriptional activation.The CREST-BRG1 complex also binds to the NR2B promoter, andactivity-dependent induction of NR2B expression involves therelease of HDAC1 and recruitment of CREBBP. Belongs to the neuralprogenitors-specific chromatin remodeling complex (npBAF complex)and the neuron-specific chromatin remodeling complex (nBAFcomplex). During neural development, a switch from astem/progenitor to a postmitotic chromatin remodeling mechanismoccurs as neurons exit the cell cycle and become committed totheir adult state. The transition from proliferating neuralstem/progenitor cells to postmitotic neurons requires a switch insubunit composition of the npBAF and nBAF complexes. As neuralprogenitors exit mitosis and differentiate into neurons, npBAFcomplexes which contain ACTL6A/BAF53A and PHF10/BAF45A, areexchanged for homologous alternative ACTL6B/BAF53B and DPF1/BAF45Bor DPF3/BAF45C subunits in neuron-specific complexes (nBAF). ThenpBAF complex is essential for the self-renewal/proliferativecapacity of the multipotent neural stem cells. The nBAF complexalong with CREST plays a role regulating the activity of genesessential for dendrite growth. SMARCA4/BAF190A may promote neuralstem cell self-renewal/proliferation by enhancing Notch-dependentproliferative signals, while concurrently making the neural stemcell insensitive to SHH-dependent differentiating cues (Bysimilarity). Acts as a corepressor of ZEB1 to regulate E-cadherintranscription and is required for induction of epithelial-mesenchymal transition (EMT) by ZEB1. Binds via DLX1 to enhancerslocated in the intergenic region between DLX5 and DLX6 and thisbinding is stabilized by the long non-coding RNA (lncRNA) Evf2 (Bysimilarity). Binds to RNA in a promiscuous manner (By similarity).Binding to RNAs including lncRNA Evf2 leads to inhibition ofSMARCA4 ATPase and chromatin remodeling activities (Bysimilarity). {ECO:0000250|UniProtKB:Q3TKT4,ECO:0000269|PubMed:19571879, ECO:0000269|PubMed:20418909,ECO:0000303|PubMed:22952240, ECO:0000303|PubMed:26601204}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000344626+18351360_13649531648Compositional biasNote=Poly-Glu
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000344626+18351571_15849531648Compositional biasNote=Poly-Glu
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000413806+17331360_13649531618Compositional biasNote=Poly-Glu
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000413806+17331571_15849531618Compositional biasNote=Poly-Glu
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000429416+19361360_13649531648Compositional biasNote=Poly-Glu
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000429416+19361571_15849531648Compositional biasNote=Poly-Glu
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000444061+19351360_13649531614Compositional biasNote=Poly-Glu
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000444061+19351571_15849531614Compositional biasNote=Poly-Glu
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000450717+17331360_13649531617Compositional biasNote=Poly-Glu
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000450717+17331571_15849531617Compositional biasNote=Poly-Glu
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000541122+19351360_13649531618Compositional biasNote=Poly-Glu
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000541122+19351571_15849531618Compositional biasNote=Poly-Glu
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000589677+19351360_13649531617Compositional biasNote=Poly-Glu
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000589677+19351571_15849531617Compositional biasNote=Poly-Glu
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000590574+18341360_13649531615Compositional biasNote=Poly-Glu
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000590574+18341571_15849531615Compositional biasNote=Poly-Glu
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000344626+18351084_12469531648DomainHelicase C-terminal
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000344626+18351477_15479531648DomainBromo
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000413806+17331084_12469531618DomainHelicase C-terminal
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000413806+17331477_15479531618DomainBromo
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000429416+19361084_12469531648DomainHelicase C-terminal
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000429416+19361477_15479531648DomainBromo
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000444061+19351084_12469531614DomainHelicase C-terminal
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000444061+19351477_15479531614DomainBromo
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000450717+17331084_12469531617DomainHelicase C-terminal
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000450717+17331477_15479531617DomainBromo
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000541122+19351084_12469531618DomainHelicase C-terminal
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000541122+19351477_15479531618DomainBromo
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000589677+19351084_12469531617DomainHelicase C-terminal
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000589677+19351477_15479531617DomainBromo
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000590574+18341084_12469531615DomainHelicase C-terminal
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000590574+18341477_15479531615DomainBromo

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneILF3chr19:10782211chr19:11134194ENST00000250241+317385_389137691Compositional biasNote=Poly-Lys
HgeneILF3chr19:10782211chr19:11134194ENST00000250241+317634_637137691Compositional biasNote=Poly-Pro
HgeneILF3chr19:10782211chr19:11134194ENST00000250241+317640_659137691Compositional biasNote=Arg/Gly-rich
HgeneILF3chr19:10782211chr19:11134194ENST00000250241+317701_709137691Compositional biasNote=Poly-Gly
HgeneILF3chr19:10782211chr19:11134194ENST00000250241+317794_798137691Compositional biasNote=Poly-Gly
HgeneILF3chr19:10782211chr19:11134194ENST00000318511+420385_389137895Compositional biasNote=Poly-Lys
HgeneILF3chr19:10782211chr19:11134194ENST00000318511+420634_637137895Compositional biasNote=Poly-Pro
HgeneILF3chr19:10782211chr19:11134194ENST00000318511+420640_659137895Compositional biasNote=Arg/Gly-rich
HgeneILF3chr19:10782211chr19:11134194ENST00000318511+420701_709137895Compositional biasNote=Poly-Gly
HgeneILF3chr19:10782211chr19:11134194ENST00000318511+420794_798137895Compositional biasNote=Poly-Gly
HgeneILF3chr19:10782211chr19:11134194ENST00000407004+418385_389137707Compositional biasNote=Poly-Lys
HgeneILF3chr19:10782211chr19:11134194ENST00000407004+418634_637137707Compositional biasNote=Poly-Pro
HgeneILF3chr19:10782211chr19:11134194ENST00000407004+418640_659137707Compositional biasNote=Arg/Gly-rich
HgeneILF3chr19:10782211chr19:11134194ENST00000407004+418701_709137707Compositional biasNote=Poly-Gly
HgeneILF3chr19:10782211chr19:11134194ENST00000407004+418794_798137707Compositional biasNote=Poly-Gly
HgeneILF3chr19:10782211chr19:11134194ENST00000420083+418385_389137691Compositional biasNote=Poly-Lys
HgeneILF3chr19:10782211chr19:11134194ENST00000420083+418634_637137691Compositional biasNote=Poly-Pro
HgeneILF3chr19:10782211chr19:11134194ENST00000420083+418640_659137691Compositional biasNote=Arg/Gly-rich
HgeneILF3chr19:10782211chr19:11134194ENST00000420083+418701_709137691Compositional biasNote=Poly-Gly
HgeneILF3chr19:10782211chr19:11134194ENST00000420083+418794_798137691Compositional biasNote=Poly-Gly
HgeneILF3chr19:10782211chr19:11134194ENST00000449870+420385_389137899Compositional biasNote=Poly-Lys
HgeneILF3chr19:10782211chr19:11134194ENST00000449870+420634_637137899Compositional biasNote=Poly-Pro
HgeneILF3chr19:10782211chr19:11134194ENST00000449870+420640_659137899Compositional biasNote=Arg/Gly-rich
HgeneILF3chr19:10782211chr19:11134194ENST00000449870+420701_709137899Compositional biasNote=Poly-Gly
HgeneILF3chr19:10782211chr19:11134194ENST00000449870+420794_798137899Compositional biasNote=Poly-Gly
HgeneILF3chr19:10782211chr19:11134194ENST00000588657+319385_389137899Compositional biasNote=Poly-Lys
HgeneILF3chr19:10782211chr19:11134194ENST00000588657+319634_637137899Compositional biasNote=Poly-Pro
HgeneILF3chr19:10782211chr19:11134194ENST00000588657+319640_659137899Compositional biasNote=Arg/Gly-rich
HgeneILF3chr19:10782211chr19:11134194ENST00000588657+319701_709137899Compositional biasNote=Poly-Gly
HgeneILF3chr19:10782211chr19:11134194ENST00000588657+319794_798137899Compositional biasNote=Poly-Gly
HgeneILF3chr19:10782211chr19:11134194ENST00000589998+418385_389137703Compositional biasNote=Poly-Lys
HgeneILF3chr19:10782211chr19:11134194ENST00000589998+418634_637137703Compositional biasNote=Poly-Pro
HgeneILF3chr19:10782211chr19:11134194ENST00000589998+418640_659137703Compositional biasNote=Arg/Gly-rich
HgeneILF3chr19:10782211chr19:11134194ENST00000589998+418701_709137703Compositional biasNote=Poly-Gly
HgeneILF3chr19:10782211chr19:11134194ENST00000589998+418794_798137703Compositional biasNote=Poly-Gly
HgeneILF3chr19:10782211chr19:11134194ENST00000590261+319385_389137895Compositional biasNote=Poly-Lys
HgeneILF3chr19:10782211chr19:11134194ENST00000590261+319634_637137895Compositional biasNote=Poly-Pro
HgeneILF3chr19:10782211chr19:11134194ENST00000590261+319640_659137895Compositional biasNote=Arg/Gly-rich
HgeneILF3chr19:10782211chr19:11134194ENST00000590261+319701_709137895Compositional biasNote=Poly-Gly
HgeneILF3chr19:10782211chr19:11134194ENST00000590261+319794_798137895Compositional biasNote=Poly-Gly
HgeneILF3chr19:10782211chr19:11134194ENST00000592763+316385_389137699Compositional biasNote=Poly-Lys
HgeneILF3chr19:10782211chr19:11134194ENST00000592763+316634_637137699Compositional biasNote=Poly-Pro
HgeneILF3chr19:10782211chr19:11134194ENST00000592763+316640_659137699Compositional biasNote=Arg/Gly-rich
HgeneILF3chr19:10782211chr19:11134194ENST00000592763+316701_709137699Compositional biasNote=Poly-Gly
HgeneILF3chr19:10782211chr19:11134194ENST00000592763+316794_798137699Compositional biasNote=Poly-Gly
HgeneILF3chr19:10782211chr19:11134194ENST00000250241+317398_467137691DomainDRBM 1
HgeneILF3chr19:10782211chr19:11134194ENST00000250241+317524_590137691DomainDRBM 2
HgeneILF3chr19:10782211chr19:11134194ENST00000250241+3175_378137691DomainDZF
HgeneILF3chr19:10782211chr19:11134194ENST00000318511+420398_467137895DomainDRBM 1
HgeneILF3chr19:10782211chr19:11134194ENST00000318511+420524_590137895DomainDRBM 2
HgeneILF3chr19:10782211chr19:11134194ENST00000318511+4205_378137895DomainDZF
HgeneILF3chr19:10782211chr19:11134194ENST00000407004+418398_467137707DomainDRBM 1
HgeneILF3chr19:10782211chr19:11134194ENST00000407004+418524_590137707DomainDRBM 2
HgeneILF3chr19:10782211chr19:11134194ENST00000407004+4185_378137707DomainDZF
HgeneILF3chr19:10782211chr19:11134194ENST00000420083+418398_467137691DomainDRBM 1
HgeneILF3chr19:10782211chr19:11134194ENST00000420083+418524_590137691DomainDRBM 2
HgeneILF3chr19:10782211chr19:11134194ENST00000420083+4185_378137691DomainDZF
HgeneILF3chr19:10782211chr19:11134194ENST00000449870+420398_467137899DomainDRBM 1
HgeneILF3chr19:10782211chr19:11134194ENST00000449870+420524_590137899DomainDRBM 2
HgeneILF3chr19:10782211chr19:11134194ENST00000449870+4205_378137899DomainDZF
HgeneILF3chr19:10782211chr19:11134194ENST00000588657+319398_467137899DomainDRBM 1
HgeneILF3chr19:10782211chr19:11134194ENST00000588657+319524_590137899DomainDRBM 2
HgeneILF3chr19:10782211chr19:11134194ENST00000588657+3195_378137899DomainDZF
HgeneILF3chr19:10782211chr19:11134194ENST00000589998+418398_467137703DomainDRBM 1
HgeneILF3chr19:10782211chr19:11134194ENST00000589998+418524_590137703DomainDRBM 2
HgeneILF3chr19:10782211chr19:11134194ENST00000589998+4185_378137703DomainDZF
HgeneILF3chr19:10782211chr19:11134194ENST00000590261+319398_467137895DomainDRBM 1
HgeneILF3chr19:10782211chr19:11134194ENST00000590261+319524_590137895DomainDRBM 2
HgeneILF3chr19:10782211chr19:11134194ENST00000590261+3195_378137895DomainDZF
HgeneILF3chr19:10782211chr19:11134194ENST00000592763+316398_467137699DomainDRBM 1
HgeneILF3chr19:10782211chr19:11134194ENST00000592763+316524_590137699DomainDRBM 2
HgeneILF3chr19:10782211chr19:11134194ENST00000592763+3165_378137699DomainDZF
HgeneILF3chr19:10782211chr19:11134194ENST00000250241+317371_389137691MotifBipartite nuclear localization signal
HgeneILF3chr19:10782211chr19:11134194ENST00000318511+420371_389137895MotifBipartite nuclear localization signal
HgeneILF3chr19:10782211chr19:11134194ENST00000407004+418371_389137707MotifBipartite nuclear localization signal
HgeneILF3chr19:10782211chr19:11134194ENST00000420083+418371_389137691MotifBipartite nuclear localization signal
HgeneILF3chr19:10782211chr19:11134194ENST00000449870+420371_389137899MotifBipartite nuclear localization signal
HgeneILF3chr19:10782211chr19:11134194ENST00000588657+319371_389137899MotifBipartite nuclear localization signal
HgeneILF3chr19:10782211chr19:11134194ENST00000589998+418371_389137703MotifBipartite nuclear localization signal
HgeneILF3chr19:10782211chr19:11134194ENST00000590261+319371_389137895MotifBipartite nuclear localization signal
HgeneILF3chr19:10782211chr19:11134194ENST00000592763+316371_389137699MotifBipartite nuclear localization signal
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000344626+1835578_5889531648Compositional biasNote=Poly-Lys
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000344626+1835663_6729531648Compositional biasNote=Poly-Glu
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000413806+1733578_5889531618Compositional biasNote=Poly-Lys
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000413806+1733663_6729531618Compositional biasNote=Poly-Glu
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000429416+1936578_5889531648Compositional biasNote=Poly-Lys
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000429416+1936663_6729531648Compositional biasNote=Poly-Glu
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000444061+1935578_5889531614Compositional biasNote=Poly-Lys
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000444061+1935663_6729531614Compositional biasNote=Poly-Glu
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000450717+1733578_5889531617Compositional biasNote=Poly-Lys
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000450717+1733663_6729531617Compositional biasNote=Poly-Glu
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000541122+1935578_5889531618Compositional biasNote=Poly-Lys
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000541122+1935663_6729531618Compositional biasNote=Poly-Glu
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000589677+1935578_5889531617Compositional biasNote=Poly-Lys
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000589677+1935663_6729531617Compositional biasNote=Poly-Glu
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000590574+1834578_5889531615Compositional biasNote=Poly-Lys
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000590574+1834663_6729531615Compositional biasNote=Poly-Glu
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000344626+1835171_2069531648DomainQLQ
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000344626+1835460_5329531648DomainHSA
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000344626+1835766_9319531648DomainHelicase ATP-binding
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000413806+1733171_2069531618DomainQLQ
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000413806+1733460_5329531618DomainHSA
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000413806+1733766_9319531618DomainHelicase ATP-binding
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000429416+1936171_2069531648DomainQLQ
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000429416+1936460_5329531648DomainHSA
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000429416+1936766_9319531648DomainHelicase ATP-binding
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000444061+1935171_2069531614DomainQLQ
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000444061+1935460_5329531614DomainHSA
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000444061+1935766_9319531614DomainHelicase ATP-binding
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000450717+1733171_2069531617DomainQLQ
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000450717+1733460_5329531617DomainHSA
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000450717+1733766_9319531617DomainHelicase ATP-binding
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000541122+1935171_2069531618DomainQLQ
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000541122+1935460_5329531618DomainHSA
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000541122+1935766_9319531618DomainHelicase ATP-binding
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000589677+1935171_2069531617DomainQLQ
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000589677+1935460_5329531617DomainHSA
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000589677+1935766_9319531617DomainHelicase ATP-binding
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000590574+1834171_2069531615DomainQLQ
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000590574+1834460_5329531615DomainHSA
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000590574+1834766_9319531615DomainHelicase ATP-binding
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000344626+1835881_8849531648MotifNote=DEGH box
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000413806+1733881_8849531618MotifNote=DEGH box
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000429416+1936881_8849531648MotifNote=DEGH box
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000444061+1935881_8849531614MotifNote=DEGH box
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000450717+1733881_8849531617MotifNote=DEGH box
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000541122+1935881_8849531618MotifNote=DEGH box
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000589677+1935881_8849531617MotifNote=DEGH box
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000590574+1834881_8849531615MotifNote=DEGH box
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000344626+1835779_7869531648Nucleotide bindingATP
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000413806+1733779_7869531618Nucleotide bindingATP
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000429416+1936779_7869531648Nucleotide bindingATP
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000444061+1935779_7869531614Nucleotide bindingATP
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000450717+1733779_7869531617Nucleotide bindingATP
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000541122+1935779_7869531618Nucleotide bindingATP
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000589677+1935779_7869531617Nucleotide bindingATP
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000590574+1834779_7869531615Nucleotide bindingATP
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000344626+1835462_7289531648RegionRNA-binding region which is sufficient for binding to lncRNA Evf2
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000413806+1733462_7289531618RegionRNA-binding region which is sufficient for binding to lncRNA Evf2
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000429416+1936462_7289531648RegionRNA-binding region which is sufficient for binding to lncRNA Evf2
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000444061+1935462_7289531614RegionRNA-binding region which is sufficient for binding to lncRNA Evf2
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000450717+1733462_7289531617RegionRNA-binding region which is sufficient for binding to lncRNA Evf2
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000541122+1935462_7289531618RegionRNA-binding region which is sufficient for binding to lncRNA Evf2
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000589677+1935462_7289531617RegionRNA-binding region which is sufficient for binding to lncRNA Evf2
TgeneSMARCA4chr19:10782211chr19:11134194ENST00000590574+1834462_7289531615RegionRNA-binding region which is sufficient for binding to lncRNA Evf2


Top

FusionGeneSequence for ILF3_SMARCA4


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ILF3_ENST00000420083_chr19_10782211_+_SMARCA4_ENST00000358026_chr19_11134194_+_864aa
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR
GVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVI
KCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLD
RILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDS
DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDESRHCSTGS
GSASFAHTAPPPAGVNPDLEEPPLKEEDEVPDDETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVER
LTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWLKKITGKDIHDTASSVARGLQFQRGLQFCTRASKAIEEGTLEEIEEEVRQKKSSRKRK
RDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKP
VDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKEDDSEGEESEEEEEGEEEGSESESRSVK

>In-frame_ILF3_ENST00000420083_chr19_10782211_+_SMARCA4_ENST00000344626_chr19_11134194_+_832aa
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR
GVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVI
KCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLD
RILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDS
DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDESRHCSTGS
GSASFAHTAPPPAGVNPDLEEPPLKEEDEVPDDETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVER
LTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRP
PAEKLSPNPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNA
QTFNLEGSLIYEDSIVLQSVFTSVRQKIEKEDDSEGEESEEEEEGEEEGSESESRSVKVKIKLGRKEKAQDRLKGGRRRPSRGSRAKPVV

>In-frame_ILF3_ENST00000420083_chr19_10782211_+_SMARCA4_ENST00000429416_chr19_11134194_+_832aa
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR
GVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVI
KCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLD
RILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDS
DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDESRHCSTGS
GSASFAHTAPPPAGVNPDLEEPPLKEEDEVPDDETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVER
LTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRP
PAEKLSPNPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNA
QTFNLEGSLIYEDSIVLQSVFTSVRQKIEKEDDSEGEESEEEEEGEEEGSESESRSVKVKIKLGRKEKAQDRLKGGRRRPSRGSRAKPVV

>In-frame_ILF3_ENST00000420083_chr19_10782211_+_SMARCA4_ENST00000541122_chr19_11134194_+_802aa
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR
GVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVI
KCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLD
RILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDS
DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVPDD
ETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWL
KTLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSS
SGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEK

>In-frame_ILF3_ENST00000420083_chr19_10782211_+_SMARCA4_ENST00000589677_chr19_11134194_+_801aa
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR
GVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVI
KCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLD
RILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDS
DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVPDD
ETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWL
KTLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSS
GRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKE

>In-frame_ILF3_ENST00000420083_chr19_10782211_+_SMARCA4_ENST00000444061_chr19_11134194_+_798aa
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR
GVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVI
KCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLD
RILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDS
DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVPDD
ETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWL
KAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSSGRQ
LSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKEDDS

>In-frame_ILF3_ENST00000420083_chr19_10782211_+_SMARCA4_ENST00000590574_chr19_11134194_+_799aa
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR
GVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVI
KCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLD
RILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDS
DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVPDD
ETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWL
KAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSSSGR
QLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKEDD

>In-frame_ILF3_ENST00000420083_chr19_10782211_+_SMARCA4_ENST00000413806_chr19_11134194_+_802aa
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR
GVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVI
KCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLD
RILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDS
DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVPDD
ETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWL
KTLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSS
SGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEK

>In-frame_ILF3_ENST00000420083_chr19_10782211_+_SMARCA4_ENST00000450717_chr19_11134194_+_801aa
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR
GVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVI
KCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLD
RILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDS
DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVPDD
ETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWL
KTLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSS
GRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKE

>In-frame_ILF3_ENST00000449870_chr19_10782211_+_SMARCA4_ENST00000358026_chr19_11134194_+_864aa
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR
GVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVI
KCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLD
RILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDS
DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDESRHCSTGS
GSASFAHTAPPPAGVNPDLEEPPLKEEDEVPDDETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVER
LTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWLKKITGKDIHDTASSVARGLQFQRGLQFCTRASKAIEEGTLEEIEEEVRQKKSSRKRK
RDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKP
VDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKEDDSEGEESEEEEEGEEEGSESESRSVK

>In-frame_ILF3_ENST00000449870_chr19_10782211_+_SMARCA4_ENST00000344626_chr19_11134194_+_832aa
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR
GVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVI
KCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLD
RILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDS
DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDESRHCSTGS
GSASFAHTAPPPAGVNPDLEEPPLKEEDEVPDDETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVER
LTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRP
PAEKLSPNPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNA
QTFNLEGSLIYEDSIVLQSVFTSVRQKIEKEDDSEGEESEEEEEGEEEGSESESRSVKVKIKLGRKEKAQDRLKGGRRRPSRGSRAKPVV

>In-frame_ILF3_ENST00000449870_chr19_10782211_+_SMARCA4_ENST00000429416_chr19_11134194_+_832aa
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR
GVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVI
KCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLD
RILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDS
DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDESRHCSTGS
GSASFAHTAPPPAGVNPDLEEPPLKEEDEVPDDETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVER
LTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRP
PAEKLSPNPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNA
QTFNLEGSLIYEDSIVLQSVFTSVRQKIEKEDDSEGEESEEEEEGEEEGSESESRSVKVKIKLGRKEKAQDRLKGGRRRPSRGSRAKPVV

>In-frame_ILF3_ENST00000449870_chr19_10782211_+_SMARCA4_ENST00000541122_chr19_11134194_+_802aa
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR
GVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVI
KCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLD
RILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDS
DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVPDD
ETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWL
KTLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSS
SGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEK

>In-frame_ILF3_ENST00000449870_chr19_10782211_+_SMARCA4_ENST00000589677_chr19_11134194_+_801aa
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR
GVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVI
KCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLD
RILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDS
DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVPDD
ETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWL
KTLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSS
GRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKE

>In-frame_ILF3_ENST00000449870_chr19_10782211_+_SMARCA4_ENST00000444061_chr19_11134194_+_798aa
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR
GVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVI
KCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLD
RILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDS
DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVPDD
ETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWL
KAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSSGRQ
LSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKEDDS

>In-frame_ILF3_ENST00000449870_chr19_10782211_+_SMARCA4_ENST00000590574_chr19_11134194_+_799aa
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR
GVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVI
KCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLD
RILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDS
DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVPDD
ETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWL
KAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSSSGR
QLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKEDD

>In-frame_ILF3_ENST00000449870_chr19_10782211_+_SMARCA4_ENST00000413806_chr19_11134194_+_802aa
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR
GVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVI
KCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLD
RILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDS
DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVPDD
ETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWL
KTLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSS
SGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEK

>In-frame_ILF3_ENST00000449870_chr19_10782211_+_SMARCA4_ENST00000450717_chr19_11134194_+_801aa
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR
GVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVI
KCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLD
RILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDS
DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVPDD
ETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWL
KTLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSS
GRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKE

>In-frame_ILF3_ENST00000318511_chr19_10782211_+_SMARCA4_ENST00000358026_chr19_11134194_+_864aa
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR
GVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVI
KCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLD
RILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDS
DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDESRHCSTGS
GSASFAHTAPPPAGVNPDLEEPPLKEEDEVPDDETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVER
LTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWLKKITGKDIHDTASSVARGLQFQRGLQFCTRASKAIEEGTLEEIEEEVRQKKSSRKRK
RDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKP
VDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKEDDSEGEESEEEEEGEEEGSESESRSVK

>In-frame_ILF3_ENST00000318511_chr19_10782211_+_SMARCA4_ENST00000344626_chr19_11134194_+_832aa
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR
GVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVI
KCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLD
RILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDS
DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDESRHCSTGS
GSASFAHTAPPPAGVNPDLEEPPLKEEDEVPDDETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVER
LTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRP
PAEKLSPNPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNA
QTFNLEGSLIYEDSIVLQSVFTSVRQKIEKEDDSEGEESEEEEEGEEEGSESESRSVKVKIKLGRKEKAQDRLKGGRRRPSRGSRAKPVV

>In-frame_ILF3_ENST00000318511_chr19_10782211_+_SMARCA4_ENST00000429416_chr19_11134194_+_832aa
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR
GVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVI
KCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLD
RILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDS
DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDESRHCSTGS
GSASFAHTAPPPAGVNPDLEEPPLKEEDEVPDDETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVER
LTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRP
PAEKLSPNPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNA
QTFNLEGSLIYEDSIVLQSVFTSVRQKIEKEDDSEGEESEEEEEGEEEGSESESRSVKVKIKLGRKEKAQDRLKGGRRRPSRGSRAKPVV

>In-frame_ILF3_ENST00000318511_chr19_10782211_+_SMARCA4_ENST00000541122_chr19_11134194_+_802aa
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR
GVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVI
KCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLD
RILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDS
DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVPDD
ETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWL
KTLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSS
SGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEK

>In-frame_ILF3_ENST00000318511_chr19_10782211_+_SMARCA4_ENST00000589677_chr19_11134194_+_801aa
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR
GVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVI
KCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLD
RILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDS
DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVPDD
ETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWL
KTLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSS
GRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKE

>In-frame_ILF3_ENST00000318511_chr19_10782211_+_SMARCA4_ENST00000444061_chr19_11134194_+_798aa
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR
GVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVI
KCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLD
RILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDS
DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVPDD
ETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWL
KAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSSGRQ
LSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKEDDS

>In-frame_ILF3_ENST00000318511_chr19_10782211_+_SMARCA4_ENST00000590574_chr19_11134194_+_799aa
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR
GVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVI
KCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLD
RILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDS
DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVPDD
ETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWL
KAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSSSGR
QLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKEDD

>In-frame_ILF3_ENST00000318511_chr19_10782211_+_SMARCA4_ENST00000413806_chr19_11134194_+_802aa
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR
GVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVI
KCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLD
RILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDS
DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVPDD
ETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWL
KTLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSS
SGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEK

>In-frame_ILF3_ENST00000318511_chr19_10782211_+_SMARCA4_ENST00000450717_chr19_11134194_+_801aa
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR
GVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVI
KCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLD
RILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDS
DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVPDD
ETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWL
KTLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSS
GRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKE

>In-frame_ILF3_ENST00000407004_chr19_10782211_+_SMARCA4_ENST00000358026_chr19_11134194_+_864aa
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR
GVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVI
KCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLD
RILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDS
DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDESRHCSTGS
GSASFAHTAPPPAGVNPDLEEPPLKEEDEVPDDETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVER
LTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWLKKITGKDIHDTASSVARGLQFQRGLQFCTRASKAIEEGTLEEIEEEVRQKKSSRKRK
RDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKP
VDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKEDDSEGEESEEEEEGEEEGSESESRSVK

>In-frame_ILF3_ENST00000407004_chr19_10782211_+_SMARCA4_ENST00000344626_chr19_11134194_+_832aa
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR
GVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVI
KCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLD
RILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDS
DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDESRHCSTGS
GSASFAHTAPPPAGVNPDLEEPPLKEEDEVPDDETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVER
LTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRP
PAEKLSPNPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNA
QTFNLEGSLIYEDSIVLQSVFTSVRQKIEKEDDSEGEESEEEEEGEEEGSESESRSVKVKIKLGRKEKAQDRLKGGRRRPSRGSRAKPVV

>In-frame_ILF3_ENST00000407004_chr19_10782211_+_SMARCA4_ENST00000429416_chr19_11134194_+_832aa
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR
GVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVI
KCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLD
RILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDS
DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDESRHCSTGS
GSASFAHTAPPPAGVNPDLEEPPLKEEDEVPDDETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVER
LTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRP
PAEKLSPNPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNA
QTFNLEGSLIYEDSIVLQSVFTSVRQKIEKEDDSEGEESEEEEEGEEEGSESESRSVKVKIKLGRKEKAQDRLKGGRRRPSRGSRAKPVV

>In-frame_ILF3_ENST00000407004_chr19_10782211_+_SMARCA4_ENST00000541122_chr19_11134194_+_802aa
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR
GVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVI
KCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLD
RILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDS
DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVPDD
ETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWL
KTLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSS
SGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEK

>In-frame_ILF3_ENST00000407004_chr19_10782211_+_SMARCA4_ENST00000589677_chr19_11134194_+_801aa
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR
GVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVI
KCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLD
RILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDS
DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVPDD
ETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWL
KTLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSS
GRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKE

>In-frame_ILF3_ENST00000407004_chr19_10782211_+_SMARCA4_ENST00000444061_chr19_11134194_+_798aa
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR
GVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVI
KCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLD
RILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDS
DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVPDD
ETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWL
KAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSSGRQ
LSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKEDDS

>In-frame_ILF3_ENST00000407004_chr19_10782211_+_SMARCA4_ENST00000590574_chr19_11134194_+_799aa
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR
GVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVI
KCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLD
RILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDS
DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVPDD
ETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWL
KAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSSSGR
QLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKEDD

>In-frame_ILF3_ENST00000407004_chr19_10782211_+_SMARCA4_ENST00000413806_chr19_11134194_+_802aa
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR
GVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVI
KCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLD
RILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDS
DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVPDD
ETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWL
KTLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSS
SGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEK

>In-frame_ILF3_ENST00000407004_chr19_10782211_+_SMARCA4_ENST00000450717_chr19_11134194_+_801aa
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR
GVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVI
KCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLD
RILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDS
DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVPDD
ETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWL
KTLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSS
GRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKE

>In-frame_ILF3_ENST00000589998_chr19_10782211_+_SMARCA4_ENST00000358026_chr19_11134194_+_864aa
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR
GVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVI
KCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLD
RILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDS
DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDESRHCSTGS
GSASFAHTAPPPAGVNPDLEEPPLKEEDEVPDDETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVER
LTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWLKKITGKDIHDTASSVARGLQFQRGLQFCTRASKAIEEGTLEEIEEEVRQKKSSRKRK
RDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKP
VDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKEDDSEGEESEEEEEGEEEGSESESRSVK

>In-frame_ILF3_ENST00000589998_chr19_10782211_+_SMARCA4_ENST00000344626_chr19_11134194_+_832aa
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR
GVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVI
KCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLD
RILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDS
DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDESRHCSTGS
GSASFAHTAPPPAGVNPDLEEPPLKEEDEVPDDETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVER
LTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRP
PAEKLSPNPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNA
QTFNLEGSLIYEDSIVLQSVFTSVRQKIEKEDDSEGEESEEEEEGEEEGSESESRSVKVKIKLGRKEKAQDRLKGGRRRPSRGSRAKPVV

>In-frame_ILF3_ENST00000589998_chr19_10782211_+_SMARCA4_ENST00000429416_chr19_11134194_+_832aa
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR
GVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVI
KCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLD
RILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDS
DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDESRHCSTGS
GSASFAHTAPPPAGVNPDLEEPPLKEEDEVPDDETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVER
LTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRP
PAEKLSPNPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNA
QTFNLEGSLIYEDSIVLQSVFTSVRQKIEKEDDSEGEESEEEEEGEEEGSESESRSVKVKIKLGRKEKAQDRLKGGRRRPSRGSRAKPVV

>In-frame_ILF3_ENST00000589998_chr19_10782211_+_SMARCA4_ENST00000541122_chr19_11134194_+_802aa
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR
GVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVI
KCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLD
RILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDS
DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVPDD
ETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWL
KTLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSS
SGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEK

>In-frame_ILF3_ENST00000589998_chr19_10782211_+_SMARCA4_ENST00000589677_chr19_11134194_+_801aa
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR
GVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVI
KCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLD
RILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDS
DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVPDD
ETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWL
KTLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSS
GRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKE

>In-frame_ILF3_ENST00000589998_chr19_10782211_+_SMARCA4_ENST00000444061_chr19_11134194_+_798aa
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR
GVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVI
KCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLD
RILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDS
DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVPDD
ETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWL
KAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSSGRQ
LSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKEDDS

>In-frame_ILF3_ENST00000589998_chr19_10782211_+_SMARCA4_ENST00000590574_chr19_11134194_+_799aa
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR
GVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVI
KCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLD
RILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDS
DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVPDD
ETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWL
KAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSSSGR
QLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKEDD

>In-frame_ILF3_ENST00000589998_chr19_10782211_+_SMARCA4_ENST00000413806_chr19_11134194_+_802aa
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR
GVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVI
KCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLD
RILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDS
DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVPDD
ETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWL
KTLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSS
SGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEK

>In-frame_ILF3_ENST00000589998_chr19_10782211_+_SMARCA4_ENST00000450717_chr19_11134194_+_801aa
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR
GVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVI
KCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLD
RILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDS
DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVPDD
ETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWL
KTLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSS
GRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKE

>In-frame_ILF3_ENST00000250241_chr19_10782211_+_SMARCA4_ENST00000358026_chr19_11134194_+_864aa
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR
GVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVI
KCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLD
RILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDS
DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDESRHCSTGS
GSASFAHTAPPPAGVNPDLEEPPLKEEDEVPDDETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVER
LTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWLKKITGKDIHDTASSVARGLQFQRGLQFCTRASKAIEEGTLEEIEEEVRQKKSSRKRK
RDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKP
VDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKEDDSEGEESEEEEEGEEEGSESESRSVK

>In-frame_ILF3_ENST00000250241_chr19_10782211_+_SMARCA4_ENST00000344626_chr19_11134194_+_832aa
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR
GVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVI
KCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLD
RILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDS
DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDESRHCSTGS
GSASFAHTAPPPAGVNPDLEEPPLKEEDEVPDDETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVER
LTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRP
PAEKLSPNPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNA
QTFNLEGSLIYEDSIVLQSVFTSVRQKIEKEDDSEGEESEEEEEGEEEGSESESRSVKVKIKLGRKEKAQDRLKGGRRRPSRGSRAKPVV

>In-frame_ILF3_ENST00000250241_chr19_10782211_+_SMARCA4_ENST00000429416_chr19_11134194_+_832aa
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR
GVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVI
KCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLD
RILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDS
DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDESRHCSTGS
GSASFAHTAPPPAGVNPDLEEPPLKEEDEVPDDETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVER
LTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRP
PAEKLSPNPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNA
QTFNLEGSLIYEDSIVLQSVFTSVRQKIEKEDDSEGEESEEEEEGEEEGSESESRSVKVKIKLGRKEKAQDRLKGGRRRPSRGSRAKPVV

>In-frame_ILF3_ENST00000250241_chr19_10782211_+_SMARCA4_ENST00000541122_chr19_11134194_+_802aa
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR
GVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVI
KCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLD
RILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDS
DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVPDD
ETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWL
KTLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSS
SGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEK

>In-frame_ILF3_ENST00000250241_chr19_10782211_+_SMARCA4_ENST00000589677_chr19_11134194_+_801aa
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR
GVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVI
KCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLD
RILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDS
DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVPDD
ETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWL
KTLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSS
GRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKE

>In-frame_ILF3_ENST00000250241_chr19_10782211_+_SMARCA4_ENST00000444061_chr19_11134194_+_798aa
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR
GVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVI
KCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLD
RILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDS
DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVPDD
ETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWL
KAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSSGRQ
LSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKEDDS

>In-frame_ILF3_ENST00000250241_chr19_10782211_+_SMARCA4_ENST00000590574_chr19_11134194_+_799aa
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR
GVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVI
KCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLD
RILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDS
DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVPDD
ETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWL
KAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSSSGR
QLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKEDD

>In-frame_ILF3_ENST00000250241_chr19_10782211_+_SMARCA4_ENST00000413806_chr19_11134194_+_802aa
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR
GVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVI
KCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLD
RILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDS
DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVPDD
ETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWL
KTLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSS
SGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEK

>In-frame_ILF3_ENST00000250241_chr19_10782211_+_SMARCA4_ENST00000450717_chr19_11134194_+_801aa
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR
GVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVI
KCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLD
RILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDS
DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVPDD
ETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWL
KTLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSS
GRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKE

>In-frame_ILF3_ENST00000592763_chr19_10782211_+_SMARCA4_ENST00000358026_chr19_11134194_+_864aa
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR
GVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVI
KCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLD
RILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDS
DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDESRHCSTGS
GSASFAHTAPPPAGVNPDLEEPPLKEEDEVPDDETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVER
LTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWLKKITGKDIHDTASSVARGLQFQRGLQFCTRASKAIEEGTLEEIEEEVRQKKSSRKRK
RDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKP
VDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKEDDSEGEESEEEEEGEEEGSESESRSVK

>In-frame_ILF3_ENST00000592763_chr19_10782211_+_SMARCA4_ENST00000344626_chr19_11134194_+_832aa
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR
GVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVI
KCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLD
RILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDS
DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDESRHCSTGS
GSASFAHTAPPPAGVNPDLEEPPLKEEDEVPDDETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVER
LTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRP
PAEKLSPNPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNA
QTFNLEGSLIYEDSIVLQSVFTSVRQKIEKEDDSEGEESEEEEEGEEEGSESESRSVKVKIKLGRKEKAQDRLKGGRRRPSRGSRAKPVV

>In-frame_ILF3_ENST00000592763_chr19_10782211_+_SMARCA4_ENST00000429416_chr19_11134194_+_832aa
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR
GVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVI
KCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLD
RILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDS
DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDESRHCSTGS
GSASFAHTAPPPAGVNPDLEEPPLKEEDEVPDDETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVER
LTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRP
PAEKLSPNPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNA
QTFNLEGSLIYEDSIVLQSVFTSVRQKIEKEDDSEGEESEEEEEGEEEGSESESRSVKVKIKLGRKEKAQDRLKGGRRRPSRGSRAKPVV

>In-frame_ILF3_ENST00000592763_chr19_10782211_+_SMARCA4_ENST00000541122_chr19_11134194_+_802aa
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR
GVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVI
KCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLD
RILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDS
DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVPDD
ETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWL
KTLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSS
SGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEK

>In-frame_ILF3_ENST00000592763_chr19_10782211_+_SMARCA4_ENST00000589677_chr19_11134194_+_801aa
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR
GVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVI
KCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLD
RILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDS
DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVPDD
ETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWL
KTLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSS
GRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKE

>In-frame_ILF3_ENST00000592763_chr19_10782211_+_SMARCA4_ENST00000444061_chr19_11134194_+_798aa
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR
GVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVI
KCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLD
RILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDS
DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVPDD
ETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWL
KAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSSGRQ
LSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKEDDS

>In-frame_ILF3_ENST00000592763_chr19_10782211_+_SMARCA4_ENST00000590574_chr19_11134194_+_799aa
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR
GVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVI
KCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLD
RILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDS
DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVPDD
ETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWL
KAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSSSGR
QLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKEDD

>In-frame_ILF3_ENST00000592763_chr19_10782211_+_SMARCA4_ENST00000413806_chr19_11134194_+_802aa
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR
GVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVI
KCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLD
RILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDS
DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVPDD
ETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWL
KTLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSS
SGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEK

>In-frame_ILF3_ENST00000592763_chr19_10782211_+_SMARCA4_ENST00000450717_chr19_11134194_+_801aa
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR
GVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVI
KCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLD
RILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDS
DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVPDD
ETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWL
KTLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSS
GRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKE

>In-frame_ILF3_ENST00000588657_chr19_10782211_+_SMARCA4_ENST00000358026_chr19_11134194_+_864aa
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR
GVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVI
KCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLD
RILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDS
DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDESRHCSTGS
GSASFAHTAPPPAGVNPDLEEPPLKEEDEVPDDETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVER
LTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWLKKITGKDIHDTASSVARGLQFQRGLQFCTRASKAIEEGTLEEIEEEVRQKKSSRKRK
RDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKP
VDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKEDDSEGEESEEEEEGEEEGSESESRSVK

>In-frame_ILF3_ENST00000588657_chr19_10782211_+_SMARCA4_ENST00000344626_chr19_11134194_+_832aa
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR
GVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVI
KCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLD
RILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDS
DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDESRHCSTGS
GSASFAHTAPPPAGVNPDLEEPPLKEEDEVPDDETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVER
LTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRP
PAEKLSPNPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNA
QTFNLEGSLIYEDSIVLQSVFTSVRQKIEKEDDSEGEESEEEEEGEEEGSESESRSVKVKIKLGRKEKAQDRLKGGRRRPSRGSRAKPVV

>In-frame_ILF3_ENST00000588657_chr19_10782211_+_SMARCA4_ENST00000429416_chr19_11134194_+_832aa
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR
GVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVI
KCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLD
RILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDS
DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDESRHCSTGS
GSASFAHTAPPPAGVNPDLEEPPLKEEDEVPDDETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVER
LTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRP
PAEKLSPNPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNA
QTFNLEGSLIYEDSIVLQSVFTSVRQKIEKEDDSEGEESEEEEEGEEEGSESESRSVKVKIKLGRKEKAQDRLKGGRRRPSRGSRAKPVV

>In-frame_ILF3_ENST00000588657_chr19_10782211_+_SMARCA4_ENST00000541122_chr19_11134194_+_802aa
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR
GVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVI
KCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLD
RILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDS
DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVPDD
ETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWL
KTLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSS
SGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEK

>In-frame_ILF3_ENST00000588657_chr19_10782211_+_SMARCA4_ENST00000589677_chr19_11134194_+_801aa
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR
GVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVI
KCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLD
RILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDS
DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVPDD
ETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWL
KTLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSS
GRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKE

>In-frame_ILF3_ENST00000588657_chr19_10782211_+_SMARCA4_ENST00000444061_chr19_11134194_+_798aa
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR
GVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVI
KCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLD
RILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDS
DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVPDD
ETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWL
KAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSSGRQ
LSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKEDDS

>In-frame_ILF3_ENST00000588657_chr19_10782211_+_SMARCA4_ENST00000590574_chr19_11134194_+_799aa
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR
GVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVI
KCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLD
RILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDS
DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVPDD
ETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWL
KAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSSSGR
QLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKEDD

>In-frame_ILF3_ENST00000588657_chr19_10782211_+_SMARCA4_ENST00000413806_chr19_11134194_+_802aa
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR
GVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVI
KCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLD
RILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDS
DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVPDD
ETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWL
KTLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSS
SGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEK

>In-frame_ILF3_ENST00000588657_chr19_10782211_+_SMARCA4_ENST00000450717_chr19_11134194_+_801aa
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR
GVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVI
KCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLD
RILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDS
DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVPDD
ETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWL
KTLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSS
GRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKE

>In-frame_ILF3_ENST00000590261_chr19_10782211_+_SMARCA4_ENST00000358026_chr19_11134194_+_864aa
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR
GVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVI
KCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLD
RILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDS
DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDESRHCSTGS
GSASFAHTAPPPAGVNPDLEEPPLKEEDEVPDDETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVER
LTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWLKKITGKDIHDTASSVARGLQFQRGLQFCTRASKAIEEGTLEEIEEEVRQKKSSRKRK
RDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKP
VDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKEDDSEGEESEEEEEGEEEGSESESRSVK

>In-frame_ILF3_ENST00000590261_chr19_10782211_+_SMARCA4_ENST00000344626_chr19_11134194_+_832aa
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR
GVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVI
KCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLD
RILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDS
DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDESRHCSTGS
GSASFAHTAPPPAGVNPDLEEPPLKEEDEVPDDETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVER
LTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRP
PAEKLSPNPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNA
QTFNLEGSLIYEDSIVLQSVFTSVRQKIEKEDDSEGEESEEEEEGEEEGSESESRSVKVKIKLGRKEKAQDRLKGGRRRPSRGSRAKPVV

>In-frame_ILF3_ENST00000590261_chr19_10782211_+_SMARCA4_ENST00000429416_chr19_11134194_+_832aa
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR
GVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVI
KCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLD
RILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDS
DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDESRHCSTGS
GSASFAHTAPPPAGVNPDLEEPPLKEEDEVPDDETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVER
LTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRP
PAEKLSPNPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNA
QTFNLEGSLIYEDSIVLQSVFTSVRQKIEKEDDSEGEESEEEEEGEEEGSESESRSVKVKIKLGRKEKAQDRLKGGRRRPSRGSRAKPVV

>In-frame_ILF3_ENST00000590261_chr19_10782211_+_SMARCA4_ENST00000541122_chr19_11134194_+_802aa
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR
GVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVI
KCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLD
RILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDS
DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVPDD
ETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWL
KTLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSS
SGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEK

>In-frame_ILF3_ENST00000590261_chr19_10782211_+_SMARCA4_ENST00000589677_chr19_11134194_+_801aa
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR
GVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVI
KCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLD
RILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDS
DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVPDD
ETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWL
KTLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSS
GRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKE

>In-frame_ILF3_ENST00000590261_chr19_10782211_+_SMARCA4_ENST00000444061_chr19_11134194_+_798aa
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR
GVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVI
KCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLD
RILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDS
DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVPDD
ETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWL
KAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSSGRQ
LSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKEDDS

>In-frame_ILF3_ENST00000590261_chr19_10782211_+_SMARCA4_ENST00000590574_chr19_11134194_+_799aa
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR
GVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVI
KCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLD
RILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDS
DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVPDD
ETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWL
KAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSSSGR
QLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKEDD

>In-frame_ILF3_ENST00000590261_chr19_10782211_+_SMARCA4_ENST00000413806_chr19_11134194_+_802aa
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR
GVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVI
KCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLD
RILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDS
DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVPDD
ETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWL
KTLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSS
SGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEK

>In-frame_ILF3_ENST00000590261_chr19_10782211_+_SMARCA4_ENST00000450717_chr19_11134194_+_801aa
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR
GVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVI
KCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLD
RILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDS
DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVPDD
ETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWL
KTLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSS
GRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKE


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ILF3_ENST00000420083_chr19_10782211_+_SMARCA4_ENST00000358026_chr19_11134194_+_2592nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGAGCAGACACTGCAGCACGGGCAGC
GGCAGTGCCAGCTTCGCCCACACTGCCCCTCCGCCAGCGGGCGTCAACCCCGACTTGGAGGAGCCACCTCTAAAGGAGGAAGACGAGGTG
CCCGACGACGAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAG
GAGGCCCGCAACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGG
CTGACCTGTGAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAG
CAGTGGCTCAAGAAAATTACAGGAAAAGATATCCATGACACAGCCAGCAGTGTGGCACGTGGGCTACAATTCCAGCGTGGCCTTCAGTTC
TGCACACGTGCGTCAAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAG
CGAGACAGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGG
CGGCCGCCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGAC
AGCAGCAGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCC
GTGGACTTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAG
AACGCACAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATC
GAGAAGGAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAA
GTGAAGATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCG

>In-frame_ILF3_ENST00000420083_chr19_10782211_+_SMARCA4_ENST00000344626_chr19_11134194_+_2496nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGAGCAGACACTGCAGCACGGGCAGC
GGCAGTGCCAGCTTCGCCCACACTGCCCCTCCGCCAGCGGGCGTCAACCCCGACTTGGAGGAGCCACCTCTAAAGGAGGAAGACGAGGTG
CCCGACGACGAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAG
GAGGCCCGCAACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGG
CTGACCTGTGAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAG
CAGTGGCTCAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGAC
AGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCG
CCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGC
AGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGAC
TTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCA
CAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAG
GAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAG
ATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTG

>In-frame_ILF3_ENST00000420083_chr19_10782211_+_SMARCA4_ENST00000429416_chr19_11134194_+_2496nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGAGCAGACACTGCAGCACGGGCAGC
GGCAGTGCCAGCTTCGCCCACACTGCCCCTCCGCCAGCGGGCGTCAACCCCGACTTGGAGGAGCCACCTCTAAAGGAGGAAGACGAGGTG
CCCGACGACGAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAG
GAGGCCCGCAACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGG
CTGACCTGTGAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAG
CAGTGGCTCAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGAC
AGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCG
CCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGC
AGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGAC
TTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCA
CAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAG
GAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAG
ATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTG

>In-frame_ILF3_ENST00000420083_chr19_10782211_+_SMARCA4_ENST00000541122_chr19_11134194_+_2406nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGAC
GAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGC
AACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGT
GAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTC
AAGACCCTGAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGAC
AGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCG
CCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGC
AGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGAC
TTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCA
CAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAG
GAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAG
ATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTG

>In-frame_ILF3_ENST00000420083_chr19_10782211_+_SMARCA4_ENST00000589677_chr19_11134194_+_2403nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGAC
GAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGC
AACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGT
GAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTC
AAGACCCTGAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGAC
AGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCG
CCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGT
GGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTC
AAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAG
ACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAG
GATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATC
AAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGT

>In-frame_ILF3_ENST00000420083_chr19_10782211_+_SMARCA4_ENST00000444061_chr19_11134194_+_2394nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGAC
GAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGC
AACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGT
GAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTC
AAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCC
GGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAG
AAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGTGGACGTCAG
CTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATA
AAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAAC
CTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGT
GAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGC
CGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGAC

>In-frame_ILF3_ENST00000420083_chr19_10782211_+_SMARCA4_ENST00000590574_chr19_11134194_+_2397nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGAC
GAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGC
AACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGT
GAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTC
AAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCC
GGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAG
AAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGCAGTGGACGT
CAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAG
ATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTC
AACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGAC
AGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTT
GGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGAT

>In-frame_ILF3_ENST00000420083_chr19_10782211_+_SMARCA4_ENST00000413806_chr19_11134194_+_2406nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGAC
GAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGC
AACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGT
GAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTC
AAGACCCTGAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGAC
AGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCG
CCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGC
AGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGAC
TTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCA
CAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAG
GAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAG
ATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTG

>In-frame_ILF3_ENST00000420083_chr19_10782211_+_SMARCA4_ENST00000450717_chr19_11134194_+_2403nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGAC
GAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGC
AACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGT
GAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTC
AAGACCCTGAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGAC
AGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCG
CCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGT
GGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTC
AAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAG
ACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAG
GATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATC
AAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGT

>In-frame_ILF3_ENST00000449870_chr19_10782211_+_SMARCA4_ENST00000358026_chr19_11134194_+_2592nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGAGCAGACACTGCAGCACGGGCAGC
GGCAGTGCCAGCTTCGCCCACACTGCCCCTCCGCCAGCGGGCGTCAACCCCGACTTGGAGGAGCCACCTCTAAAGGAGGAAGACGAGGTG
CCCGACGACGAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAG
GAGGCCCGCAACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGG
CTGACCTGTGAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAG
CAGTGGCTCAAGAAAATTACAGGAAAAGATATCCATGACACAGCCAGCAGTGTGGCACGTGGGCTACAATTCCAGCGTGGCCTTCAGTTC
TGCACACGTGCGTCAAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAG
CGAGACAGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGG
CGGCCGCCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGAC
AGCAGCAGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCC
GTGGACTTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAG
AACGCACAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATC
GAGAAGGAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAA
GTGAAGATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCG

>In-frame_ILF3_ENST00000449870_chr19_10782211_+_SMARCA4_ENST00000344626_chr19_11134194_+_2496nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGAGCAGACACTGCAGCACGGGCAGC
GGCAGTGCCAGCTTCGCCCACACTGCCCCTCCGCCAGCGGGCGTCAACCCCGACTTGGAGGAGCCACCTCTAAAGGAGGAAGACGAGGTG
CCCGACGACGAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAG
GAGGCCCGCAACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGG
CTGACCTGTGAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAG
CAGTGGCTCAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGAC
AGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCG
CCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGC
AGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGAC
TTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCA
CAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAG
GAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAG
ATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTG

>In-frame_ILF3_ENST00000449870_chr19_10782211_+_SMARCA4_ENST00000429416_chr19_11134194_+_2496nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGAGCAGACACTGCAGCACGGGCAGC
GGCAGTGCCAGCTTCGCCCACACTGCCCCTCCGCCAGCGGGCGTCAACCCCGACTTGGAGGAGCCACCTCTAAAGGAGGAAGACGAGGTG
CCCGACGACGAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAG
GAGGCCCGCAACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGG
CTGACCTGTGAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAG
CAGTGGCTCAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGAC
AGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCG
CCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGC
AGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGAC
TTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCA
CAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAG
GAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAG
ATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTG

>In-frame_ILF3_ENST00000449870_chr19_10782211_+_SMARCA4_ENST00000541122_chr19_11134194_+_2406nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGAC
GAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGC
AACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGT
GAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTC
AAGACCCTGAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGAC
AGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCG
CCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGC
AGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGAC
TTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCA
CAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAG
GAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAG
ATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTG

>In-frame_ILF3_ENST00000449870_chr19_10782211_+_SMARCA4_ENST00000589677_chr19_11134194_+_2403nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGAC
GAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGC
AACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGT
GAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTC
AAGACCCTGAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGAC
AGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCG
CCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGT
GGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTC
AAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAG
ACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAG
GATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATC
AAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGT

>In-frame_ILF3_ENST00000449870_chr19_10782211_+_SMARCA4_ENST00000444061_chr19_11134194_+_2394nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGAC
GAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGC
AACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGT
GAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTC
AAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCC
GGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAG
AAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGTGGACGTCAG
CTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATA
AAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAAC
CTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGT
GAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGC
CGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGAC

>In-frame_ILF3_ENST00000449870_chr19_10782211_+_SMARCA4_ENST00000590574_chr19_11134194_+_2397nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGAC
GAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGC
AACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGT
GAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTC
AAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCC
GGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAG
AAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGCAGTGGACGT
CAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAG
ATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTC
AACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGAC
AGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTT
GGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGAT

>In-frame_ILF3_ENST00000449870_chr19_10782211_+_SMARCA4_ENST00000413806_chr19_11134194_+_2406nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGAC
GAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGC
AACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGT
GAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTC
AAGACCCTGAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGAC
AGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCG
CCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGC
AGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGAC
TTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCA
CAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAG
GAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAG
ATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTG

>In-frame_ILF3_ENST00000449870_chr19_10782211_+_SMARCA4_ENST00000450717_chr19_11134194_+_2403nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGAC
GAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGC
AACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGT
GAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTC
AAGACCCTGAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGAC
AGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCG
CCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGT
GGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTC
AAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAG
ACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAG
GATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATC
AAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGT

>In-frame_ILF3_ENST00000318511_chr19_10782211_+_SMARCA4_ENST00000358026_chr19_11134194_+_2592nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGAGCAGACACTGCAGCACGGGCAGC
GGCAGTGCCAGCTTCGCCCACACTGCCCCTCCGCCAGCGGGCGTCAACCCCGACTTGGAGGAGCCACCTCTAAAGGAGGAAGACGAGGTG
CCCGACGACGAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAG
GAGGCCCGCAACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGG
CTGACCTGTGAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAG
CAGTGGCTCAAGAAAATTACAGGAAAAGATATCCATGACACAGCCAGCAGTGTGGCACGTGGGCTACAATTCCAGCGTGGCCTTCAGTTC
TGCACACGTGCGTCAAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAG
CGAGACAGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGG
CGGCCGCCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGAC
AGCAGCAGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCC
GTGGACTTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAG
AACGCACAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATC
GAGAAGGAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAA
GTGAAGATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCG

>In-frame_ILF3_ENST00000318511_chr19_10782211_+_SMARCA4_ENST00000344626_chr19_11134194_+_2496nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGAGCAGACACTGCAGCACGGGCAGC
GGCAGTGCCAGCTTCGCCCACACTGCCCCTCCGCCAGCGGGCGTCAACCCCGACTTGGAGGAGCCACCTCTAAAGGAGGAAGACGAGGTG
CCCGACGACGAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAG
GAGGCCCGCAACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGG
CTGACCTGTGAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAG
CAGTGGCTCAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGAC
AGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCG
CCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGC
AGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGAC
TTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCA
CAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAG
GAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAG
ATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTG

>In-frame_ILF3_ENST00000318511_chr19_10782211_+_SMARCA4_ENST00000429416_chr19_11134194_+_2496nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGAGCAGACACTGCAGCACGGGCAGC
GGCAGTGCCAGCTTCGCCCACACTGCCCCTCCGCCAGCGGGCGTCAACCCCGACTTGGAGGAGCCACCTCTAAAGGAGGAAGACGAGGTG
CCCGACGACGAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAG
GAGGCCCGCAACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGG
CTGACCTGTGAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAG
CAGTGGCTCAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGAC
AGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCG
CCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGC
AGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGAC
TTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCA
CAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAG
GAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAG
ATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTG

>In-frame_ILF3_ENST00000318511_chr19_10782211_+_SMARCA4_ENST00000541122_chr19_11134194_+_2406nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGAC
GAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGC
AACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGT
GAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTC
AAGACCCTGAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGAC
AGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCG
CCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGC
AGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGAC
TTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCA
CAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAG
GAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAG
ATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTG

>In-frame_ILF3_ENST00000318511_chr19_10782211_+_SMARCA4_ENST00000589677_chr19_11134194_+_2403nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGAC
GAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGC
AACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGT
GAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTC
AAGACCCTGAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGAC
AGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCG
CCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGT
GGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTC
AAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAG
ACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAG
GATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATC
AAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGT

>In-frame_ILF3_ENST00000318511_chr19_10782211_+_SMARCA4_ENST00000444061_chr19_11134194_+_2394nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGAC
GAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGC
AACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGT
GAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTC
AAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCC
GGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAG
AAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGTGGACGTCAG
CTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATA
AAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAAC
CTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGT
GAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGC
CGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGAC

>In-frame_ILF3_ENST00000318511_chr19_10782211_+_SMARCA4_ENST00000590574_chr19_11134194_+_2397nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGAC
GAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGC
AACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGT
GAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTC
AAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCC
GGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAG
AAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGCAGTGGACGT
CAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAG
ATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTC
AACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGAC
AGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTT
GGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGAT

>In-frame_ILF3_ENST00000318511_chr19_10782211_+_SMARCA4_ENST00000413806_chr19_11134194_+_2406nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGAC
GAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGC
AACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGT
GAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTC
AAGACCCTGAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGAC
AGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCG
CCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGC
AGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGAC
TTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCA
CAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAG
GAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAG
ATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTG

>In-frame_ILF3_ENST00000318511_chr19_10782211_+_SMARCA4_ENST00000450717_chr19_11134194_+_2403nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGAC
GAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGC
AACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGT
GAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTC
AAGACCCTGAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGAC
AGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCG
CCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGT
GGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTC
AAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAG
ACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAG
GATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATC
AAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGT

>In-frame_ILF3_ENST00000407004_chr19_10782211_+_SMARCA4_ENST00000358026_chr19_11134194_+_2592nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGAGCAGACACTGCAGCACGGGCAGC
GGCAGTGCCAGCTTCGCCCACACTGCCCCTCCGCCAGCGGGCGTCAACCCCGACTTGGAGGAGCCACCTCTAAAGGAGGAAGACGAGGTG
CCCGACGACGAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAG
GAGGCCCGCAACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGG
CTGACCTGTGAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAG
CAGTGGCTCAAGAAAATTACAGGAAAAGATATCCATGACACAGCCAGCAGTGTGGCACGTGGGCTACAATTCCAGCGTGGCCTTCAGTTC
TGCACACGTGCGTCAAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAG
CGAGACAGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGG
CGGCCGCCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGAC
AGCAGCAGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCC
GTGGACTTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAG
AACGCACAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATC
GAGAAGGAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAA
GTGAAGATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCG

>In-frame_ILF3_ENST00000407004_chr19_10782211_+_SMARCA4_ENST00000344626_chr19_11134194_+_2496nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGAGCAGACACTGCAGCACGGGCAGC
GGCAGTGCCAGCTTCGCCCACACTGCCCCTCCGCCAGCGGGCGTCAACCCCGACTTGGAGGAGCCACCTCTAAAGGAGGAAGACGAGGTG
CCCGACGACGAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAG
GAGGCCCGCAACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGG
CTGACCTGTGAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAG
CAGTGGCTCAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGAC
AGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCG
CCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGC
AGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGAC
TTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCA
CAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAG
GAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAG
ATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTG

>In-frame_ILF3_ENST00000407004_chr19_10782211_+_SMARCA4_ENST00000429416_chr19_11134194_+_2496nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGAGCAGACACTGCAGCACGGGCAGC
GGCAGTGCCAGCTTCGCCCACACTGCCCCTCCGCCAGCGGGCGTCAACCCCGACTTGGAGGAGCCACCTCTAAAGGAGGAAGACGAGGTG
CCCGACGACGAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAG
GAGGCCCGCAACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGG
CTGACCTGTGAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAG
CAGTGGCTCAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGAC
AGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCG
CCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGC
AGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGAC
TTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCA
CAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAG
GAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAG
ATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTG

>In-frame_ILF3_ENST00000407004_chr19_10782211_+_SMARCA4_ENST00000541122_chr19_11134194_+_2406nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGAC
GAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGC
AACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGT
GAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTC
AAGACCCTGAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGAC
AGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCG
CCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGC
AGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGAC
TTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCA
CAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAG
GAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAG
ATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTG

>In-frame_ILF3_ENST00000407004_chr19_10782211_+_SMARCA4_ENST00000589677_chr19_11134194_+_2403nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGAC
GAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGC
AACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGT
GAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTC
AAGACCCTGAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGAC
AGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCG
CCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGT
GGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTC
AAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAG
ACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAG
GATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATC
AAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGT

>In-frame_ILF3_ENST00000407004_chr19_10782211_+_SMARCA4_ENST00000444061_chr19_11134194_+_2394nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGAC
GAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGC
AACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGT
GAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTC
AAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCC
GGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAG
AAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGTGGACGTCAG
CTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATA
AAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAAC
CTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGT
GAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGC
CGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGAC

>In-frame_ILF3_ENST00000407004_chr19_10782211_+_SMARCA4_ENST00000590574_chr19_11134194_+_2397nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGAC
GAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGC
AACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGT
GAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTC
AAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCC
GGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAG
AAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGCAGTGGACGT
CAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAG
ATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTC
AACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGAC
AGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTT
GGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGAT

>In-frame_ILF3_ENST00000407004_chr19_10782211_+_SMARCA4_ENST00000413806_chr19_11134194_+_2406nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGAC
GAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGC
AACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGT
GAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTC
AAGACCCTGAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGAC
AGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCG
CCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGC
AGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGAC
TTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCA
CAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAG
GAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAG
ATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTG

>In-frame_ILF3_ENST00000407004_chr19_10782211_+_SMARCA4_ENST00000450717_chr19_11134194_+_2403nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGAC
GAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGC
AACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGT
GAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTC
AAGACCCTGAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGAC
AGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCG
CCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGT
GGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTC
AAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAG
ACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAG
GATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATC
AAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGT

>In-frame_ILF3_ENST00000589998_chr19_10782211_+_SMARCA4_ENST00000358026_chr19_11134194_+_2592nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGAGCAGACACTGCAGCACGGGCAGC
GGCAGTGCCAGCTTCGCCCACACTGCCCCTCCGCCAGCGGGCGTCAACCCCGACTTGGAGGAGCCACCTCTAAAGGAGGAAGACGAGGTG
CCCGACGACGAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAG
GAGGCCCGCAACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGG
CTGACCTGTGAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAG
CAGTGGCTCAAGAAAATTACAGGAAAAGATATCCATGACACAGCCAGCAGTGTGGCACGTGGGCTACAATTCCAGCGTGGCCTTCAGTTC
TGCACACGTGCGTCAAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAG
CGAGACAGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGG
CGGCCGCCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGAC
AGCAGCAGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCC
GTGGACTTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAG
AACGCACAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATC
GAGAAGGAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAA
GTGAAGATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCG

>In-frame_ILF3_ENST00000589998_chr19_10782211_+_SMARCA4_ENST00000344626_chr19_11134194_+_2496nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGAGCAGACACTGCAGCACGGGCAGC
GGCAGTGCCAGCTTCGCCCACACTGCCCCTCCGCCAGCGGGCGTCAACCCCGACTTGGAGGAGCCACCTCTAAAGGAGGAAGACGAGGTG
CCCGACGACGAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAG
GAGGCCCGCAACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGG
CTGACCTGTGAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAG
CAGTGGCTCAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGAC
AGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCG
CCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGC
AGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGAC
TTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCA
CAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAG
GAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAG
ATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTG

>In-frame_ILF3_ENST00000589998_chr19_10782211_+_SMARCA4_ENST00000429416_chr19_11134194_+_2496nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGAGCAGACACTGCAGCACGGGCAGC
GGCAGTGCCAGCTTCGCCCACACTGCCCCTCCGCCAGCGGGCGTCAACCCCGACTTGGAGGAGCCACCTCTAAAGGAGGAAGACGAGGTG
CCCGACGACGAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAG
GAGGCCCGCAACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGG
CTGACCTGTGAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAG
CAGTGGCTCAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGAC
AGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCG
CCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGC
AGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGAC
TTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCA
CAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAG
GAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAG
ATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTG

>In-frame_ILF3_ENST00000589998_chr19_10782211_+_SMARCA4_ENST00000541122_chr19_11134194_+_2406nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGAC
GAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGC
AACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGT
GAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTC
AAGACCCTGAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGAC
AGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCG
CCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGC
AGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGAC
TTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCA
CAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAG
GAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAG
ATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTG

>In-frame_ILF3_ENST00000589998_chr19_10782211_+_SMARCA4_ENST00000589677_chr19_11134194_+_2403nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGAC
GAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGC
AACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGT
GAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTC
AAGACCCTGAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGAC
AGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCG
CCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGT
GGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTC
AAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAG
ACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAG
GATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATC
AAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGT

>In-frame_ILF3_ENST00000589998_chr19_10782211_+_SMARCA4_ENST00000444061_chr19_11134194_+_2394nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGAC
GAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGC
AACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGT
GAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTC
AAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCC
GGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAG
AAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGTGGACGTCAG
CTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATA
AAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAAC
CTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGT
GAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGC
CGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGAC

>In-frame_ILF3_ENST00000589998_chr19_10782211_+_SMARCA4_ENST00000590574_chr19_11134194_+_2397nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGAC
GAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGC
AACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGT
GAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTC
AAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCC
GGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAG
AAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGCAGTGGACGT
CAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAG
ATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTC
AACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGAC
AGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTT
GGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGAT

>In-frame_ILF3_ENST00000589998_chr19_10782211_+_SMARCA4_ENST00000413806_chr19_11134194_+_2406nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGAC
GAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGC
AACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGT
GAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTC
AAGACCCTGAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGAC
AGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCG
CCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGC
AGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGAC
TTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCA
CAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAG
GAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAG
ATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTG

>In-frame_ILF3_ENST00000589998_chr19_10782211_+_SMARCA4_ENST00000450717_chr19_11134194_+_2403nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGAC
GAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGC
AACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGT
GAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTC
AAGACCCTGAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGAC
AGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCG
CCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGT
GGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTC
AAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAG
ACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAG
GATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATC
AAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGT

>In-frame_ILF3_ENST00000250241_chr19_10782211_+_SMARCA4_ENST00000358026_chr19_11134194_+_2592nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGAGCAGACACTGCAGCACGGGCAGC
GGCAGTGCCAGCTTCGCCCACACTGCCCCTCCGCCAGCGGGCGTCAACCCCGACTTGGAGGAGCCACCTCTAAAGGAGGAAGACGAGGTG
CCCGACGACGAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAG
GAGGCCCGCAACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGG
CTGACCTGTGAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAG
CAGTGGCTCAAGAAAATTACAGGAAAAGATATCCATGACACAGCCAGCAGTGTGGCACGTGGGCTACAATTCCAGCGTGGCCTTCAGTTC
TGCACACGTGCGTCAAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAG
CGAGACAGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGG
CGGCCGCCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGAC
AGCAGCAGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCC
GTGGACTTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAG
AACGCACAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATC
GAGAAGGAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAA
GTGAAGATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCG

>In-frame_ILF3_ENST00000250241_chr19_10782211_+_SMARCA4_ENST00000344626_chr19_11134194_+_2496nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGAGCAGACACTGCAGCACGGGCAGC
GGCAGTGCCAGCTTCGCCCACACTGCCCCTCCGCCAGCGGGCGTCAACCCCGACTTGGAGGAGCCACCTCTAAAGGAGGAAGACGAGGTG
CCCGACGACGAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAG
GAGGCCCGCAACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGG
CTGACCTGTGAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAG
CAGTGGCTCAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGAC
AGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCG
CCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGC
AGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGAC
TTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCA
CAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAG
GAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAG
ATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTG

>In-frame_ILF3_ENST00000250241_chr19_10782211_+_SMARCA4_ENST00000429416_chr19_11134194_+_2496nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGAGCAGACACTGCAGCACGGGCAGC
GGCAGTGCCAGCTTCGCCCACACTGCCCCTCCGCCAGCGGGCGTCAACCCCGACTTGGAGGAGCCACCTCTAAAGGAGGAAGACGAGGTG
CCCGACGACGAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAG
GAGGCCCGCAACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGG
CTGACCTGTGAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAG
CAGTGGCTCAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGAC
AGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCG
CCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGC
AGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGAC
TTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCA
CAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAG
GAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAG
ATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTG

>In-frame_ILF3_ENST00000250241_chr19_10782211_+_SMARCA4_ENST00000541122_chr19_11134194_+_2406nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGAC
GAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGC
AACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGT
GAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTC
AAGACCCTGAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGAC
AGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCG
CCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGC
AGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGAC
TTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCA
CAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAG
GAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAG
ATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTG

>In-frame_ILF3_ENST00000250241_chr19_10782211_+_SMARCA4_ENST00000589677_chr19_11134194_+_2403nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGAC
GAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGC
AACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGT
GAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTC
AAGACCCTGAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGAC
AGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCG
CCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGT
GGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTC
AAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAG
ACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAG
GATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATC
AAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGT

>In-frame_ILF3_ENST00000250241_chr19_10782211_+_SMARCA4_ENST00000444061_chr19_11134194_+_2394nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGAC
GAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGC
AACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGT
GAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTC
AAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCC
GGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAG
AAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGTGGACGTCAG
CTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATA
AAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAAC
CTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGT
GAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGC
CGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGAC

>In-frame_ILF3_ENST00000250241_chr19_10782211_+_SMARCA4_ENST00000590574_chr19_11134194_+_2397nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGAC
GAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGC
AACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGT
GAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTC
AAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCC
GGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAG
AAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGCAGTGGACGT
CAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAG
ATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTC
AACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGAC
AGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTT
GGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGAT

>In-frame_ILF3_ENST00000250241_chr19_10782211_+_SMARCA4_ENST00000413806_chr19_11134194_+_2406nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGAC
GAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGC
AACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGT
GAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTC
AAGACCCTGAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGAC
AGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCG
CCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGC
AGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGAC
TTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCA
CAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAG
GAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAG
ATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTG

>In-frame_ILF3_ENST00000250241_chr19_10782211_+_SMARCA4_ENST00000450717_chr19_11134194_+_2403nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGAC
GAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGC
AACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGT
GAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTC
AAGACCCTGAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGAC
AGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCG
CCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGT
GGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTC
AAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAG
ACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAG
GATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATC
AAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGT

>In-frame_ILF3_ENST00000592763_chr19_10782211_+_SMARCA4_ENST00000358026_chr19_11134194_+_2592nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGAGCAGACACTGCAGCACGGGCAGC
GGCAGTGCCAGCTTCGCCCACACTGCCCCTCCGCCAGCGGGCGTCAACCCCGACTTGGAGGAGCCACCTCTAAAGGAGGAAGACGAGGTG
CCCGACGACGAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAG
GAGGCCCGCAACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGG
CTGACCTGTGAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAG
CAGTGGCTCAAGAAAATTACAGGAAAAGATATCCATGACACAGCCAGCAGTGTGGCACGTGGGCTACAATTCCAGCGTGGCCTTCAGTTC
TGCACACGTGCGTCAAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAG
CGAGACAGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGG
CGGCCGCCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGAC
AGCAGCAGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCC
GTGGACTTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAG
AACGCACAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATC
GAGAAGGAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAA
GTGAAGATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCG

>In-frame_ILF3_ENST00000592763_chr19_10782211_+_SMARCA4_ENST00000344626_chr19_11134194_+_2496nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGAGCAGACACTGCAGCACGGGCAGC
GGCAGTGCCAGCTTCGCCCACACTGCCCCTCCGCCAGCGGGCGTCAACCCCGACTTGGAGGAGCCACCTCTAAAGGAGGAAGACGAGGTG
CCCGACGACGAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAG
GAGGCCCGCAACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGG
CTGACCTGTGAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAG
CAGTGGCTCAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGAC
AGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCG
CCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGC
AGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGAC
TTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCA
CAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAG
GAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAG
ATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTG

>In-frame_ILF3_ENST00000592763_chr19_10782211_+_SMARCA4_ENST00000429416_chr19_11134194_+_2496nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGAGCAGACACTGCAGCACGGGCAGC
GGCAGTGCCAGCTTCGCCCACACTGCCCCTCCGCCAGCGGGCGTCAACCCCGACTTGGAGGAGCCACCTCTAAAGGAGGAAGACGAGGTG
CCCGACGACGAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAG
GAGGCCCGCAACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGG
CTGACCTGTGAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAG
CAGTGGCTCAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGAC
AGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCG
CCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGC
AGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGAC
TTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCA
CAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAG
GAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAG
ATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTG

>In-frame_ILF3_ENST00000592763_chr19_10782211_+_SMARCA4_ENST00000541122_chr19_11134194_+_2406nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGAC
GAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGC
AACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGT
GAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTC
AAGACCCTGAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGAC
AGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCG
CCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGC
AGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGAC
TTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCA
CAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAG
GAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAG
ATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTG

>In-frame_ILF3_ENST00000592763_chr19_10782211_+_SMARCA4_ENST00000589677_chr19_11134194_+_2403nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGAC
GAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGC
AACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGT
GAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTC
AAGACCCTGAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGAC
AGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCG
CCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGT
GGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTC
AAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAG
ACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAG
GATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATC
AAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGT

>In-frame_ILF3_ENST00000592763_chr19_10782211_+_SMARCA4_ENST00000444061_chr19_11134194_+_2394nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGAC
GAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGC
AACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGT
GAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTC
AAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCC
GGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAG
AAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGTGGACGTCAG
CTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATA
AAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAAC
CTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGT
GAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGC
CGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGAC

>In-frame_ILF3_ENST00000592763_chr19_10782211_+_SMARCA4_ENST00000590574_chr19_11134194_+_2397nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGAC
GAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGC
AACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGT
GAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTC
AAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCC
GGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAG
AAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGCAGTGGACGT
CAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAG
ATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTC
AACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGAC
AGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTT
GGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGAT

>In-frame_ILF3_ENST00000592763_chr19_10782211_+_SMARCA4_ENST00000413806_chr19_11134194_+_2406nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGAC
GAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGC
AACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGT
GAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTC
AAGACCCTGAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGAC
AGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCG
CCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGC
AGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGAC
TTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCA
CAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAG
GAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAG
ATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTG

>In-frame_ILF3_ENST00000592763_chr19_10782211_+_SMARCA4_ENST00000450717_chr19_11134194_+_2403nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGAC
GAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGC
AACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGT
GAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTC
AAGACCCTGAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGAC
AGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCG
CCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGT
GGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTC
AAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAG
ACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAG
GATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATC
AAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGT

>In-frame_ILF3_ENST00000588657_chr19_10782211_+_SMARCA4_ENST00000358026_chr19_11134194_+_2592nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGAGCAGACACTGCAGCACGGGCAGC
GGCAGTGCCAGCTTCGCCCACACTGCCCCTCCGCCAGCGGGCGTCAACCCCGACTTGGAGGAGCCACCTCTAAAGGAGGAAGACGAGGTG
CCCGACGACGAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAG
GAGGCCCGCAACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGG
CTGACCTGTGAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAG
CAGTGGCTCAAGAAAATTACAGGAAAAGATATCCATGACACAGCCAGCAGTGTGGCACGTGGGCTACAATTCCAGCGTGGCCTTCAGTTC
TGCACACGTGCGTCAAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAG
CGAGACAGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGG
CGGCCGCCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGAC
AGCAGCAGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCC
GTGGACTTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAG
AACGCACAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATC
GAGAAGGAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAA
GTGAAGATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCG

>In-frame_ILF3_ENST00000588657_chr19_10782211_+_SMARCA4_ENST00000344626_chr19_11134194_+_2496nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGAGCAGACACTGCAGCACGGGCAGC
GGCAGTGCCAGCTTCGCCCACACTGCCCCTCCGCCAGCGGGCGTCAACCCCGACTTGGAGGAGCCACCTCTAAAGGAGGAAGACGAGGTG
CCCGACGACGAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAG
GAGGCCCGCAACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGG
CTGACCTGTGAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAG
CAGTGGCTCAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGAC
AGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCG
CCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGC
AGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGAC
TTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCA
CAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAG
GAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAG
ATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTG

>In-frame_ILF3_ENST00000588657_chr19_10782211_+_SMARCA4_ENST00000429416_chr19_11134194_+_2496nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGAGCAGACACTGCAGCACGGGCAGC
GGCAGTGCCAGCTTCGCCCACACTGCCCCTCCGCCAGCGGGCGTCAACCCCGACTTGGAGGAGCCACCTCTAAAGGAGGAAGACGAGGTG
CCCGACGACGAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAG
GAGGCCCGCAACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGG
CTGACCTGTGAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAG
CAGTGGCTCAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGAC
AGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCG
CCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGC
AGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGAC
TTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCA
CAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAG
GAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAG
ATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTG

>In-frame_ILF3_ENST00000588657_chr19_10782211_+_SMARCA4_ENST00000541122_chr19_11134194_+_2406nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGAC
GAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGC
AACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGT
GAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTC
AAGACCCTGAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGAC
AGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCG
CCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGC
AGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGAC
TTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCA
CAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAG
GAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAG
ATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTG

>In-frame_ILF3_ENST00000588657_chr19_10782211_+_SMARCA4_ENST00000589677_chr19_11134194_+_2403nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGAC
GAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGC
AACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGT
GAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTC
AAGACCCTGAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGAC
AGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCG
CCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGT
GGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTC
AAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAG
ACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAG
GATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATC
AAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGT

>In-frame_ILF3_ENST00000588657_chr19_10782211_+_SMARCA4_ENST00000444061_chr19_11134194_+_2394nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGAC
GAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGC
AACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGT
GAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTC
AAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCC
GGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAG
AAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGTGGACGTCAG
CTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATA
AAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAAC
CTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGT
GAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGC
CGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGAC

>In-frame_ILF3_ENST00000588657_chr19_10782211_+_SMARCA4_ENST00000590574_chr19_11134194_+_2397nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGAC
GAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGC
AACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGT
GAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTC
AAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCC
GGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAG
AAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGCAGTGGACGT
CAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAG
ATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTC
AACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGAC
AGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTT
GGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGAT

>In-frame_ILF3_ENST00000588657_chr19_10782211_+_SMARCA4_ENST00000413806_chr19_11134194_+_2406nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGAC
GAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGC
AACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGT
GAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTC
AAGACCCTGAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGAC
AGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCG
CCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGC
AGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGAC
TTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCA
CAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAG
GAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAG
ATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTG

>In-frame_ILF3_ENST00000588657_chr19_10782211_+_SMARCA4_ENST00000450717_chr19_11134194_+_2403nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGAC
GAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGC
AACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGT
GAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTC
AAGACCCTGAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGAC
AGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCG
CCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGT
GGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTC
AAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAG
ACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAG
GATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATC
AAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGT

>In-frame_ILF3_ENST00000590261_chr19_10782211_+_SMARCA4_ENST00000358026_chr19_11134194_+_2592nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGAGCAGACACTGCAGCACGGGCAGC
GGCAGTGCCAGCTTCGCCCACACTGCCCCTCCGCCAGCGGGCGTCAACCCCGACTTGGAGGAGCCACCTCTAAAGGAGGAAGACGAGGTG
CCCGACGACGAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAG
GAGGCCCGCAACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGG
CTGACCTGTGAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAG
CAGTGGCTCAAGAAAATTACAGGAAAAGATATCCATGACACAGCCAGCAGTGTGGCACGTGGGCTACAATTCCAGCGTGGCCTTCAGTTC
TGCACACGTGCGTCAAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAG
CGAGACAGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGG
CGGCCGCCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGAC
AGCAGCAGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCC
GTGGACTTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAG
AACGCACAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATC
GAGAAGGAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAA
GTGAAGATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCG

>In-frame_ILF3_ENST00000590261_chr19_10782211_+_SMARCA4_ENST00000344626_chr19_11134194_+_2496nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGAGCAGACACTGCAGCACGGGCAGC
GGCAGTGCCAGCTTCGCCCACACTGCCCCTCCGCCAGCGGGCGTCAACCCCGACTTGGAGGAGCCACCTCTAAAGGAGGAAGACGAGGTG
CCCGACGACGAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAG
GAGGCCCGCAACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGG
CTGACCTGTGAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAG
CAGTGGCTCAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGAC
AGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCG
CCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGC
AGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGAC
TTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCA
CAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAG
GAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAG
ATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTG

>In-frame_ILF3_ENST00000590261_chr19_10782211_+_SMARCA4_ENST00000429416_chr19_11134194_+_2496nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGAGCAGACACTGCAGCACGGGCAGC
GGCAGTGCCAGCTTCGCCCACACTGCCCCTCCGCCAGCGGGCGTCAACCCCGACTTGGAGGAGCCACCTCTAAAGGAGGAAGACGAGGTG
CCCGACGACGAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAG
GAGGCCCGCAACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGG
CTGACCTGTGAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAG
CAGTGGCTCAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGAC
AGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCG
CCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGC
AGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGAC
TTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCA
CAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAG
GAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAG
ATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTG

>In-frame_ILF3_ENST00000590261_chr19_10782211_+_SMARCA4_ENST00000541122_chr19_11134194_+_2406nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGAC
GAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGC
AACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGT
GAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTC
AAGACCCTGAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGAC
AGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCG
CCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGC
AGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGAC
TTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCA
CAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAG
GAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAG
ATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTG

>In-frame_ILF3_ENST00000590261_chr19_10782211_+_SMARCA4_ENST00000589677_chr19_11134194_+_2403nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGAC
GAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGC
AACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGT
GAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTC
AAGACCCTGAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGAC
AGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCG
CCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGT
GGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTC
AAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAG
ACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAG
GATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATC
AAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGT

>In-frame_ILF3_ENST00000590261_chr19_10782211_+_SMARCA4_ENST00000444061_chr19_11134194_+_2394nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGAC
GAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGC
AACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGT
GAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTC
AAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCC
GGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAG
AAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGTGGACGTCAG
CTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATA
AAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAAC
CTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGT
GAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGC
CGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGAC

>In-frame_ILF3_ENST00000590261_chr19_10782211_+_SMARCA4_ENST00000590574_chr19_11134194_+_2397nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGAC
GAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGC
AACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGT
GAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTC
AAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCC
GGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAG
AAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGCAGTGGACGT
CAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAG
ATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTC
AACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGAC
AGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTT
GGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGAT

>In-frame_ILF3_ENST00000590261_chr19_10782211_+_SMARCA4_ENST00000413806_chr19_11134194_+_2406nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGAC
GAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGC
AACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGT
GAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTC
AAGACCCTGAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGAC
AGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCG
CCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGC
AGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGAC
TTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCA
CAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAG
GAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAG
ATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTG

>In-frame_ILF3_ENST00000590261_chr19_10782211_+_SMARCA4_ENST00000450717_chr19_11134194_+_2403nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGAC
GAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGC
AACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGT
GAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTC
AAGACCCTGAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGAC
AGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCG
CCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGT
GGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTC
AAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAG
ACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAG
GATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATC
AAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGT


* Fusion transcript sequences (Full-length transcript).
>In-frame_ILF3_ENST00000420083_chr19_10782211_+_SMARCA4_ENST00000358026_chr19_11134194_+_3375nt
AAAGGGGGCGGGGCTTCAGCCGGTCACGTGTTCCCGCACCTCCCCGGCGCGCGCCTGCCCGCCCGCCCGCTCGCCCCCGGTCCGGACTCC
TCCTCCTCCTCTTCTCGCCATTGCAGTTGGACCCAGCAGCCCGGCGCGCACCGCGTGGCTTTTGGGGGCAGACCCCGGCGGGCTGTGGCA
GGAGGGCGGCGGCGGCGGCTGCGGTCGAAGAAGGGGACGCCGACAAGAGTTGAAGTATTGATAACACCAAGGAACTCTATCACAATTTGA
AAAGATAAGCAAAAGTTTGATTTCCAGACACTACAGAAGAAGTAAAAATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGA
TGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCAGTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTG
TGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCAGAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAG
AAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGGGGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCA
AGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCCACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCC
AGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGGCGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCA
AGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATCAAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACA
TGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAGAAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGC
AGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAGGAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCC
AAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGATAGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGC
TGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTTGCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGA
AGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGCTCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGC
TCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGCGACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCC
ACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACCGTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACA
AGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAGAAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCC
TGGAGCACGAGGAGCAGGATGAGAGCAGACACTGCAGCACGGGCAGCGGCAGTGCCAGCTTCGCCCACACTGCCCCTCCGCCAGCGGGCG
TCAACCCCGACTTGGAGGAGCCACCTCTAAAGGAGGAAGACGAGGTGCCCGACGACGAGACCGTCAACCAGATGATCGCCCGGCACGAGG
AGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGCAACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGG
ACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGTGAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCT
CCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTCAAGAAAATTACAGGAAAAGATATCCATGACACAG
CCAGCAGTGTGGCACGTGGGCTACAATTCCAGCGTGGCCTTCAGTTCTGCACACGTGCGTCAAAGGCCATCGAGGAGGGCACGCTGGAGG
AGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCC
GCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCA
CCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGCAGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGC
CCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGT
ACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAG
ACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGG
AAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGC
TGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGACAGTGAGGAGGAACAAGAGGAGGACC
GCTCAGGAAGTGGCAGCGAAGAAGACTGAGCCCCGACATTCCAGTCTCGACCCCGAGCCCCTCGTTCCAGAGCTGAGATGGCATAGGCCT
TAGCAGTAACGGGTAGCAGCAGATGTAGTTTCAGACTTGGAGTAAAACTGTATAAACAAAAGAATCTTCCATATTTATACAGCAGAGAAG
CTGTAGGACTGTTTGTGACTGGCCCTGTCCTGGCATCAGTAGCATCTGTAACAGCATTAACTGTCTTAAAGAGAGAGAGAGAGAATTCCG
AATTGGGGAACACACGATACCTGTTTTTCTTTTCCGTTGCTGGCAGTACTGTTGCGCCGCAGTTTGGAGTCACTGTAGTTAAGTGTGGAT
GCATGTGCGTCACCGTCCACTCCTCCTACTGTATTTTATTGGACAGGTCAGACTCGCCGGGGGCCCGGCGAGGGTATGTCAGTGTCACTG

>In-frame_ILF3_ENST00000420083_chr19_10782211_+_SMARCA4_ENST00000344626_chr19_11134194_+_3056nt
AAAGGGGGCGGGGCTTCAGCCGGTCACGTGTTCCCGCACCTCCCCGGCGCGCGCCTGCCCGCCCGCCCGCTCGCCCCCGGTCCGGACTCC
TCCTCCTCCTCTTCTCGCCATTGCAGTTGGACCCAGCAGCCCGGCGCGCACCGCGTGGCTTTTGGGGGCAGACCCCGGCGGGCTGTGGCA
GGAGGGCGGCGGCGGCGGCTGCGGTCGAAGAAGGGGACGCCGACAAGAGTTGAAGTATTGATAACACCAAGGAACTCTATCACAATTTGA
AAAGATAAGCAAAAGTTTGATTTCCAGACACTACAGAAGAAGTAAAAATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGA
TGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCAGTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTG
TGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCAGAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAG
AAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGGGGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCA
AGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCCACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCC
AGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGGCGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCA
AGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATCAAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACA
TGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAGAAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGC
AGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAGGAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCC
AAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGATAGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGC
TGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTTGCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGA
AGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGCTCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGC
TCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGCGACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCC
ACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACCGTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACA
AGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAGAAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCC
TGGAGCACGAGGAGCAGGATGAGAGCAGACACTGCAGCACGGGCAGCGGCAGTGCCAGCTTCGCCCACACTGCCCCTCCGCCAGCGGGCG
TCAACCCCGACTTGGAGGAGCCACCTCTAAAGGAGGAAGACGAGGTGCCCGACGACGAGACCGTCAACCAGATGATCGCCCGGCACGAGG
AGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGCAACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGG
ACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGTGAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCT
CCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTCAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCG
AAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCC
GCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGA
AGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGCAGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGC
GAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCA
GCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCA
TCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGG
GCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGG
GCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGACAGTGAGGAGGAACAAGAGGAGGACCGCTCAG
GAAGTGGCAGCGAAGAAGACTGAGCCCCGACATTCCAGTCTCGACCCCGAGCCCCTCGTTCCAGAGCTGAGATGGCATAGGCCTTAGCAG
TAACGGGTAGCAGCAGATGTAGTTTCAGACTTGGAGTAAAACTGTATAAACAAAAGAATCTTCCATATTTATACAGCAGAGAAGCTGTAG

>In-frame_ILF3_ENST00000420083_chr19_10782211_+_SMARCA4_ENST00000429416_chr19_11134194_+_3279nt
AAAGGGGGCGGGGCTTCAGCCGGTCACGTGTTCCCGCACCTCCCCGGCGCGCGCCTGCCCGCCCGCCCGCTCGCCCCCGGTCCGGACTCC
TCCTCCTCCTCTTCTCGCCATTGCAGTTGGACCCAGCAGCCCGGCGCGCACCGCGTGGCTTTTGGGGGCAGACCCCGGCGGGCTGTGGCA
GGAGGGCGGCGGCGGCGGCTGCGGTCGAAGAAGGGGACGCCGACAAGAGTTGAAGTATTGATAACACCAAGGAACTCTATCACAATTTGA
AAAGATAAGCAAAAGTTTGATTTCCAGACACTACAGAAGAAGTAAAAATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGA
TGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCAGTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTG
TGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCAGAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAG
AAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGGGGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCA
AGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCCACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCC
AGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGGCGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCA
AGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATCAAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACA
TGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAGAAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGC
AGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAGGAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCC
AAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGATAGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGC
TGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTTGCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGA
AGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGCTCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGC
TCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGCGACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCC
ACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACCGTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACA
AGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAGAAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCC
TGGAGCACGAGGAGCAGGATGAGAGCAGACACTGCAGCACGGGCAGCGGCAGTGCCAGCTTCGCCCACACTGCCCCTCCGCCAGCGGGCG
TCAACCCCGACTTGGAGGAGCCACCTCTAAAGGAGGAAGACGAGGTGCCCGACGACGAGACCGTCAACCAGATGATCGCCCGGCACGAGG
AGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGCAACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGG
ACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGTGAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCT
CCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTCAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCG
AAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCC
GCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGA
AGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGCAGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGC
GAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCA
GCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCA
TCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGG
GCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGG
GCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGACAGTGAGGAGGAACAAGAGGAGGACCGCTCAG
GAAGTGGCAGCGAAGAAGACTGAGCCCCGACATTCCAGTCTCGACCCCGAGCCCCTCGTTCCAGAGCTGAGATGGCATAGGCCTTAGCAG
TAACGGGTAGCAGCAGATGTAGTTTCAGACTTGGAGTAAAACTGTATAAACAAAAGAATCTTCCATATTTATACAGCAGAGAAGCTGTAG
GACTGTTTGTGACTGGCCCTGTCCTGGCATCAGTAGCATCTGTAACAGCATTAACTGTCTTAAAGAGAGAGAGAGAGAATTCCGAATTGG
GGAACACACGATACCTGTTTTTCTTTTCCGTTGCTGGCAGTACTGTTGCGCCGCAGTTTGGAGTCACTGTAGTTAAGTGTGGATGCATGT
GCGTCACCGTCCACTCCTCCTACTGTATTTTATTGGACAGGTCAGACTCGCCGGGGGCCCGGCGAGGGTATGTCAGTGTCACTGGATGTC

>In-frame_ILF3_ENST00000420083_chr19_10782211_+_SMARCA4_ENST00000541122_chr19_11134194_+_2723nt
AAAGGGGGCGGGGCTTCAGCCGGTCACGTGTTCCCGCACCTCCCCGGCGCGCGCCTGCCCGCCCGCCCGCTCGCCCCCGGTCCGGACTCC
TCCTCCTCCTCTTCTCGCCATTGCAGTTGGACCCAGCAGCCCGGCGCGCACCGCGTGGCTTTTGGGGGCAGACCCCGGCGGGCTGTGGCA
GGAGGGCGGCGGCGGCGGCTGCGGTCGAAGAAGGGGACGCCGACAAGAGTTGAAGTATTGATAACACCAAGGAACTCTATCACAATTTGA
AAAGATAAGCAAAAGTTTGATTTCCAGACACTACAGAAGAAGTAAAAATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGA
TGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCAGTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTG
TGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCAGAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAG
AAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGGGGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCA
AGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCCACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCC
AGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGGCGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCA
AGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATCAAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACA
TGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAGAAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGC
AGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAGGAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCC
AAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGATAGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGC
TGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTTGCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGA
AGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGCTCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGC
TCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGCGACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCC
ACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACCGTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACA
AGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAGAAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCC
TGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGACGAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTG
ATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGCAACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCC
CCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGTGAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACC
GCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTCAAGACCCTGAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCG
AAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCC
GCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGA
AGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGCAGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGC
GAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCA
GCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCA
TCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGG
GCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGG
GCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGACAGTGAGGAGGAACAAGAGGAGGACCGCTCAG

>In-frame_ILF3_ENST00000420083_chr19_10782211_+_SMARCA4_ENST00000589677_chr19_11134194_+_2720nt
AAAGGGGGCGGGGCTTCAGCCGGTCACGTGTTCCCGCACCTCCCCGGCGCGCGCCTGCCCGCCCGCCCGCTCGCCCCCGGTCCGGACTCC
TCCTCCTCCTCTTCTCGCCATTGCAGTTGGACCCAGCAGCCCGGCGCGCACCGCGTGGCTTTTGGGGGCAGACCCCGGCGGGCTGTGGCA
GGAGGGCGGCGGCGGCGGCTGCGGTCGAAGAAGGGGACGCCGACAAGAGTTGAAGTATTGATAACACCAAGGAACTCTATCACAATTTGA
AAAGATAAGCAAAAGTTTGATTTCCAGACACTACAGAAGAAGTAAAAATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGA
TGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCAGTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTG
TGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCAGAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAG
AAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGGGGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCA
AGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCCACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCC
AGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGGCGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCA
AGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATCAAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACA
TGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAGAAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGC
AGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAGGAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCC
AAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGATAGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGC
TGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTTGCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGA
AGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGCTCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGC
TCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGCGACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCC
ACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACCGTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACA
AGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAGAAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCC
TGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGACGAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTG
ATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGCAACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCC
CCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGTGAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACC
GCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTCAAGACCCTGAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCG
AAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCC
GCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGA
AGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAA
AGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCC
TCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCG
TCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCG
AGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCG
GCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGACAGTGAGGAGGAACAAGAGGAGGACCGCTCAGGAA

>In-frame_ILF3_ENST00000420083_chr19_10782211_+_SMARCA4_ENST00000444061_chr19_11134194_+_2711nt
AAAGGGGGCGGGGCTTCAGCCGGTCACGTGTTCCCGCACCTCCCCGGCGCGCGCCTGCCCGCCCGCCCGCTCGCCCCCGGTCCGGACTCC
TCCTCCTCCTCTTCTCGCCATTGCAGTTGGACCCAGCAGCCCGGCGCGCACCGCGTGGCTTTTGGGGGCAGACCCCGGCGGGCTGTGGCA
GGAGGGCGGCGGCGGCGGCTGCGGTCGAAGAAGGGGACGCCGACAAGAGTTGAAGTATTGATAACACCAAGGAACTCTATCACAATTTGA
AAAGATAAGCAAAAGTTTGATTTCCAGACACTACAGAAGAAGTAAAAATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGA
TGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCAGTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTG
TGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCAGAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAG
AAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGGGGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCA
AGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCCACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCC
AGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGGCGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCA
AGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATCAAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACA
TGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAGAAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGC
AGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAGGAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCC
AAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGATAGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGC
TGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTTGCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGA
AGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGCTCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGC
TCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGCGACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCC
ACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACCGTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACA
AGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAGAAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCC
TGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGACGAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTG
ATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGCAACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCC
CCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGTGAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACC
GCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTCAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGG
TCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGG
ACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGA
AGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGC
CCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACC
TAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGT
CGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAG
GCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGC
GGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGACAGTGAGGAGGAACAAGAGGAGGACCGCTCAGGAAGTGGCAGCG

>In-frame_ILF3_ENST00000420083_chr19_10782211_+_SMARCA4_ENST00000590574_chr19_11134194_+_2714nt
AAAGGGGGCGGGGCTTCAGCCGGTCACGTGTTCCCGCACCTCCCCGGCGCGCGCCTGCCCGCCCGCCCGCTCGCCCCCGGTCCGGACTCC
TCCTCCTCCTCTTCTCGCCATTGCAGTTGGACCCAGCAGCCCGGCGCGCACCGCGTGGCTTTTGGGGGCAGACCCCGGCGGGCTGTGGCA
GGAGGGCGGCGGCGGCGGCTGCGGTCGAAGAAGGGGACGCCGACAAGAGTTGAAGTATTGATAACACCAAGGAACTCTATCACAATTTGA
AAAGATAAGCAAAAGTTTGATTTCCAGACACTACAGAAGAAGTAAAAATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGA
TGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCAGTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTG
TGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCAGAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAG
AAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGGGGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCA
AGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCCACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCC
AGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGGCGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCA
AGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATCAAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACA
TGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAGAAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGC
AGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAGGAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCC
AAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGATAGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGC
TGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTTGCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGA
AGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGCTCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGC
TCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGCGACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCC
ACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACCGTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACA
AGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAGAAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCC
TGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGACGAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTG
ATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGCAACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCC
CCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGTGAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACC
GCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTCAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGG
TCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGG
ACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGA
AGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGCAGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGC
TGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACG
ACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGC
AGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGG
AAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGC
GGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGACAGTGAGGAGGAACAAGAGGAGGACCGCTCAGGAAGTGGCA

>In-frame_ILF3_ENST00000420083_chr19_10782211_+_SMARCA4_ENST00000413806_chr19_11134194_+_3189nt
AAAGGGGGCGGGGCTTCAGCCGGTCACGTGTTCCCGCACCTCCCCGGCGCGCGCCTGCCCGCCCGCCCGCTCGCCCCCGGTCCGGACTCC
TCCTCCTCCTCTTCTCGCCATTGCAGTTGGACCCAGCAGCCCGGCGCGCACCGCGTGGCTTTTGGGGGCAGACCCCGGCGGGCTGTGGCA
GGAGGGCGGCGGCGGCGGCTGCGGTCGAAGAAGGGGACGCCGACAAGAGTTGAAGTATTGATAACACCAAGGAACTCTATCACAATTTGA
AAAGATAAGCAAAAGTTTGATTTCCAGACACTACAGAAGAAGTAAAAATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGA
TGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCAGTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTG
TGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCAGAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAG
AAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGGGGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCA
AGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCCACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCC
AGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGGCGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCA
AGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATCAAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACA
TGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAGAAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGC
AGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAGGAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCC
AAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGATAGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGC
TGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTTGCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGA
AGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGCTCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGC
TCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGCGACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCC
ACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACCGTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACA
AGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAGAAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCC
TGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGACGAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTG
ATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGCAACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCC
CCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGTGAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACC
GCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTCAAGACCCTGAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCG
AAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCC
GCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGA
AGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGCAGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGC
GAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCA
GCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCA
TCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGG
GCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGG
GCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGACAGTGAGGAGGAACAAGAGGAGGACCGCTCAG
GAAGTGGCAGCGAAGAAGACTGAGCCCCGACATTCCAGTCTCGACCCCGAGCCCCTCGTTCCAGAGCTGAGATGGCATAGGCCTTAGCAG
TAACGGGTAGCAGCAGATGTAGTTTCAGACTTGGAGTAAAACTGTATAAACAAAAGAATCTTCCATATTTATACAGCAGAGAAGCTGTAG
GACTGTTTGTGACTGGCCCTGTCCTGGCATCAGTAGCATCTGTAACAGCATTAACTGTCTTAAAGAGAGAGAGAGAGAATTCCGAATTGG
GGAACACACGATACCTGTTTTTCTTTTCCGTTGCTGGCAGTACTGTTGCGCCGCAGTTTGGAGTCACTGTAGTTAAGTGTGGATGCATGT
GCGTCACCGTCCACTCCTCCTACTGTATTTTATTGGACAGGTCAGACTCGCCGGGGGCCCGGCGAGGGTATGTCAGTGTCACTGGATGTC

>In-frame_ILF3_ENST00000420083_chr19_10782211_+_SMARCA4_ENST00000450717_chr19_11134194_+_3186nt
AAAGGGGGCGGGGCTTCAGCCGGTCACGTGTTCCCGCACCTCCCCGGCGCGCGCCTGCCCGCCCGCCCGCTCGCCCCCGGTCCGGACTCC
TCCTCCTCCTCTTCTCGCCATTGCAGTTGGACCCAGCAGCCCGGCGCGCACCGCGTGGCTTTTGGGGGCAGACCCCGGCGGGCTGTGGCA
GGAGGGCGGCGGCGGCGGCTGCGGTCGAAGAAGGGGACGCCGACAAGAGTTGAAGTATTGATAACACCAAGGAACTCTATCACAATTTGA
AAAGATAAGCAAAAGTTTGATTTCCAGACACTACAGAAGAAGTAAAAATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGA
TGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCAGTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTG
TGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCAGAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAG
AAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGGGGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCA
AGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCCACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCC
AGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGGCGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCA
AGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATCAAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACA
TGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAGAAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGC
AGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAGGAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCC
AAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGATAGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGC
TGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTTGCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGA
AGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGCTCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGC
TCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGCGACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCC
ACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACCGTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACA
AGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAGAAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCC
TGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGACGAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTG
ATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGCAACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCC
CCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGTGAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACC
GCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTCAAGACCCTGAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCG
AAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCC
GCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGA
AGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAA
AGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCC
TCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCG
TCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCG
AGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCG
GCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGACAGTGAGGAGGAACAAGAGGAGGACCGCTCAGGAA
GTGGCAGCGAAGAAGACTGAGCCCCGACATTCCAGTCTCGACCCCGAGCCCCTCGTTCCAGAGCTGAGATGGCATAGGCCTTAGCAGTAA
CGGGTAGCAGCAGATGTAGTTTCAGACTTGGAGTAAAACTGTATAAACAAAAGAATCTTCCATATTTATACAGCAGAGAAGCTGTAGGAC
TGTTTGTGACTGGCCCTGTCCTGGCATCAGTAGCATCTGTAACAGCATTAACTGTCTTAAAGAGAGAGAGAGAGAATTCCGAATTGGGGA
ACACACGATACCTGTTTTTCTTTTCCGTTGCTGGCAGTACTGTTGCGCCGCAGTTTGGAGTCACTGTAGTTAAGTGTGGATGCATGTGCG
TCACCGTCCACTCCTCCTACTGTATTTTATTGGACAGGTCAGACTCGCCGGGGGCCCGGCGAGGGTATGTCAGTGTCACTGGATGTCAAA

>In-frame_ILF3_ENST00000449870_chr19_10782211_+_SMARCA4_ENST00000358026_chr19_11134194_+_3375nt
AAAGGGGGCGGGGCTTCAGCCGGTCACGTGTTCCCGCACCTCCCCGGCGCGCGCCTGCCCGCCCGCCCGCTCGCCCCCGGTCCGGACTCC
TCCTCCTCCTCTTCTCGCCATTGCAGTTGGACCCAGCAGCCCGGCGCGCACCGCGTGGCTTTTGGGGGCAGACCCCGGCGGGCTGTGGCA
GGAGGGCGGCGGCGGCGGCTGCGGTCGAAGAAGGGGACGCCGACAAGAGTTGAAGTATTGATAACACCAAGGAACTCTATCACAATTTGA
AAAGATAAGCAAAAGTTTGATTTCCAGACACTACAGAAGAAGTAAAAATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGA
TGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCAGTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTG
TGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCAGAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAG
AAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGGGGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCA
AGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCCACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCC
AGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGGCGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCA
AGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATCAAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACA
TGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAGAAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGC
AGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAGGAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCC
AAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGATAGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGC
TGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTTGCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGA
AGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGCTCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGC
TCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGCGACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCC
ACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACCGTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACA
AGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAGAAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCC
TGGAGCACGAGGAGCAGGATGAGAGCAGACACTGCAGCACGGGCAGCGGCAGTGCCAGCTTCGCCCACACTGCCCCTCCGCCAGCGGGCG
TCAACCCCGACTTGGAGGAGCCACCTCTAAAGGAGGAAGACGAGGTGCCCGACGACGAGACCGTCAACCAGATGATCGCCCGGCACGAGG
AGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGCAACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGG
ACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGTGAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCT
CCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTCAAGAAAATTACAGGAAAAGATATCCATGACACAG
CCAGCAGTGTGGCACGTGGGCTACAATTCCAGCGTGGCCTTCAGTTCTGCACACGTGCGTCAAAGGCCATCGAGGAGGGCACGCTGGAGG
AGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCC
GCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCA
CCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGCAGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGC
CCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGT
ACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAG
ACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGG
AAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGC
TGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGACAGTGAGGAGGAACAAGAGGAGGACC
GCTCAGGAAGTGGCAGCGAAGAAGACTGAGCCCCGACATTCCAGTCTCGACCCCGAGCCCCTCGTTCCAGAGCTGAGATGGCATAGGCCT
TAGCAGTAACGGGTAGCAGCAGATGTAGTTTCAGACTTGGAGTAAAACTGTATAAACAAAAGAATCTTCCATATTTATACAGCAGAGAAG
CTGTAGGACTGTTTGTGACTGGCCCTGTCCTGGCATCAGTAGCATCTGTAACAGCATTAACTGTCTTAAAGAGAGAGAGAGAGAATTCCG
AATTGGGGAACACACGATACCTGTTTTTCTTTTCCGTTGCTGGCAGTACTGTTGCGCCGCAGTTTGGAGTCACTGTAGTTAAGTGTGGAT
GCATGTGCGTCACCGTCCACTCCTCCTACTGTATTTTATTGGACAGGTCAGACTCGCCGGGGGCCCGGCGAGGGTATGTCAGTGTCACTG

>In-frame_ILF3_ENST00000449870_chr19_10782211_+_SMARCA4_ENST00000344626_chr19_11134194_+_3056nt
AAAGGGGGCGGGGCTTCAGCCGGTCACGTGTTCCCGCACCTCCCCGGCGCGCGCCTGCCCGCCCGCCCGCTCGCCCCCGGTCCGGACTCC
TCCTCCTCCTCTTCTCGCCATTGCAGTTGGACCCAGCAGCCCGGCGCGCACCGCGTGGCTTTTGGGGGCAGACCCCGGCGGGCTGTGGCA
GGAGGGCGGCGGCGGCGGCTGCGGTCGAAGAAGGGGACGCCGACAAGAGTTGAAGTATTGATAACACCAAGGAACTCTATCACAATTTGA
AAAGATAAGCAAAAGTTTGATTTCCAGACACTACAGAAGAAGTAAAAATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGA
TGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCAGTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTG
TGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCAGAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAG
AAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGGGGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCA
AGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCCACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCC
AGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGGCGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCA
AGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATCAAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACA
TGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAGAAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGC
AGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAGGAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCC
AAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGATAGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGC
TGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTTGCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGA
AGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGCTCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGC
TCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGCGACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCC
ACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACCGTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACA
AGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAGAAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCC
TGGAGCACGAGGAGCAGGATGAGAGCAGACACTGCAGCACGGGCAGCGGCAGTGCCAGCTTCGCCCACACTGCCCCTCCGCCAGCGGGCG
TCAACCCCGACTTGGAGGAGCCACCTCTAAAGGAGGAAGACGAGGTGCCCGACGACGAGACCGTCAACCAGATGATCGCCCGGCACGAGG
AGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGCAACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGG
ACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGTGAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCT
CCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTCAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCG
AAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCC
GCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGA
AGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGCAGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGC
GAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCA
GCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCA
TCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGG
GCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGG
GCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGACAGTGAGGAGGAACAAGAGGAGGACCGCTCAG
GAAGTGGCAGCGAAGAAGACTGAGCCCCGACATTCCAGTCTCGACCCCGAGCCCCTCGTTCCAGAGCTGAGATGGCATAGGCCTTAGCAG
TAACGGGTAGCAGCAGATGTAGTTTCAGACTTGGAGTAAAACTGTATAAACAAAAGAATCTTCCATATTTATACAGCAGAGAAGCTGTAG

>In-frame_ILF3_ENST00000449870_chr19_10782211_+_SMARCA4_ENST00000429416_chr19_11134194_+_3279nt
AAAGGGGGCGGGGCTTCAGCCGGTCACGTGTTCCCGCACCTCCCCGGCGCGCGCCTGCCCGCCCGCCCGCTCGCCCCCGGTCCGGACTCC
TCCTCCTCCTCTTCTCGCCATTGCAGTTGGACCCAGCAGCCCGGCGCGCACCGCGTGGCTTTTGGGGGCAGACCCCGGCGGGCTGTGGCA
GGAGGGCGGCGGCGGCGGCTGCGGTCGAAGAAGGGGACGCCGACAAGAGTTGAAGTATTGATAACACCAAGGAACTCTATCACAATTTGA
AAAGATAAGCAAAAGTTTGATTTCCAGACACTACAGAAGAAGTAAAAATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGA
TGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCAGTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTG
TGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCAGAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAG
AAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGGGGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCA
AGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCCACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCC
AGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGGCGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCA
AGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATCAAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACA
TGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAGAAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGC
AGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAGGAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCC
AAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGATAGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGC
TGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTTGCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGA
AGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGCTCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGC
TCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGCGACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCC
ACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACCGTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACA
AGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAGAAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCC
TGGAGCACGAGGAGCAGGATGAGAGCAGACACTGCAGCACGGGCAGCGGCAGTGCCAGCTTCGCCCACACTGCCCCTCCGCCAGCGGGCG
TCAACCCCGACTTGGAGGAGCCACCTCTAAAGGAGGAAGACGAGGTGCCCGACGACGAGACCGTCAACCAGATGATCGCCCGGCACGAGG
AGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGCAACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGG
ACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGTGAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCT
CCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTCAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCG
AAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCC
GCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGA
AGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGCAGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGC
GAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCA
GCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCA
TCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGG
GCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGG
GCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGACAGTGAGGAGGAACAAGAGGAGGACCGCTCAG
GAAGTGGCAGCGAAGAAGACTGAGCCCCGACATTCCAGTCTCGACCCCGAGCCCCTCGTTCCAGAGCTGAGATGGCATAGGCCTTAGCAG
TAACGGGTAGCAGCAGATGTAGTTTCAGACTTGGAGTAAAACTGTATAAACAAAAGAATCTTCCATATTTATACAGCAGAGAAGCTGTAG
GACTGTTTGTGACTGGCCCTGTCCTGGCATCAGTAGCATCTGTAACAGCATTAACTGTCTTAAAGAGAGAGAGAGAGAATTCCGAATTGG
GGAACACACGATACCTGTTTTTCTTTTCCGTTGCTGGCAGTACTGTTGCGCCGCAGTTTGGAGTCACTGTAGTTAAGTGTGGATGCATGT
GCGTCACCGTCCACTCCTCCTACTGTATTTTATTGGACAGGTCAGACTCGCCGGGGGCCCGGCGAGGGTATGTCAGTGTCACTGGATGTC

>In-frame_ILF3_ENST00000449870_chr19_10782211_+_SMARCA4_ENST00000541122_chr19_11134194_+_2723nt
AAAGGGGGCGGGGCTTCAGCCGGTCACGTGTTCCCGCACCTCCCCGGCGCGCGCCTGCCCGCCCGCCCGCTCGCCCCCGGTCCGGACTCC
TCCTCCTCCTCTTCTCGCCATTGCAGTTGGACCCAGCAGCCCGGCGCGCACCGCGTGGCTTTTGGGGGCAGACCCCGGCGGGCTGTGGCA
GGAGGGCGGCGGCGGCGGCTGCGGTCGAAGAAGGGGACGCCGACAAGAGTTGAAGTATTGATAACACCAAGGAACTCTATCACAATTTGA
AAAGATAAGCAAAAGTTTGATTTCCAGACACTACAGAAGAAGTAAAAATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGA
TGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCAGTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTG
TGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCAGAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAG
AAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGGGGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCA
AGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCCACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCC
AGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGGCGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCA
AGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATCAAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACA
TGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAGAAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGC
AGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAGGAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCC
AAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGATAGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGC
TGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTTGCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGA
AGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGCTCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGC
TCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGCGACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCC
ACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACCGTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACA
AGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAGAAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCC
TGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGACGAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTG
ATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGCAACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCC
CCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGTGAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACC
GCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTCAAGACCCTGAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCG
AAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCC
GCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGA
AGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGCAGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGC
GAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCA
GCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCA
TCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGG
GCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGG
GCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGACAGTGAGGAGGAACAAGAGGAGGACCGCTCAG

>In-frame_ILF3_ENST00000449870_chr19_10782211_+_SMARCA4_ENST00000589677_chr19_11134194_+_2720nt
AAAGGGGGCGGGGCTTCAGCCGGTCACGTGTTCCCGCACCTCCCCGGCGCGCGCCTGCCCGCCCGCCCGCTCGCCCCCGGTCCGGACTCC
TCCTCCTCCTCTTCTCGCCATTGCAGTTGGACCCAGCAGCCCGGCGCGCACCGCGTGGCTTTTGGGGGCAGACCCCGGCGGGCTGTGGCA
GGAGGGCGGCGGCGGCGGCTGCGGTCGAAGAAGGGGACGCCGACAAGAGTTGAAGTATTGATAACACCAAGGAACTCTATCACAATTTGA
AAAGATAAGCAAAAGTTTGATTTCCAGACACTACAGAAGAAGTAAAAATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGA
TGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCAGTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTG
TGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCAGAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAG
AAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGGGGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCA
AGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCCACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCC
AGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGGCGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCA
AGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATCAAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACA
TGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAGAAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGC
AGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAGGAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCC
AAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGATAGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGC
TGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTTGCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGA
AGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGCTCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGC
TCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGCGACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCC
ACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACCGTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACA
AGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAGAAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCC
TGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGACGAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTG
ATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGCAACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCC
CCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGTGAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACC
GCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTCAAGACCCTGAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCG
AAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCC
GCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGA
AGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAA
AGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCC
TCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCG
TCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCG
AGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCG
GCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGACAGTGAGGAGGAACAAGAGGAGGACCGCTCAGGAA

>In-frame_ILF3_ENST00000449870_chr19_10782211_+_SMARCA4_ENST00000444061_chr19_11134194_+_2711nt
AAAGGGGGCGGGGCTTCAGCCGGTCACGTGTTCCCGCACCTCCCCGGCGCGCGCCTGCCCGCCCGCCCGCTCGCCCCCGGTCCGGACTCC
TCCTCCTCCTCTTCTCGCCATTGCAGTTGGACCCAGCAGCCCGGCGCGCACCGCGTGGCTTTTGGGGGCAGACCCCGGCGGGCTGTGGCA
GGAGGGCGGCGGCGGCGGCTGCGGTCGAAGAAGGGGACGCCGACAAGAGTTGAAGTATTGATAACACCAAGGAACTCTATCACAATTTGA
AAAGATAAGCAAAAGTTTGATTTCCAGACACTACAGAAGAAGTAAAAATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGA
TGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCAGTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTG
TGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCAGAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAG
AAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGGGGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCA
AGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCCACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCC
AGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGGCGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCA
AGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATCAAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACA
TGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAGAAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGC
AGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAGGAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCC
AAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGATAGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGC
TGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTTGCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGA
AGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGCTCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGC
TCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGCGACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCC
ACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACCGTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACA
AGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAGAAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCC
TGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGACGAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTG
ATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGCAACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCC
CCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGTGAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACC
GCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTCAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGG
TCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGG
ACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGA
AGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGC
CCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACC
TAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGT
CGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAG
GCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGC
GGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGACAGTGAGGAGGAACAAGAGGAGGACCGCTCAGGAAGTGGCAGCG

>In-frame_ILF3_ENST00000449870_chr19_10782211_+_SMARCA4_ENST00000590574_chr19_11134194_+_2714nt
AAAGGGGGCGGGGCTTCAGCCGGTCACGTGTTCCCGCACCTCCCCGGCGCGCGCCTGCCCGCCCGCCCGCTCGCCCCCGGTCCGGACTCC
TCCTCCTCCTCTTCTCGCCATTGCAGTTGGACCCAGCAGCCCGGCGCGCACCGCGTGGCTTTTGGGGGCAGACCCCGGCGGGCTGTGGCA
GGAGGGCGGCGGCGGCGGCTGCGGTCGAAGAAGGGGACGCCGACAAGAGTTGAAGTATTGATAACACCAAGGAACTCTATCACAATTTGA
AAAGATAAGCAAAAGTTTGATTTCCAGACACTACAGAAGAAGTAAAAATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGA
TGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCAGTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTG
TGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCAGAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAG
AAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGGGGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCA
AGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCCACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCC
AGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGGCGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCA
AGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATCAAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACA
TGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAGAAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGC
AGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAGGAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCC
AAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGATAGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGC
TGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTTGCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGA
AGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGCTCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGC
TCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGCGACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCC
ACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACCGTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACA
AGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAGAAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCC
TGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGACGAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTG
ATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGCAACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCC
CCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGTGAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACC
GCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTCAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGG
TCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGG
ACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGA
AGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGCAGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGC
TGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACG
ACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGC
AGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGG
AAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGC
GGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGACAGTGAGGAGGAACAAGAGGAGGACCGCTCAGGAAGTGGCA

>In-frame_ILF3_ENST00000449870_chr19_10782211_+_SMARCA4_ENST00000413806_chr19_11134194_+_3189nt
AAAGGGGGCGGGGCTTCAGCCGGTCACGTGTTCCCGCACCTCCCCGGCGCGCGCCTGCCCGCCCGCCCGCTCGCCCCCGGTCCGGACTCC
TCCTCCTCCTCTTCTCGCCATTGCAGTTGGACCCAGCAGCCCGGCGCGCACCGCGTGGCTTTTGGGGGCAGACCCCGGCGGGCTGTGGCA
GGAGGGCGGCGGCGGCGGCTGCGGTCGAAGAAGGGGACGCCGACAAGAGTTGAAGTATTGATAACACCAAGGAACTCTATCACAATTTGA
AAAGATAAGCAAAAGTTTGATTTCCAGACACTACAGAAGAAGTAAAAATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGA
TGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCAGTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTG
TGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCAGAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAG
AAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGGGGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCA
AGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCCACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCC
AGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGGCGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCA
AGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATCAAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACA
TGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAGAAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGC
AGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAGGAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCC
AAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGATAGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGC
TGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTTGCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGA
AGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGCTCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGC
TCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGCGACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCC
ACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACCGTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACA
AGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAGAAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCC
TGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGACGAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTG
ATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGCAACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCC
CCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGTGAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACC
GCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTCAAGACCCTGAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCG
AAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCC
GCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGA
AGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGCAGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGC
GAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCA
GCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCA
TCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGG
GCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGG
GCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGACAGTGAGGAGGAACAAGAGGAGGACCGCTCAG
GAAGTGGCAGCGAAGAAGACTGAGCCCCGACATTCCAGTCTCGACCCCGAGCCCCTCGTTCCAGAGCTGAGATGGCATAGGCCTTAGCAG
TAACGGGTAGCAGCAGATGTAGTTTCAGACTTGGAGTAAAACTGTATAAACAAAAGAATCTTCCATATTTATACAGCAGAGAAGCTGTAG
GACTGTTTGTGACTGGCCCTGTCCTGGCATCAGTAGCATCTGTAACAGCATTAACTGTCTTAAAGAGAGAGAGAGAGAATTCCGAATTGG
GGAACACACGATACCTGTTTTTCTTTTCCGTTGCTGGCAGTACTGTTGCGCCGCAGTTTGGAGTCACTGTAGTTAAGTGTGGATGCATGT
GCGTCACCGTCCACTCCTCCTACTGTATTTTATTGGACAGGTCAGACTCGCCGGGGGCCCGGCGAGGGTATGTCAGTGTCACTGGATGTC

>In-frame_ILF3_ENST00000449870_chr19_10782211_+_SMARCA4_ENST00000450717_chr19_11134194_+_3186nt
AAAGGGGGCGGGGCTTCAGCCGGTCACGTGTTCCCGCACCTCCCCGGCGCGCGCCTGCCCGCCCGCCCGCTCGCCCCCGGTCCGGACTCC
TCCTCCTCCTCTTCTCGCCATTGCAGTTGGACCCAGCAGCCCGGCGCGCACCGCGTGGCTTTTGGGGGCAGACCCCGGCGGGCTGTGGCA
GGAGGGCGGCGGCGGCGGCTGCGGTCGAAGAAGGGGACGCCGACAAGAGTTGAAGTATTGATAACACCAAGGAACTCTATCACAATTTGA
AAAGATAAGCAAAAGTTTGATTTCCAGACACTACAGAAGAAGTAAAAATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGA
TGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCAGTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTG
TGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCAGAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAG
AAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGGGGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCA
AGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCCACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCC
AGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGGCGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCA
AGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATCAAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACA
TGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAGAAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGC
AGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAGGAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCC
AAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGATAGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGC
TGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTTGCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGA
AGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGCTCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGC
TCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGCGACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCC
ACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACCGTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACA
AGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAGAAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCC
TGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGACGAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTG
ATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGCAACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCC
CCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGTGAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACC
GCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTCAAGACCCTGAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCG
AAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCC
GCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGA
AGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAA
AGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCC
TCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCG
TCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCG
AGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCG
GCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGACAGTGAGGAGGAACAAGAGGAGGACCGCTCAGGAA
GTGGCAGCGAAGAAGACTGAGCCCCGACATTCCAGTCTCGACCCCGAGCCCCTCGTTCCAGAGCTGAGATGGCATAGGCCTTAGCAGTAA
CGGGTAGCAGCAGATGTAGTTTCAGACTTGGAGTAAAACTGTATAAACAAAAGAATCTTCCATATTTATACAGCAGAGAAGCTGTAGGAC
TGTTTGTGACTGGCCCTGTCCTGGCATCAGTAGCATCTGTAACAGCATTAACTGTCTTAAAGAGAGAGAGAGAGAATTCCGAATTGGGGA
ACACACGATACCTGTTTTTCTTTTCCGTTGCTGGCAGTACTGTTGCGCCGCAGTTTGGAGTCACTGTAGTTAAGTGTGGATGCATGTGCG
TCACCGTCCACTCCTCCTACTGTATTTTATTGGACAGGTCAGACTCGCCGGGGGCCCGGCGAGGGTATGTCAGTGTCACTGGATGTCAAA

>In-frame_ILF3_ENST00000318511_chr19_10782211_+_SMARCA4_ENST00000358026_chr19_11134194_+_3375nt
AAAGGGGGCGGGGCTTCAGCCGGTCACGTGTTCCCGCACCTCCCCGGCGCGCGCCTGCCCGCCCGCCCGCTCGCCCCCGGTCCGGACTCC
TCCTCCTCCTCTTCTCGCCATTGCAGTTGGACCCAGCAGCCCGGCGCGCACCGCGTGGCTTTTGGGGGCAGACCCCGGCGGGCTGTGGCA
GGAGGGCGGCGGCGGCGGCTGCGGTCGAAGAAGGGGACGCCGACAAGAGTTGAAGTATTGATAACACCAAGGAACTCTATCACAATTTGA
AAAGATAAGCAAAAGTTTGATTTCCAGACACTACAGAAGAAGTAAAAATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGA
TGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCAGTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTG
TGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCAGAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAG
AAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGGGGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCA
AGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCCACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCC
AGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGGCGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCA
AGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATCAAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACA
TGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAGAAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGC
AGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAGGAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCC
AAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGATAGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGC
TGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTTGCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGA
AGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGCTCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGC
TCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGCGACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCC
ACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACCGTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACA
AGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAGAAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCC
TGGAGCACGAGGAGCAGGATGAGAGCAGACACTGCAGCACGGGCAGCGGCAGTGCCAGCTTCGCCCACACTGCCCCTCCGCCAGCGGGCG
TCAACCCCGACTTGGAGGAGCCACCTCTAAAGGAGGAAGACGAGGTGCCCGACGACGAGACCGTCAACCAGATGATCGCCCGGCACGAGG
AGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGCAACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGG
ACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGTGAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCT
CCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTCAAGAAAATTACAGGAAAAGATATCCATGACACAG
CCAGCAGTGTGGCACGTGGGCTACAATTCCAGCGTGGCCTTCAGTTCTGCACACGTGCGTCAAAGGCCATCGAGGAGGGCACGCTGGAGG
AGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCC
GCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCA
CCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGCAGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGC
CCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGT
ACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAG
ACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGG
AAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGC
TGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGACAGTGAGGAGGAACAAGAGGAGGACC
GCTCAGGAAGTGGCAGCGAAGAAGACTGAGCCCCGACATTCCAGTCTCGACCCCGAGCCCCTCGTTCCAGAGCTGAGATGGCATAGGCCT
TAGCAGTAACGGGTAGCAGCAGATGTAGTTTCAGACTTGGAGTAAAACTGTATAAACAAAAGAATCTTCCATATTTATACAGCAGAGAAG
CTGTAGGACTGTTTGTGACTGGCCCTGTCCTGGCATCAGTAGCATCTGTAACAGCATTAACTGTCTTAAAGAGAGAGAGAGAGAATTCCG
AATTGGGGAACACACGATACCTGTTTTTCTTTTCCGTTGCTGGCAGTACTGTTGCGCCGCAGTTTGGAGTCACTGTAGTTAAGTGTGGAT
GCATGTGCGTCACCGTCCACTCCTCCTACTGTATTTTATTGGACAGGTCAGACTCGCCGGGGGCCCGGCGAGGGTATGTCAGTGTCACTG

>In-frame_ILF3_ENST00000318511_chr19_10782211_+_SMARCA4_ENST00000344626_chr19_11134194_+_3056nt
AAAGGGGGCGGGGCTTCAGCCGGTCACGTGTTCCCGCACCTCCCCGGCGCGCGCCTGCCCGCCCGCCCGCTCGCCCCCGGTCCGGACTCC
TCCTCCTCCTCTTCTCGCCATTGCAGTTGGACCCAGCAGCCCGGCGCGCACCGCGTGGCTTTTGGGGGCAGACCCCGGCGGGCTGTGGCA
GGAGGGCGGCGGCGGCGGCTGCGGTCGAAGAAGGGGACGCCGACAAGAGTTGAAGTATTGATAACACCAAGGAACTCTATCACAATTTGA
AAAGATAAGCAAAAGTTTGATTTCCAGACACTACAGAAGAAGTAAAAATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGA
TGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCAGTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTG
TGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCAGAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAG
AAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGGGGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCA
AGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCCACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCC
AGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGGCGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCA
AGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATCAAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACA
TGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAGAAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGC
AGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAGGAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCC
AAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGATAGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGC
TGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTTGCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGA
AGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGCTCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGC
TCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGCGACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCC
ACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACCGTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACA
AGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAGAAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCC
TGGAGCACGAGGAGCAGGATGAGAGCAGACACTGCAGCACGGGCAGCGGCAGTGCCAGCTTCGCCCACACTGCCCCTCCGCCAGCGGGCG
TCAACCCCGACTTGGAGGAGCCACCTCTAAAGGAGGAAGACGAGGTGCCCGACGACGAGACCGTCAACCAGATGATCGCCCGGCACGAGG
AGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGCAACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGG
ACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGTGAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCT
CCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTCAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCG
AAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCC
GCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGA
AGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGCAGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGC
GAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCA
GCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCA
TCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGG
GCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGG
GCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGACAGTGAGGAGGAACAAGAGGAGGACCGCTCAG
GAAGTGGCAGCGAAGAAGACTGAGCCCCGACATTCCAGTCTCGACCCCGAGCCCCTCGTTCCAGAGCTGAGATGGCATAGGCCTTAGCAG
TAACGGGTAGCAGCAGATGTAGTTTCAGACTTGGAGTAAAACTGTATAAACAAAAGAATCTTCCATATTTATACAGCAGAGAAGCTGTAG

>In-frame_ILF3_ENST00000318511_chr19_10782211_+_SMARCA4_ENST00000429416_chr19_11134194_+_3279nt
AAAGGGGGCGGGGCTTCAGCCGGTCACGTGTTCCCGCACCTCCCCGGCGCGCGCCTGCCCGCCCGCCCGCTCGCCCCCGGTCCGGACTCC
TCCTCCTCCTCTTCTCGCCATTGCAGTTGGACCCAGCAGCCCGGCGCGCACCGCGTGGCTTTTGGGGGCAGACCCCGGCGGGCTGTGGCA
GGAGGGCGGCGGCGGCGGCTGCGGTCGAAGAAGGGGACGCCGACAAGAGTTGAAGTATTGATAACACCAAGGAACTCTATCACAATTTGA
AAAGATAAGCAAAAGTTTGATTTCCAGACACTACAGAAGAAGTAAAAATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGA
TGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCAGTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTG
TGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCAGAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAG
AAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGGGGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCA
AGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCCACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCC
AGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGGCGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCA
AGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATCAAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACA
TGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAGAAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGC
AGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAGGAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCC
AAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGATAGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGC
TGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTTGCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGA
AGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGCTCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGC
TCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGCGACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCC
ACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACCGTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACA
AGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAGAAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCC
TGGAGCACGAGGAGCAGGATGAGAGCAGACACTGCAGCACGGGCAGCGGCAGTGCCAGCTTCGCCCACACTGCCCCTCCGCCAGCGGGCG
TCAACCCCGACTTGGAGGAGCCACCTCTAAAGGAGGAAGACGAGGTGCCCGACGACGAGACCGTCAACCAGATGATCGCCCGGCACGAGG
AGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGCAACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGG
ACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGTGAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCT
CCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTCAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCG
AAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCC
GCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGA
AGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGCAGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGC
GAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCA
GCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCA
TCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGG
GCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGG
GCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGACAGTGAGGAGGAACAAGAGGAGGACCGCTCAG
GAAGTGGCAGCGAAGAAGACTGAGCCCCGACATTCCAGTCTCGACCCCGAGCCCCTCGTTCCAGAGCTGAGATGGCATAGGCCTTAGCAG
TAACGGGTAGCAGCAGATGTAGTTTCAGACTTGGAGTAAAACTGTATAAACAAAAGAATCTTCCATATTTATACAGCAGAGAAGCTGTAG
GACTGTTTGTGACTGGCCCTGTCCTGGCATCAGTAGCATCTGTAACAGCATTAACTGTCTTAAAGAGAGAGAGAGAGAATTCCGAATTGG
GGAACACACGATACCTGTTTTTCTTTTCCGTTGCTGGCAGTACTGTTGCGCCGCAGTTTGGAGTCACTGTAGTTAAGTGTGGATGCATGT
GCGTCACCGTCCACTCCTCCTACTGTATTTTATTGGACAGGTCAGACTCGCCGGGGGCCCGGCGAGGGTATGTCAGTGTCACTGGATGTC

>In-frame_ILF3_ENST00000318511_chr19_10782211_+_SMARCA4_ENST00000541122_chr19_11134194_+_2723nt
AAAGGGGGCGGGGCTTCAGCCGGTCACGTGTTCCCGCACCTCCCCGGCGCGCGCCTGCCCGCCCGCCCGCTCGCCCCCGGTCCGGACTCC
TCCTCCTCCTCTTCTCGCCATTGCAGTTGGACCCAGCAGCCCGGCGCGCACCGCGTGGCTTTTGGGGGCAGACCCCGGCGGGCTGTGGCA
GGAGGGCGGCGGCGGCGGCTGCGGTCGAAGAAGGGGACGCCGACAAGAGTTGAAGTATTGATAACACCAAGGAACTCTATCACAATTTGA
AAAGATAAGCAAAAGTTTGATTTCCAGACACTACAGAAGAAGTAAAAATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGA
TGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCAGTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTG
TGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCAGAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAG
AAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGGGGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCA
AGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCCACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCC
AGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGGCGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCA
AGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATCAAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACA
TGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAGAAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGC
AGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAGGAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCC
AAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGATAGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGC
TGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTTGCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGA
AGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGCTCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGC
TCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGCGACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCC
ACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACCGTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACA
AGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAGAAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCC
TGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGACGAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTG
ATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGCAACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCC
CCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGTGAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACC
GCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTCAAGACCCTGAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCG
AAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCC
GCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGA
AGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGCAGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGC
GAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCA
GCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCA
TCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGG
GCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGG
GCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGACAGTGAGGAGGAACAAGAGGAGGACCGCTCAG

>In-frame_ILF3_ENST00000318511_chr19_10782211_+_SMARCA4_ENST00000589677_chr19_11134194_+_2720nt
AAAGGGGGCGGGGCTTCAGCCGGTCACGTGTTCCCGCACCTCCCCGGCGCGCGCCTGCCCGCCCGCCCGCTCGCCCCCGGTCCGGACTCC
TCCTCCTCCTCTTCTCGCCATTGCAGTTGGACCCAGCAGCCCGGCGCGCACCGCGTGGCTTTTGGGGGCAGACCCCGGCGGGCTGTGGCA
GGAGGGCGGCGGCGGCGGCTGCGGTCGAAGAAGGGGACGCCGACAAGAGTTGAAGTATTGATAACACCAAGGAACTCTATCACAATTTGA
AAAGATAAGCAAAAGTTTGATTTCCAGACACTACAGAAGAAGTAAAAATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGA
TGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCAGTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTG
TGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCAGAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAG
AAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGGGGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCA
AGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCCACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCC
AGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGGCGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCA
AGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATCAAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACA
TGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAGAAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGC
AGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAGGAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCC
AAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGATAGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGC
TGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTTGCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGA
AGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGCTCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGC
TCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGCGACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCC
ACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACCGTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACA
AGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAGAAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCC
TGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGACGAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTG
ATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGCAACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCC
CCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGTGAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACC
GCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTCAAGACCCTGAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCG
AAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCC
GCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGA
AGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAA
AGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCC
TCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCG
TCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCG
AGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCG
GCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGACAGTGAGGAGGAACAAGAGGAGGACCGCTCAGGAA

>In-frame_ILF3_ENST00000318511_chr19_10782211_+_SMARCA4_ENST00000444061_chr19_11134194_+_2711nt
AAAGGGGGCGGGGCTTCAGCCGGTCACGTGTTCCCGCACCTCCCCGGCGCGCGCCTGCCCGCCCGCCCGCTCGCCCCCGGTCCGGACTCC
TCCTCCTCCTCTTCTCGCCATTGCAGTTGGACCCAGCAGCCCGGCGCGCACCGCGTGGCTTTTGGGGGCAGACCCCGGCGGGCTGTGGCA
GGAGGGCGGCGGCGGCGGCTGCGGTCGAAGAAGGGGACGCCGACAAGAGTTGAAGTATTGATAACACCAAGGAACTCTATCACAATTTGA
AAAGATAAGCAAAAGTTTGATTTCCAGACACTACAGAAGAAGTAAAAATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGA
TGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCAGTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTG
TGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCAGAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAG
AAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGGGGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCA
AGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCCACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCC
AGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGGCGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCA
AGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATCAAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACA
TGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAGAAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGC
AGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAGGAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCC
AAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGATAGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGC
TGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTTGCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGA
AGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGCTCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGC
TCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGCGACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCC
ACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACCGTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACA
AGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAGAAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCC
TGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGACGAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTG
ATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGCAACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCC
CCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGTGAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACC
GCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTCAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGG
TCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGG
ACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGA
AGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGC
CCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACC
TAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGT
CGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAG
GCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGC
GGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGACAGTGAGGAGGAACAAGAGGAGGACCGCTCAGGAAGTGGCAGCG

>In-frame_ILF3_ENST00000318511_chr19_10782211_+_SMARCA4_ENST00000590574_chr19_11134194_+_2714nt
AAAGGGGGCGGGGCTTCAGCCGGTCACGTGTTCCCGCACCTCCCCGGCGCGCGCCTGCCCGCCCGCCCGCTCGCCCCCGGTCCGGACTCC
TCCTCCTCCTCTTCTCGCCATTGCAGTTGGACCCAGCAGCCCGGCGCGCACCGCGTGGCTTTTGGGGGCAGACCCCGGCGGGCTGTGGCA
GGAGGGCGGCGGCGGCGGCTGCGGTCGAAGAAGGGGACGCCGACAAGAGTTGAAGTATTGATAACACCAAGGAACTCTATCACAATTTGA
AAAGATAAGCAAAAGTTTGATTTCCAGACACTACAGAAGAAGTAAAAATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGA
TGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCAGTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTG
TGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCAGAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAG
AAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGGGGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCA
AGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCCACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCC
AGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGGCGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCA
AGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATCAAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACA
TGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAGAAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGC
AGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAGGAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCC
AAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGATAGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGC
TGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTTGCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGA
AGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGCTCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGC
TCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGCGACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCC
ACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACCGTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACA
AGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAGAAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCC
TGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGACGAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTG
ATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGCAACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCC
CCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGTGAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACC
GCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTCAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGG
TCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGG
ACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGA
AGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGCAGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGC
TGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACG
ACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGC
AGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGG
AAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGC
GGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGACAGTGAGGAGGAACAAGAGGAGGACCGCTCAGGAAGTGGCA

>In-frame_ILF3_ENST00000318511_chr19_10782211_+_SMARCA4_ENST00000413806_chr19_11134194_+_3189nt
AAAGGGGGCGGGGCTTCAGCCGGTCACGTGTTCCCGCACCTCCCCGGCGCGCGCCTGCCCGCCCGCCCGCTCGCCCCCGGTCCGGACTCC
TCCTCCTCCTCTTCTCGCCATTGCAGTTGGACCCAGCAGCCCGGCGCGCACCGCGTGGCTTTTGGGGGCAGACCCCGGCGGGCTGTGGCA
GGAGGGCGGCGGCGGCGGCTGCGGTCGAAGAAGGGGACGCCGACAAGAGTTGAAGTATTGATAACACCAAGGAACTCTATCACAATTTGA
AAAGATAAGCAAAAGTTTGATTTCCAGACACTACAGAAGAAGTAAAAATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGA
TGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCAGTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTG
TGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCAGAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAG
AAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGGGGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCA
AGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCCACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCC
AGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGGCGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCA
AGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATCAAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACA
TGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAGAAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGC
AGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAGGAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCC
AAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGATAGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGC
TGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTTGCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGA
AGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGCTCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGC
TCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGCGACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCC
ACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACCGTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACA
AGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAGAAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCC
TGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGACGAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTG
ATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGCAACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCC
CCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGTGAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACC
GCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTCAAGACCCTGAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCG
AAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCC
GCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGA
AGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGCAGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGC
GAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCA
GCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCA
TCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGG
GCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGG
GCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGACAGTGAGGAGGAACAAGAGGAGGACCGCTCAG
GAAGTGGCAGCGAAGAAGACTGAGCCCCGACATTCCAGTCTCGACCCCGAGCCCCTCGTTCCAGAGCTGAGATGGCATAGGCCTTAGCAG
TAACGGGTAGCAGCAGATGTAGTTTCAGACTTGGAGTAAAACTGTATAAACAAAAGAATCTTCCATATTTATACAGCAGAGAAGCTGTAG
GACTGTTTGTGACTGGCCCTGTCCTGGCATCAGTAGCATCTGTAACAGCATTAACTGTCTTAAAGAGAGAGAGAGAGAATTCCGAATTGG
GGAACACACGATACCTGTTTTTCTTTTCCGTTGCTGGCAGTACTGTTGCGCCGCAGTTTGGAGTCACTGTAGTTAAGTGTGGATGCATGT
GCGTCACCGTCCACTCCTCCTACTGTATTTTATTGGACAGGTCAGACTCGCCGGGGGCCCGGCGAGGGTATGTCAGTGTCACTGGATGTC

>In-frame_ILF3_ENST00000318511_chr19_10782211_+_SMARCA4_ENST00000450717_chr19_11134194_+_3186nt
AAAGGGGGCGGGGCTTCAGCCGGTCACGTGTTCCCGCACCTCCCCGGCGCGCGCCTGCCCGCCCGCCCGCTCGCCCCCGGTCCGGACTCC
TCCTCCTCCTCTTCTCGCCATTGCAGTTGGACCCAGCAGCCCGGCGCGCACCGCGTGGCTTTTGGGGGCAGACCCCGGCGGGCTGTGGCA
GGAGGGCGGCGGCGGCGGCTGCGGTCGAAGAAGGGGACGCCGACAAGAGTTGAAGTATTGATAACACCAAGGAACTCTATCACAATTTGA
AAAGATAAGCAAAAGTTTGATTTCCAGACACTACAGAAGAAGTAAAAATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGA
TGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCAGTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTG
TGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCAGAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAG
AAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGGGGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCA
AGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCCACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCC
AGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGGCGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCA
AGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATCAAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACA
TGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAGAAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGC
AGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAGGAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCC
AAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGATAGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGC
TGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTTGCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGA
AGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGCTCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGC
TCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGCGACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCC
ACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACCGTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACA
AGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAGAAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCC
TGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGACGAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTG
ATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGCAACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCC
CCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGTGAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACC
GCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTCAAGACCCTGAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCG
AAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCC
GCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGA
AGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAA
AGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCC
TCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCG
TCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCG
AGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCG
GCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGACAGTGAGGAGGAACAAGAGGAGGACCGCTCAGGAA
GTGGCAGCGAAGAAGACTGAGCCCCGACATTCCAGTCTCGACCCCGAGCCCCTCGTTCCAGAGCTGAGATGGCATAGGCCTTAGCAGTAA
CGGGTAGCAGCAGATGTAGTTTCAGACTTGGAGTAAAACTGTATAAACAAAAGAATCTTCCATATTTATACAGCAGAGAAGCTGTAGGAC
TGTTTGTGACTGGCCCTGTCCTGGCATCAGTAGCATCTGTAACAGCATTAACTGTCTTAAAGAGAGAGAGAGAGAATTCCGAATTGGGGA
ACACACGATACCTGTTTTTCTTTTCCGTTGCTGGCAGTACTGTTGCGCCGCAGTTTGGAGTCACTGTAGTTAAGTGTGGATGCATGTGCG
TCACCGTCCACTCCTCCTACTGTATTTTATTGGACAGGTCAGACTCGCCGGGGGCCCGGCGAGGGTATGTCAGTGTCACTGGATGTCAAA

>In-frame_ILF3_ENST00000407004_chr19_10782211_+_SMARCA4_ENST00000358026_chr19_11134194_+_3308nt
CGCTCGCCCCCGGTCCGGACTCCTCCTCCTCCTCTTCTCGCCATTGCAGTTGGACCCAGCAGCCCGGCGCGCACCGCGTGGCTTTTGGGG
GCAGACCCCGGCGGGCTGTGGCAGGAGGGCGGCGGCGGCGGCTGCGGTCGAAGAAGGGGACGCCGACAAGAGTTGAAGTATTGATAACAC
CAAGGAACTCTATCACAATTTGAAAAGATAAGCAAAAGTTTGATTTCCAGACACTACAGAAGAAGTAAAAATGCGTCCAATGCGAATTTT
TGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCAGTCCAGAACATGGTGTCCCA
CACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCAGAGTCCGATAACATGGATGT
GCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGGGGAGTGATGCGGGTGGGCCT
GGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCCACAACCGCCCTCCTGGACAA
GGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGGCGTCTCCACAAAGTGCTGCG
GCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATCAAGTGCGACATGTCTGCGCT
GCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAGAAGGGCAAAGGCGGCACCAA
GACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAGGAGTCCTTTTCCGAGCACTT
GGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGATAGAATTCTTCCCAAACTCCG
AGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTTGCGTATCGCGGCTTTAAATA
CCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGCTCTGAGTACTTCATCTTCCT
GCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGCGACTGGAATCCTCACCAGGA
CCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACCGTCAACAGCGTGGAGGAGAA
GATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAGAAGTCCTCCAGCCATGAGCG
GCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGAGCAGACACTGCAGCACGGGCAGCGGCAGTGCCAGCTTCGCCCA
CACTGCCCCTCCGCCAGCGGGCGTCAACCCCGACTTGGAGGAGCCACCTCTAAAGGAGGAAGACGAGGTGCCCGACGACGAGACCGTCAA
CCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGCAACCCCAAGCG
GAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGTGAGGAGGAGGA
GGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTCAAGAAAATTAC
AGGAAAAGATATCCATGACACAGCCAGCAGTGTGGCACGTGGGCTACAATTCCAGCGTGGCCTTCAGTTCTGCACACGTGCGTCAAAGGC
CATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCCGGCTC
CTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAGAAACT
CTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGCAGTGGACGTCAGCT
CAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATAAA
GGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAACCT
GGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGTGA
AGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGCCG
GAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGACAG
TGAGGAGGAACAAGAGGAGGACCGCTCAGGAAGTGGCAGCGAAGAAGACTGAGCCCCGACATTCCAGTCTCGACCCCGAGCCCCTCGTTC
CAGAGCTGAGATGGCATAGGCCTTAGCAGTAACGGGTAGCAGCAGATGTAGTTTCAGACTTGGAGTAAAACTGTATAAACAAAAGAATCT
TCCATATTTATACAGCAGAGAAGCTGTAGGACTGTTTGTGACTGGCCCTGTCCTGGCATCAGTAGCATCTGTAACAGCATTAACTGTCTT
AAAGAGAGAGAGAGAGAATTCCGAATTGGGGAACACACGATACCTGTTTTTCTTTTCCGTTGCTGGCAGTACTGTTGCGCCGCAGTTTGG
AGTCACTGTAGTTAAGTGTGGATGCATGTGCGTCACCGTCCACTCCTCCTACTGTATTTTATTGGACAGGTCAGACTCGCCGGGGGCCCG

>In-frame_ILF3_ENST00000407004_chr19_10782211_+_SMARCA4_ENST00000344626_chr19_11134194_+_2989nt
CGCTCGCCCCCGGTCCGGACTCCTCCTCCTCCTCTTCTCGCCATTGCAGTTGGACCCAGCAGCCCGGCGCGCACCGCGTGGCTTTTGGGG
GCAGACCCCGGCGGGCTGTGGCAGGAGGGCGGCGGCGGCGGCTGCGGTCGAAGAAGGGGACGCCGACAAGAGTTGAAGTATTGATAACAC
CAAGGAACTCTATCACAATTTGAAAAGATAAGCAAAAGTTTGATTTCCAGACACTACAGAAGAAGTAAAAATGCGTCCAATGCGAATTTT
TGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCAGTCCAGAACATGGTGTCCCA
CACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCAGAGTCCGATAACATGGATGT
GCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGGGGAGTGATGCGGGTGGGCCT
GGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCCACAACCGCCCTCCTGGACAA
GGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGGCGTCTCCACAAAGTGCTGCG
GCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATCAAGTGCGACATGTCTGCGCT
GCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAGAAGGGCAAAGGCGGCACCAA
GACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAGGAGTCCTTTTCCGAGCACTT
GGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGATAGAATTCTTCCCAAACTCCG
AGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTTGCGTATCGCGGCTTTAAATA
CCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGCTCTGAGTACTTCATCTTCCT
GCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGCGACTGGAATCCTCACCAGGA
CCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACCGTCAACAGCGTGGAGGAGAA
GATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAGAAGTCCTCCAGCCATGAGCG
GCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGAGCAGACACTGCAGCACGGGCAGCGGCAGTGCCAGCTTCGCCCA
CACTGCCCCTCCGCCAGCGGGCGTCAACCCCGACTTGGAGGAGCCACCTCTAAAGGAGGAAGACGAGGTGCCCGACGACGAGACCGTCAA
CCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGCAACCCCAAGCG
GAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGTGAGGAGGAGGA
GGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTCAAGGCCATCGA
GGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCCGGCTCCTCCAC
CCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAGAAACTCTCCCC
TAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGCAGTGGACGTCAGCTCAGCGA
GGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATAAAGGAGCG
CATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAACCTGGAGGG
CTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGTGAAGGCGA
GGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGCCGGAAGGA
GAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGACAGTGAGGA
GGAACAAGAGGAGGACCGCTCAGGAAGTGGCAGCGAAGAAGACTGAGCCCCGACATTCCAGTCTCGACCCCGAGCCCCTCGTTCCAGAGC
TGAGATGGCATAGGCCTTAGCAGTAACGGGTAGCAGCAGATGTAGTTTCAGACTTGGAGTAAAACTGTATAAACAAAAGAATCTTCCATA
TTTATACAGCAGAGAAGCTGTAGGACTGTTTGTGACTGGCCCTGTCCTGGCATCAGTAGCATCTGTAACAGCATTAACTGTCTTAAAGAG

>In-frame_ILF3_ENST00000407004_chr19_10782211_+_SMARCA4_ENST00000429416_chr19_11134194_+_3212nt
CGCTCGCCCCCGGTCCGGACTCCTCCTCCTCCTCTTCTCGCCATTGCAGTTGGACCCAGCAGCCCGGCGCGCACCGCGTGGCTTTTGGGG
GCAGACCCCGGCGGGCTGTGGCAGGAGGGCGGCGGCGGCGGCTGCGGTCGAAGAAGGGGACGCCGACAAGAGTTGAAGTATTGATAACAC
CAAGGAACTCTATCACAATTTGAAAAGATAAGCAAAAGTTTGATTTCCAGACACTACAGAAGAAGTAAAAATGCGTCCAATGCGAATTTT
TGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCAGTCCAGAACATGGTGTCCCA
CACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCAGAGTCCGATAACATGGATGT
GCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGGGGAGTGATGCGGGTGGGCCT
GGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCCACAACCGCCCTCCTGGACAA
GGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGGCGTCTCCACAAAGTGCTGCG
GCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATCAAGTGCGACATGTCTGCGCT
GCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAGAAGGGCAAAGGCGGCACCAA
GACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAGGAGTCCTTTTCCGAGCACTT
GGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGATAGAATTCTTCCCAAACTCCG
AGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTTGCGTATCGCGGCTTTAAATA
CCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGCTCTGAGTACTTCATCTTCCT
GCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGCGACTGGAATCCTCACCAGGA
CCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACCGTCAACAGCGTGGAGGAGAA
GATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAGAAGTCCTCCAGCCATGAGCG
GCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGAGCAGACACTGCAGCACGGGCAGCGGCAGTGCCAGCTTCGCCCA
CACTGCCCCTCCGCCAGCGGGCGTCAACCCCGACTTGGAGGAGCCACCTCTAAAGGAGGAAGACGAGGTGCCCGACGACGAGACCGTCAA
CCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGCAACCCCAAGCG
GAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGTGAGGAGGAGGA
GGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTCAAGGCCATCGA
GGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCCGGCTCCTCCAC
CCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAGAAACTCTCCCC
TAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGCAGTGGACGTCAGCTCAGCGA
GGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATAAAGGAGCG
CATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAACCTGGAGGG
CTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGTGAAGGCGA
GGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGCCGGAAGGA
GAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGACAGTGAGGA
GGAACAAGAGGAGGACCGCTCAGGAAGTGGCAGCGAAGAAGACTGAGCCCCGACATTCCAGTCTCGACCCCGAGCCCCTCGTTCCAGAGC
TGAGATGGCATAGGCCTTAGCAGTAACGGGTAGCAGCAGATGTAGTTTCAGACTTGGAGTAAAACTGTATAAACAAAAGAATCTTCCATA
TTTATACAGCAGAGAAGCTGTAGGACTGTTTGTGACTGGCCCTGTCCTGGCATCAGTAGCATCTGTAACAGCATTAACTGTCTTAAAGAG
AGAGAGAGAGAATTCCGAATTGGGGAACACACGATACCTGTTTTTCTTTTCCGTTGCTGGCAGTACTGTTGCGCCGCAGTTTGGAGTCAC
TGTAGTTAAGTGTGGATGCATGTGCGTCACCGTCCACTCCTCCTACTGTATTTTATTGGACAGGTCAGACTCGCCGGGGGCCCGGCGAGG

>In-frame_ILF3_ENST00000407004_chr19_10782211_+_SMARCA4_ENST00000541122_chr19_11134194_+_2656nt
CGCTCGCCCCCGGTCCGGACTCCTCCTCCTCCTCTTCTCGCCATTGCAGTTGGACCCAGCAGCCCGGCGCGCACCGCGTGGCTTTTGGGG
GCAGACCCCGGCGGGCTGTGGCAGGAGGGCGGCGGCGGCGGCTGCGGTCGAAGAAGGGGACGCCGACAAGAGTTGAAGTATTGATAACAC
CAAGGAACTCTATCACAATTTGAAAAGATAAGCAAAAGTTTGATTTCCAGACACTACAGAAGAAGTAAAAATGCGTCCAATGCGAATTTT
TGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCAGTCCAGAACATGGTGTCCCA
CACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCAGAGTCCGATAACATGGATGT
GCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGGGGAGTGATGCGGGTGGGCCT
GGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCCACAACCGCCCTCCTGGACAA
GGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGGCGTCTCCACAAAGTGCTGCG
GCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATCAAGTGCGACATGTCTGCGCT
GCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAGAAGGGCAAAGGCGGCACCAA
GACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAGGAGTCCTTTTCCGAGCACTT
GGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGATAGAATTCTTCCCAAACTCCG
AGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTTGCGTATCGCGGCTTTAAATA
CCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGCTCTGAGTACTTCATCTTCCT
GCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGCGACTGGAATCCTCACCAGGA
CCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACCGTCAACAGCGTGGAGGAGAA
GATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAGAAGTCCTCCAGCCATGAGCG
GCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGACGAGACCGTCAACCAGATGAT
CGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGCAACCCCAAGCGGAAGCCGCG
CCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGTGAGGAGGAGGAGGAGAAGAT
GTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTCAAGACCCTGAAGGCCATCGA
GGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCCGGCTCCTCCAC
CCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAGAAACTCTCCCC
TAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGCAGTGGACGTCAGCTCAGCGA
GGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATAAAGGAGCG
CATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAACCTGGAGGG
CTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGTGAAGGCGA
GGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGCCGGAAGGA
GAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGACAGTGAGGA

>In-frame_ILF3_ENST00000407004_chr19_10782211_+_SMARCA4_ENST00000589677_chr19_11134194_+_2653nt
CGCTCGCCCCCGGTCCGGACTCCTCCTCCTCCTCTTCTCGCCATTGCAGTTGGACCCAGCAGCCCGGCGCGCACCGCGTGGCTTTTGGGG
GCAGACCCCGGCGGGCTGTGGCAGGAGGGCGGCGGCGGCGGCTGCGGTCGAAGAAGGGGACGCCGACAAGAGTTGAAGTATTGATAACAC
CAAGGAACTCTATCACAATTTGAAAAGATAAGCAAAAGTTTGATTTCCAGACACTACAGAAGAAGTAAAAATGCGTCCAATGCGAATTTT
TGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCAGTCCAGAACATGGTGTCCCA
CACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCAGAGTCCGATAACATGGATGT
GCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGGGGAGTGATGCGGGTGGGCCT
GGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCCACAACCGCCCTCCTGGACAA
GGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGGCGTCTCCACAAAGTGCTGCG
GCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATCAAGTGCGACATGTCTGCGCT
GCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAGAAGGGCAAAGGCGGCACCAA
GACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAGGAGTCCTTTTCCGAGCACTT
GGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGATAGAATTCTTCCCAAACTCCG
AGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTTGCGTATCGCGGCTTTAAATA
CCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGCTCTGAGTACTTCATCTTCCT
GCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGCGACTGGAATCCTCACCAGGA
CCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACCGTCAACAGCGTGGAGGAGAA
GATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAGAAGTCCTCCAGCCATGAGCG
GCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGACGAGACCGTCAACCAGATGAT
CGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGCAACCCCAAGCGGAAGCCGCG
CCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGTGAGGAGGAGGAGGAGAAGAT
GTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTCAAGACCCTGAAGGCCATCGA
GGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCCGGCTCCTCCAC
CCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAGAAACTCTCCCC
TAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGTGGACGTCAGCTCAGCGAGGT
CTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATAAAGGAGCGCAT
TCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAACCTGGAGGGCTC
CCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGTGAAGGCGAGGA
GAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGCCGGAAGGAGAA
GGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGACAGTGAGGAGGA

>In-frame_ILF3_ENST00000407004_chr19_10782211_+_SMARCA4_ENST00000444061_chr19_11134194_+_2644nt
CGCTCGCCCCCGGTCCGGACTCCTCCTCCTCCTCTTCTCGCCATTGCAGTTGGACCCAGCAGCCCGGCGCGCACCGCGTGGCTTTTGGGG
GCAGACCCCGGCGGGCTGTGGCAGGAGGGCGGCGGCGGCGGCTGCGGTCGAAGAAGGGGACGCCGACAAGAGTTGAAGTATTGATAACAC
CAAGGAACTCTATCACAATTTGAAAAGATAAGCAAAAGTTTGATTTCCAGACACTACAGAAGAAGTAAAAATGCGTCCAATGCGAATTTT
TGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCAGTCCAGAACATGGTGTCCCA
CACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCAGAGTCCGATAACATGGATGT
GCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGGGGAGTGATGCGGGTGGGCCT
GGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCCACAACCGCCCTCCTGGACAA
GGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGGCGTCTCCACAAAGTGCTGCG
GCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATCAAGTGCGACATGTCTGCGCT
GCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAGAAGGGCAAAGGCGGCACCAA
GACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAGGAGTCCTTTTCCGAGCACTT
GGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGATAGAATTCTTCCCAAACTCCG
AGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTTGCGTATCGCGGCTTTAAATA
CCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGCTCTGAGTACTTCATCTTCCT
GCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGCGACTGGAATCCTCACCAGGA
CCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACCGTCAACAGCGTGGAGGAGAA
GATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAGAAGTCCTCCAGCCATGAGCG
GCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGACGAGACCGTCAACCAGATGAT
CGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGCAACCCCAAGCGGAAGCCGCG
CCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGTGAGGAGGAGGAGGAGAAGAT
GTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTCAAGGCCATCGAGGAGGGCAC
GCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCCGGCTCCTCCACCCCGACCAC
CAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAGAAACTCTCCCCTAACCCACC
CAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGTGGACGTCAGCTCAGCGAGGTCTTCATCCA
GCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATAAAGGAGCGCATTCGCAACCA
CAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAACCTGGAGGGCTCCCTGATCTA
TGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGTGAAGGCGAGGAGAGTGAGGA
GGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGCCGGAAGGAGAAGGCACAGGA
CCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGACAGTGAGGAGGAACAAGAGGA

>In-frame_ILF3_ENST00000407004_chr19_10782211_+_SMARCA4_ENST00000590574_chr19_11134194_+_2647nt
CGCTCGCCCCCGGTCCGGACTCCTCCTCCTCCTCTTCTCGCCATTGCAGTTGGACCCAGCAGCCCGGCGCGCACCGCGTGGCTTTTGGGG
GCAGACCCCGGCGGGCTGTGGCAGGAGGGCGGCGGCGGCGGCTGCGGTCGAAGAAGGGGACGCCGACAAGAGTTGAAGTATTGATAACAC
CAAGGAACTCTATCACAATTTGAAAAGATAAGCAAAAGTTTGATTTCCAGACACTACAGAAGAAGTAAAAATGCGTCCAATGCGAATTTT
TGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCAGTCCAGAACATGGTGTCCCA
CACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCAGAGTCCGATAACATGGATGT
GCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGGGGAGTGATGCGGGTGGGCCT
GGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCCACAACCGCCCTCCTGGACAA
GGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGGCGTCTCCACAAAGTGCTGCG
GCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATCAAGTGCGACATGTCTGCGCT
GCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAGAAGGGCAAAGGCGGCACCAA
GACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAGGAGTCCTTTTCCGAGCACTT
GGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGATAGAATTCTTCCCAAACTCCG
AGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTTGCGTATCGCGGCTTTAAATA
CCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGCTCTGAGTACTTCATCTTCCT
GCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGCGACTGGAATCCTCACCAGGA
CCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACCGTCAACAGCGTGGAGGAGAA
GATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAGAAGTCCTCCAGCCATGAGCG
GCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGACGAGACCGTCAACCAGATGAT
CGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGCAACCCCAAGCGGAAGCCGCG
CCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGTGAGGAGGAGGAGGAGAAGAT
GTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTCAAGGCCATCGAGGAGGGCAC
GCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCCGGCTCCTCCACCCCGACCAC
CAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAGAAACTCTCCCCTAACCCACC
CAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGCAGTGGACGTCAGCTCAGCGAGGTCTTCAT
CCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATAAAGGAGCGCATTCGCAA
CCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAACCTGGAGGGCTCCCTGAT
CTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGTGAAGGCGAGGAGAGTGA
GGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGCCGGAAGGAGAAGGCACA
GGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGACAGTGAGGAGGAACAAGA

>In-frame_ILF3_ENST00000407004_chr19_10782211_+_SMARCA4_ENST00000413806_chr19_11134194_+_3122nt
CGCTCGCCCCCGGTCCGGACTCCTCCTCCTCCTCTTCTCGCCATTGCAGTTGGACCCAGCAGCCCGGCGCGCACCGCGTGGCTTTTGGGG
GCAGACCCCGGCGGGCTGTGGCAGGAGGGCGGCGGCGGCGGCTGCGGTCGAAGAAGGGGACGCCGACAAGAGTTGAAGTATTGATAACAC
CAAGGAACTCTATCACAATTTGAAAAGATAAGCAAAAGTTTGATTTCCAGACACTACAGAAGAAGTAAAAATGCGTCCAATGCGAATTTT
TGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCAGTCCAGAACATGGTGTCCCA
CACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCAGAGTCCGATAACATGGATGT
GCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGGGGAGTGATGCGGGTGGGCCT
GGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCCACAACCGCCCTCCTGGACAA
GGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGGCGTCTCCACAAAGTGCTGCG
GCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATCAAGTGCGACATGTCTGCGCT
GCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAGAAGGGCAAAGGCGGCACCAA
GACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAGGAGTCCTTTTCCGAGCACTT
GGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGATAGAATTCTTCCCAAACTCCG
AGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTTGCGTATCGCGGCTTTAAATA
CCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGCTCTGAGTACTTCATCTTCCT
GCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGCGACTGGAATCCTCACCAGGA
CCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACCGTCAACAGCGTGGAGGAGAA
GATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAGAAGTCCTCCAGCCATGAGCG
GCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGACGAGACCGTCAACCAGATGAT
CGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGCAACCCCAAGCGGAAGCCGCG
CCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGTGAGGAGGAGGAGGAGAAGAT
GTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTCAAGACCCTGAAGGCCATCGA
GGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCCGGCTCCTCCAC
CCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAGAAACTCTCCCC
TAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGCAGTGGACGTCAGCTCAGCGA
GGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATAAAGGAGCG
CATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAACCTGGAGGG
CTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGTGAAGGCGA
GGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGCCGGAAGGA
GAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGACAGTGAGGA
GGAACAAGAGGAGGACCGCTCAGGAAGTGGCAGCGAAGAAGACTGAGCCCCGACATTCCAGTCTCGACCCCGAGCCCCTCGTTCCAGAGC
TGAGATGGCATAGGCCTTAGCAGTAACGGGTAGCAGCAGATGTAGTTTCAGACTTGGAGTAAAACTGTATAAACAAAAGAATCTTCCATA
TTTATACAGCAGAGAAGCTGTAGGACTGTTTGTGACTGGCCCTGTCCTGGCATCAGTAGCATCTGTAACAGCATTAACTGTCTTAAAGAG
AGAGAGAGAGAATTCCGAATTGGGGAACACACGATACCTGTTTTTCTTTTCCGTTGCTGGCAGTACTGTTGCGCCGCAGTTTGGAGTCAC
TGTAGTTAAGTGTGGATGCATGTGCGTCACCGTCCACTCCTCCTACTGTATTTTATTGGACAGGTCAGACTCGCCGGGGGCCCGGCGAGG

>In-frame_ILF3_ENST00000407004_chr19_10782211_+_SMARCA4_ENST00000450717_chr19_11134194_+_3119nt
CGCTCGCCCCCGGTCCGGACTCCTCCTCCTCCTCTTCTCGCCATTGCAGTTGGACCCAGCAGCCCGGCGCGCACCGCGTGGCTTTTGGGG
GCAGACCCCGGCGGGCTGTGGCAGGAGGGCGGCGGCGGCGGCTGCGGTCGAAGAAGGGGACGCCGACAAGAGTTGAAGTATTGATAACAC
CAAGGAACTCTATCACAATTTGAAAAGATAAGCAAAAGTTTGATTTCCAGACACTACAGAAGAAGTAAAAATGCGTCCAATGCGAATTTT
TGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCAGTCCAGAACATGGTGTCCCA
CACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCAGAGTCCGATAACATGGATGT
GCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGGGGAGTGATGCGGGTGGGCCT
GGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCCACAACCGCCCTCCTGGACAA
GGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGGCGTCTCCACAAAGTGCTGCG
GCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATCAAGTGCGACATGTCTGCGCT
GCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAGAAGGGCAAAGGCGGCACCAA
GACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAGGAGTCCTTTTCCGAGCACTT
GGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGATAGAATTCTTCCCAAACTCCG
AGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTTGCGTATCGCGGCTTTAAATA
CCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGCTCTGAGTACTTCATCTTCCT
GCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGCGACTGGAATCCTCACCAGGA
CCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACCGTCAACAGCGTGGAGGAGAA
GATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAGAAGTCCTCCAGCCATGAGCG
GCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGACGAGACCGTCAACCAGATGAT
CGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGCAACCCCAAGCGGAAGCCGCG
CCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGTGAGGAGGAGGAGGAGAAGAT
GTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTCAAGACCCTGAAGGCCATCGA
GGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCCGGCTCCTCCAC
CCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAGAAACTCTCCCC
TAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGTGGACGTCAGCTCAGCGAGGT
CTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATAAAGGAGCGCAT
TCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAACCTGGAGGGCTC
CCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGTGAAGGCGAGGA
GAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGCCGGAAGGAGAA
GGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGACAGTGAGGAGGA
ACAAGAGGAGGACCGCTCAGGAAGTGGCAGCGAAGAAGACTGAGCCCCGACATTCCAGTCTCGACCCCGAGCCCCTCGTTCCAGAGCTGA
GATGGCATAGGCCTTAGCAGTAACGGGTAGCAGCAGATGTAGTTTCAGACTTGGAGTAAAACTGTATAAACAAAAGAATCTTCCATATTT
ATACAGCAGAGAAGCTGTAGGACTGTTTGTGACTGGCCCTGTCCTGGCATCAGTAGCATCTGTAACAGCATTAACTGTCTTAAAGAGAGA
GAGAGAGAATTCCGAATTGGGGAACACACGATACCTGTTTTTCTTTTCCGTTGCTGGCAGTACTGTTGCGCCGCAGTTTGGAGTCACTGT
AGTTAAGTGTGGATGCATGTGCGTCACCGTCCACTCCTCCTACTGTATTTTATTGGACAGGTCAGACTCGCCGGGGGCCCGGCGAGGGTA

>In-frame_ILF3_ENST00000589998_chr19_10782211_+_SMARCA4_ENST00000358026_chr19_11134194_+_3275nt
CTTCTCGCCATTGCAGTTGGACCCAGCAGCCCGGCGCGCACCGCGTGGCTTTTGGGGGCAGACCCCGGCGGGCTGTGGCAGGAGGGCGGC
GGCGGCGGCTGCGGTCGAAGAAGGGGACGCCGACAAGAGTTGAAGTATTGATAACACCAAGGAACTCTATCACAATTTGAAAAGATAAGC
AAAAGTTTGATTTCCAGACACTACAGAAGAAGTAAAAATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCA
TTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCAGTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTG
GATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCAGAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGG
GGAACAGAAGACGGAGCACATGACCAGAACCCTGCGGGGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTT
GGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCCACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGT
GGACCTGAATGAGGAGGAAACCATTCTCATCATCCGGCGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGT
CGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATCAAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAA
GGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAGAAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAA
GATCTGCAACCACCCCTACATGTTCCAGCACATCGAGGAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGA
CCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGATAGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCA
AATGACCTCCCTCATGACCATCATGGAAGATTACTTTGCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGA
CCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGCTCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAA
CCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGCGACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGG
GCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACCGTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGT
GGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAGAAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGA
GGAGCAGGATGAGAGCAGACACTGCAGCACGGGCAGCGGCAGTGCCAGCTTCGCCCACACTGCCCCTCCGCCAGCGGGCGTCAACCCCGA
CTTGGAGGAGCCACCTCTAAAGGAGGAAGACGAGGTGCCCGACGACGAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGA
TCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGCAACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCC
CTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGTGAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCG
CAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTCAAGAAAATTACAGGAAAAGATATCCATGACACAGCCAGCAGTGT
GGCACGTGGGCTACAATTCCAGCGTGGCCTTCAGTTCTGCACACGTGCGTCAAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGA
GGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGA
CAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGAT
GAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGCAGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAA
GGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCT
CAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGT
CTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGA
GGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGG
CCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGACAGTGAGGAGGAACAAGAGGAGGACCGCTCAGGAAG
TGGCAGCGAAGAAGACTGAGCCCCGACATTCCAGTCTCGACCCCGAGCCCCTCGTTCCAGAGCTGAGATGGCATAGGCCTTAGCAGTAAC
GGGTAGCAGCAGATGTAGTTTCAGACTTGGAGTAAAACTGTATAAACAAAAGAATCTTCCATATTTATACAGCAGAGAAGCTGTAGGACT
GTTTGTGACTGGCCCTGTCCTGGCATCAGTAGCATCTGTAACAGCATTAACTGTCTTAAAGAGAGAGAGAGAGAATTCCGAATTGGGGAA
CACACGATACCTGTTTTTCTTTTCCGTTGCTGGCAGTACTGTTGCGCCGCAGTTTGGAGTCACTGTAGTTAAGTGTGGATGCATGTGCGT
CACCGTCCACTCCTCCTACTGTATTTTATTGGACAGGTCAGACTCGCCGGGGGCCCGGCGAGGGTATGTCAGTGTCACTGGATGTCAAAC

>In-frame_ILF3_ENST00000589998_chr19_10782211_+_SMARCA4_ENST00000344626_chr19_11134194_+_2956nt
CTTCTCGCCATTGCAGTTGGACCCAGCAGCCCGGCGCGCACCGCGTGGCTTTTGGGGGCAGACCCCGGCGGGCTGTGGCAGGAGGGCGGC
GGCGGCGGCTGCGGTCGAAGAAGGGGACGCCGACAAGAGTTGAAGTATTGATAACACCAAGGAACTCTATCACAATTTGAAAAGATAAGC
AAAAGTTTGATTTCCAGACACTACAGAAGAAGTAAAAATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCA
TTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCAGTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTG
GATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCAGAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGG
GGAACAGAAGACGGAGCACATGACCAGAACCCTGCGGGGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTT
GGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCCACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGT
GGACCTGAATGAGGAGGAAACCATTCTCATCATCCGGCGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGT
CGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATCAAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAA
GGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAGAAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAA
GATCTGCAACCACCCCTACATGTTCCAGCACATCGAGGAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGA
CCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGATAGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCA
AATGACCTCCCTCATGACCATCATGGAAGATTACTTTGCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGA
CCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGCTCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAA
CCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGCGACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGG
GCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACCGTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGT
GGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAGAAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGA
GGAGCAGGATGAGAGCAGACACTGCAGCACGGGCAGCGGCAGTGCCAGCTTCGCCCACACTGCCCCTCCGCCAGCGGGCGTCAACCCCGA
CTTGGAGGAGCCACCTCTAAAGGAGGAAGACGAGGTGCCCGACGACGAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGA
TCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGCAACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCC
CTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGTGAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCG
CAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTCAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGT
CCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGA
CGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAA
GATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGCAGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCT
GCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGA
CCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCA
GTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGA
AGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCG
GCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGACAGTGAGGAGGAACAAGAGGAGGACCGCTCAGGAAGTGGCAG
CGAAGAAGACTGAGCCCCGACATTCCAGTCTCGACCCCGAGCCCCTCGTTCCAGAGCTGAGATGGCATAGGCCTTAGCAGTAACGGGTAG
CAGCAGATGTAGTTTCAGACTTGGAGTAAAACTGTATAAACAAAAGAATCTTCCATATTTATACAGCAGAGAAGCTGTAGGACTGTTTGT

>In-frame_ILF3_ENST00000589998_chr19_10782211_+_SMARCA4_ENST00000429416_chr19_11134194_+_3179nt
CTTCTCGCCATTGCAGTTGGACCCAGCAGCCCGGCGCGCACCGCGTGGCTTTTGGGGGCAGACCCCGGCGGGCTGTGGCAGGAGGGCGGC
GGCGGCGGCTGCGGTCGAAGAAGGGGACGCCGACAAGAGTTGAAGTATTGATAACACCAAGGAACTCTATCACAATTTGAAAAGATAAGC
AAAAGTTTGATTTCCAGACACTACAGAAGAAGTAAAAATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCA
TTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCAGTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTG
GATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCAGAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGG
GGAACAGAAGACGGAGCACATGACCAGAACCCTGCGGGGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTT
GGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCCACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGT
GGACCTGAATGAGGAGGAAACCATTCTCATCATCCGGCGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGT
CGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATCAAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAA
GGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAGAAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAA
GATCTGCAACCACCCCTACATGTTCCAGCACATCGAGGAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGA
CCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGATAGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCA
AATGACCTCCCTCATGACCATCATGGAAGATTACTTTGCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGA
CCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGCTCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAA
CCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGCGACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGG
GCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACCGTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGT
GGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAGAAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGA
GGAGCAGGATGAGAGCAGACACTGCAGCACGGGCAGCGGCAGTGCCAGCTTCGCCCACACTGCCCCTCCGCCAGCGGGCGTCAACCCCGA
CTTGGAGGAGCCACCTCTAAAGGAGGAAGACGAGGTGCCCGACGACGAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGA
TCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGCAACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCC
CTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGTGAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCG
CAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTCAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGT
CCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGA
CGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAA
GATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGCAGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCT
GCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGA
CCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCA
GTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGA
AGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCG
GCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGACAGTGAGGAGGAACAAGAGGAGGACCGCTCAGGAAGTGGCAG
CGAAGAAGACTGAGCCCCGACATTCCAGTCTCGACCCCGAGCCCCTCGTTCCAGAGCTGAGATGGCATAGGCCTTAGCAGTAACGGGTAG
CAGCAGATGTAGTTTCAGACTTGGAGTAAAACTGTATAAACAAAAGAATCTTCCATATTTATACAGCAGAGAAGCTGTAGGACTGTTTGT
GACTGGCCCTGTCCTGGCATCAGTAGCATCTGTAACAGCATTAACTGTCTTAAAGAGAGAGAGAGAGAATTCCGAATTGGGGAACACACG
ATACCTGTTTTTCTTTTCCGTTGCTGGCAGTACTGTTGCGCCGCAGTTTGGAGTCACTGTAGTTAAGTGTGGATGCATGTGCGTCACCGT
CCACTCCTCCTACTGTATTTTATTGGACAGGTCAGACTCGCCGGGGGCCCGGCGAGGGTATGTCAGTGTCACTGGATGTCAAACAGTAAT

>In-frame_ILF3_ENST00000589998_chr19_10782211_+_SMARCA4_ENST00000541122_chr19_11134194_+_2623nt
CTTCTCGCCATTGCAGTTGGACCCAGCAGCCCGGCGCGCACCGCGTGGCTTTTGGGGGCAGACCCCGGCGGGCTGTGGCAGGAGGGCGGC
GGCGGCGGCTGCGGTCGAAGAAGGGGACGCCGACAAGAGTTGAAGTATTGATAACACCAAGGAACTCTATCACAATTTGAAAAGATAAGC
AAAAGTTTGATTTCCAGACACTACAGAAGAAGTAAAAATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCA
TTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCAGTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTG
GATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCAGAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGG
GGAACAGAAGACGGAGCACATGACCAGAACCCTGCGGGGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTT
GGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCCACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGT
GGACCTGAATGAGGAGGAAACCATTCTCATCATCCGGCGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGT
CGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATCAAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAA
GGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAGAAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAA
GATCTGCAACCACCCCTACATGTTCCAGCACATCGAGGAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGA
CCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGATAGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCA
AATGACCTCCCTCATGACCATCATGGAAGATTACTTTGCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGA
CCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGCTCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAA
CCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGCGACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGG
GCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACCGTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGT
GGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAGAAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGA
GGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGACGAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCAT
GCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGCAACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGAT
CATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGTGAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGT
GGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTCAAGACCCTGAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGT
CCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGA
CGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAA
GATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGCAGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCT
GCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGA
CCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCA
GTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGA
AGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCG
GCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGACAGTGAGGAGGAACAAGAGGAGGACCGCTCAGGAAGTGGCAG

>In-frame_ILF3_ENST00000589998_chr19_10782211_+_SMARCA4_ENST00000589677_chr19_11134194_+_2620nt
CTTCTCGCCATTGCAGTTGGACCCAGCAGCCCGGCGCGCACCGCGTGGCTTTTGGGGGCAGACCCCGGCGGGCTGTGGCAGGAGGGCGGC
GGCGGCGGCTGCGGTCGAAGAAGGGGACGCCGACAAGAGTTGAAGTATTGATAACACCAAGGAACTCTATCACAATTTGAAAAGATAAGC
AAAAGTTTGATTTCCAGACACTACAGAAGAAGTAAAAATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCA
TTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCAGTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTG
GATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCAGAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGG
GGAACAGAAGACGGAGCACATGACCAGAACCCTGCGGGGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTT
GGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCCACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGT
GGACCTGAATGAGGAGGAAACCATTCTCATCATCCGGCGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGT
CGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATCAAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAA
GGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAGAAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAA
GATCTGCAACCACCCCTACATGTTCCAGCACATCGAGGAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGA
CCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGATAGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCA
AATGACCTCCCTCATGACCATCATGGAAGATTACTTTGCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGA
CCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGCTCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAA
CCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGCGACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGG
GCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACCGTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGT
GGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAGAAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGA
GGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGACGAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCAT
GCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGCAACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGAT
CATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGTGAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGT
GGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTCAAGACCCTGAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGT
CCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGA
CGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAA
GATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCC
CGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCT
AGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTC
GGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGG
CTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCG
GCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGACAGTGAGGAGGAACAAGAGGAGGACCGCTCAGGAAGTGGCAGCGA

>In-frame_ILF3_ENST00000589998_chr19_10782211_+_SMARCA4_ENST00000444061_chr19_11134194_+_2611nt
CTTCTCGCCATTGCAGTTGGACCCAGCAGCCCGGCGCGCACCGCGTGGCTTTTGGGGGCAGACCCCGGCGGGCTGTGGCAGGAGGGCGGC
GGCGGCGGCTGCGGTCGAAGAAGGGGACGCCGACAAGAGTTGAAGTATTGATAACACCAAGGAACTCTATCACAATTTGAAAAGATAAGC
AAAAGTTTGATTTCCAGACACTACAGAAGAAGTAAAAATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCA
TTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCAGTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTG
GATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCAGAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGG
GGAACAGAAGACGGAGCACATGACCAGAACCCTGCGGGGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTT
GGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCCACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGT
GGACCTGAATGAGGAGGAAACCATTCTCATCATCCGGCGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGT
CGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATCAAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAA
GGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAGAAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAA
GATCTGCAACCACCCCTACATGTTCCAGCACATCGAGGAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGA
CCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGATAGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCA
AATGACCTCCCTCATGACCATCATGGAAGATTACTTTGCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGA
CCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGCTCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAA
CCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGCGACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGG
GCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACCGTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGT
GGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAGAAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGA
GGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGACGAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCAT
GCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGCAACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGAT
CATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGTGAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGT
GGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTCAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAA
GAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAG
CAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGA
TGCCGTGATCAAGTACAAGGACAGCAGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTA
CGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGA
CGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCAC
CAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATC
CGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCG
AGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGACAGTGAGGAGGAACAAGAGGAGGACCGCTCAGGAAGTGGCAGCGAAGAAGACTG

>In-frame_ILF3_ENST00000589998_chr19_10782211_+_SMARCA4_ENST00000590574_chr19_11134194_+_2614nt
CTTCTCGCCATTGCAGTTGGACCCAGCAGCCCGGCGCGCACCGCGTGGCTTTTGGGGGCAGACCCCGGCGGGCTGTGGCAGGAGGGCGGC
GGCGGCGGCTGCGGTCGAAGAAGGGGACGCCGACAAGAGTTGAAGTATTGATAACACCAAGGAACTCTATCACAATTTGAAAAGATAAGC
AAAAGTTTGATTTCCAGACACTACAGAAGAAGTAAAAATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCA
TTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCAGTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTG
GATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCAGAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGG
GGAACAGAAGACGGAGCACATGACCAGAACCCTGCGGGGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTT
GGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCCACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGT
GGACCTGAATGAGGAGGAAACCATTCTCATCATCCGGCGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGT
CGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATCAAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAA
GGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAGAAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAA
GATCTGCAACCACCCCTACATGTTCCAGCACATCGAGGAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGA
CCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGATAGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCA
AATGACCTCCCTCATGACCATCATGGAAGATTACTTTGCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGA
CCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGCTCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAA
CCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGCGACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGG
GCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACCGTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGT
GGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAGAAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGA
GGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGACGAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCAT
GCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGCAACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGAT
CATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGTGAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGT
GGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTCAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAA
GAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAG
CAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGA
TGCCGTGATCAAGTACAAGGACAGCAGCAGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTA
CTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAA
GGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTT
CACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGA
ATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAG
CCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGACAGTGAGGAGGAACAAGAGGAGGACCGCTCAGGAAGTGGCAGCGAAGAAGA

>In-frame_ILF3_ENST00000589998_chr19_10782211_+_SMARCA4_ENST00000413806_chr19_11134194_+_3089nt
CTTCTCGCCATTGCAGTTGGACCCAGCAGCCCGGCGCGCACCGCGTGGCTTTTGGGGGCAGACCCCGGCGGGCTGTGGCAGGAGGGCGGC
GGCGGCGGCTGCGGTCGAAGAAGGGGACGCCGACAAGAGTTGAAGTATTGATAACACCAAGGAACTCTATCACAATTTGAAAAGATAAGC
AAAAGTTTGATTTCCAGACACTACAGAAGAAGTAAAAATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCA
TTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCAGTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTG
GATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCAGAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGG
GGAACAGAAGACGGAGCACATGACCAGAACCCTGCGGGGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTT
GGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCCACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGT
GGACCTGAATGAGGAGGAAACCATTCTCATCATCCGGCGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGT
CGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATCAAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAA
GGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAGAAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAA
GATCTGCAACCACCCCTACATGTTCCAGCACATCGAGGAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGA
CCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGATAGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCA
AATGACCTCCCTCATGACCATCATGGAAGATTACTTTGCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGA
CCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGCTCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAA
CCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGCGACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGG
GCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACCGTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGT
GGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAGAAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGA
GGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGACGAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCAT
GCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGCAACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGAT
CATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGTGAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGT
GGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTCAAGACCCTGAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGT
CCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGA
CGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAA
GATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGCAGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCT
GCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGA
CCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCA
GTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGA
AGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCG
GCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGACAGTGAGGAGGAACAAGAGGAGGACCGCTCAGGAAGTGGCAG
CGAAGAAGACTGAGCCCCGACATTCCAGTCTCGACCCCGAGCCCCTCGTTCCAGAGCTGAGATGGCATAGGCCTTAGCAGTAACGGGTAG
CAGCAGATGTAGTTTCAGACTTGGAGTAAAACTGTATAAACAAAAGAATCTTCCATATTTATACAGCAGAGAAGCTGTAGGACTGTTTGT
GACTGGCCCTGTCCTGGCATCAGTAGCATCTGTAACAGCATTAACTGTCTTAAAGAGAGAGAGAGAGAATTCCGAATTGGGGAACACACG
ATACCTGTTTTTCTTTTCCGTTGCTGGCAGTACTGTTGCGCCGCAGTTTGGAGTCACTGTAGTTAAGTGTGGATGCATGTGCGTCACCGT
CCACTCCTCCTACTGTATTTTATTGGACAGGTCAGACTCGCCGGGGGCCCGGCGAGGGTATGTCAGTGTCACTGGATGTCAAACAGTAAT

>In-frame_ILF3_ENST00000589998_chr19_10782211_+_SMARCA4_ENST00000450717_chr19_11134194_+_3086nt
CTTCTCGCCATTGCAGTTGGACCCAGCAGCCCGGCGCGCACCGCGTGGCTTTTGGGGGCAGACCCCGGCGGGCTGTGGCAGGAGGGCGGC
GGCGGCGGCTGCGGTCGAAGAAGGGGACGCCGACAAGAGTTGAAGTATTGATAACACCAAGGAACTCTATCACAATTTGAAAAGATAAGC
AAAAGTTTGATTTCCAGACACTACAGAAGAAGTAAAAATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCA
TTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCAGTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTG
GATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCAGAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGG
GGAACAGAAGACGGAGCACATGACCAGAACCCTGCGGGGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTT
GGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCCACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGT
GGACCTGAATGAGGAGGAAACCATTCTCATCATCCGGCGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGT
CGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATCAAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAA
GGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAGAAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAA
GATCTGCAACCACCCCTACATGTTCCAGCACATCGAGGAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGA
CCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGATAGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCA
AATGACCTCCCTCATGACCATCATGGAAGATTACTTTGCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGA
CCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGCTCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAA
CCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGCGACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGG
GCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACCGTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGT
GGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAGAAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGA
GGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGACGAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCAT
GCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGCAACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGAT
CATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGTGAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGT
GGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTCAAGACCCTGAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGT
CCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGA
CGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAA
GATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCC
CGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCT
AGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTC
GGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGG
CTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCG
GCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGACAGTGAGGAGGAACAAGAGGAGGACCGCTCAGGAAGTGGCAGCGA
AGAAGACTGAGCCCCGACATTCCAGTCTCGACCCCGAGCCCCTCGTTCCAGAGCTGAGATGGCATAGGCCTTAGCAGTAACGGGTAGCAG
CAGATGTAGTTTCAGACTTGGAGTAAAACTGTATAAACAAAAGAATCTTCCATATTTATACAGCAGAGAAGCTGTAGGACTGTTTGTGAC
TGGCCCTGTCCTGGCATCAGTAGCATCTGTAACAGCATTAACTGTCTTAAAGAGAGAGAGAGAGAATTCCGAATTGGGGAACACACGATA
CCTGTTTTTCTTTTCCGTTGCTGGCAGTACTGTTGCGCCGCAGTTTGGAGTCACTGTAGTTAAGTGTGGATGCATGTGCGTCACCGTCCA
CTCCTCCTACTGTATTTTATTGGACAGGTCAGACTCGCCGGGGGCCCGGCGAGGGTATGTCAGTGTCACTGGATGTCAAACAGTAATAAA

>In-frame_ILF3_ENST00000250241_chr19_10782211_+_SMARCA4_ENST00000358026_chr19_11134194_+_3127nt
AAGGAACTCTATCACAATTTGAAAAGATAAGCAAAAGTTTGATTTCCAGACACTACAGAAGAAGTAAAAATGCGTCCAATGCGAATTTTT
GTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCAGTCCAGAACATGGTGTCCCAC
ACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCAGAGTCCGATAACATGGATGTG
CCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGGGGAGTGATGCGGGTGGGCCTG
GTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCCACAACCGCCCTCCTGGACAAG
GTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGGCGTCTCCACAAAGTGCTGCGG
CCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATCAAGTGCGACATGTCTGCGCTG
CAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAGAAGGGCAAAGGCGGCACCAAG
ACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAGGAGTCCTTTTCCGAGCACTTG
GGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGATAGAATTCTTCCCAAACTCCGA
GCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTTGCGTATCGCGGCTTTAAATAC
CTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGCTCTGAGTACTTCATCTTCCTG
CTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGCGACTGGAATCCTCACCAGGAC
CTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACCGTCAACAGCGTGGAGGAGAAG
ATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAGAAGTCCTCCAGCCATGAGCGG
CGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGAGCAGACACTGCAGCACGGGCAGCGGCAGTGCCAGCTTCGCCCAC
ACTGCCCCTCCGCCAGCGGGCGTCAACCCCGACTTGGAGGAGCCACCTCTAAAGGAGGAAGACGAGGTGCCCGACGACGAGACCGTCAAC
CAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGCAACCCCAAGCGG
AAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGTGAGGAGGAGGAG
GAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTCAAGAAAATTACA
GGAAAAGATATCCATGACACAGCCAGCAGTGTGGCACGTGGGCTACAATTCCAGCGTGGCCTTCAGTTCTGCACACGTGCGTCAAAGGCC
ATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCCGGCTCC
TCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAGAAACTC
TCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGCAGTGGACGTCAGCTC
AGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATAAAG
GAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAACCTG
GAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGTGAA
GGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGCCGG
AAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGACAGT
GAGGAGGAACAAGAGGAGGACCGCTCAGGAAGTGGCAGCGAAGAAGACTGAGCCCCGACATTCCAGTCTCGACCCCGAGCCCCTCGTTCC
AGAGCTGAGATGGCATAGGCCTTAGCAGTAACGGGTAGCAGCAGATGTAGTTTCAGACTTGGAGTAAAACTGTATAAACAAAAGAATCTT
CCATATTTATACAGCAGAGAAGCTGTAGGACTGTTTGTGACTGGCCCTGTCCTGGCATCAGTAGCATCTGTAACAGCATTAACTGTCTTA
AAGAGAGAGAGAGAGAATTCCGAATTGGGGAACACACGATACCTGTTTTTCTTTTCCGTTGCTGGCAGTACTGTTGCGCCGCAGTTTGGA
GTCACTGTAGTTAAGTGTGGATGCATGTGCGTCACCGTCCACTCCTCCTACTGTATTTTATTGGACAGGTCAGACTCGCCGGGGGCCCGG

>In-frame_ILF3_ENST00000250241_chr19_10782211_+_SMARCA4_ENST00000344626_chr19_11134194_+_2808nt
AAGGAACTCTATCACAATTTGAAAAGATAAGCAAAAGTTTGATTTCCAGACACTACAGAAGAAGTAAAAATGCGTCCAATGCGAATTTTT
GTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCAGTCCAGAACATGGTGTCCCAC
ACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCAGAGTCCGATAACATGGATGTG
CCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGGGGAGTGATGCGGGTGGGCCTG
GTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCCACAACCGCCCTCCTGGACAAG
GTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGGCGTCTCCACAAAGTGCTGCGG
CCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATCAAGTGCGACATGTCTGCGCTG
CAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAGAAGGGCAAAGGCGGCACCAAG
ACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAGGAGTCCTTTTCCGAGCACTTG
GGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGATAGAATTCTTCCCAAACTCCGA
GCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTTGCGTATCGCGGCTTTAAATAC
CTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGCTCTGAGTACTTCATCTTCCTG
CTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGCGACTGGAATCCTCACCAGGAC
CTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACCGTCAACAGCGTGGAGGAGAAG
ATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAGAAGTCCTCCAGCCATGAGCGG
CGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGAGCAGACACTGCAGCACGGGCAGCGGCAGTGCCAGCTTCGCCCAC
ACTGCCCCTCCGCCAGCGGGCGTCAACCCCGACTTGGAGGAGCCACCTCTAAAGGAGGAAGACGAGGTGCCCGACGACGAGACCGTCAAC
CAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGCAACCCCAAGCGG
AAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGTGAGGAGGAGGAG
GAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTCAAGGCCATCGAG
GAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCCGGCTCCTCCACC
CCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAGAAACTCTCCCCT
AACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGCAGTGGACGTCAGCTCAGCGAG
GTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATAAAGGAGCGC
ATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAACCTGGAGGGC
TCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGTGAAGGCGAG
GAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGCCGGAAGGAG
AAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGACAGTGAGGAG
GAACAAGAGGAGGACCGCTCAGGAAGTGGCAGCGAAGAAGACTGAGCCCCGACATTCCAGTCTCGACCCCGAGCCCCTCGTTCCAGAGCT
GAGATGGCATAGGCCTTAGCAGTAACGGGTAGCAGCAGATGTAGTTTCAGACTTGGAGTAAAACTGTATAAACAAAAGAATCTTCCATAT
TTATACAGCAGAGAAGCTGTAGGACTGTTTGTGACTGGCCCTGTCCTGGCATCAGTAGCATCTGTAACAGCATTAACTGTCTTAAAGAGA

>In-frame_ILF3_ENST00000250241_chr19_10782211_+_SMARCA4_ENST00000429416_chr19_11134194_+_3031nt
AAGGAACTCTATCACAATTTGAAAAGATAAGCAAAAGTTTGATTTCCAGACACTACAGAAGAAGTAAAAATGCGTCCAATGCGAATTTTT
GTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCAGTCCAGAACATGGTGTCCCAC
ACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCAGAGTCCGATAACATGGATGTG
CCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGGGGAGTGATGCGGGTGGGCCTG
GTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCCACAACCGCCCTCCTGGACAAG
GTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGGCGTCTCCACAAAGTGCTGCGG
CCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATCAAGTGCGACATGTCTGCGCTG
CAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAGAAGGGCAAAGGCGGCACCAAG
ACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAGGAGTCCTTTTCCGAGCACTTG
GGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGATAGAATTCTTCCCAAACTCCGA
GCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTTGCGTATCGCGGCTTTAAATAC
CTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGCTCTGAGTACTTCATCTTCCTG
CTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGCGACTGGAATCCTCACCAGGAC
CTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACCGTCAACAGCGTGGAGGAGAAG
ATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAGAAGTCCTCCAGCCATGAGCGG
CGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGAGCAGACACTGCAGCACGGGCAGCGGCAGTGCCAGCTTCGCCCAC
ACTGCCCCTCCGCCAGCGGGCGTCAACCCCGACTTGGAGGAGCCACCTCTAAAGGAGGAAGACGAGGTGCCCGACGACGAGACCGTCAAC
CAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGCAACCCCAAGCGG
AAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGTGAGGAGGAGGAG
GAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTCAAGGCCATCGAG
GAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCCGGCTCCTCCACC
CCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAGAAACTCTCCCCT
AACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGCAGTGGACGTCAGCTCAGCGAG
GTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATAAAGGAGCGC
ATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAACCTGGAGGGC
TCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGTGAAGGCGAG
GAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGCCGGAAGGAG
AAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGACAGTGAGGAG
GAACAAGAGGAGGACCGCTCAGGAAGTGGCAGCGAAGAAGACTGAGCCCCGACATTCCAGTCTCGACCCCGAGCCCCTCGTTCCAGAGCT
GAGATGGCATAGGCCTTAGCAGTAACGGGTAGCAGCAGATGTAGTTTCAGACTTGGAGTAAAACTGTATAAACAAAAGAATCTTCCATAT
TTATACAGCAGAGAAGCTGTAGGACTGTTTGTGACTGGCCCTGTCCTGGCATCAGTAGCATCTGTAACAGCATTAACTGTCTTAAAGAGA
GAGAGAGAGAATTCCGAATTGGGGAACACACGATACCTGTTTTTCTTTTCCGTTGCTGGCAGTACTGTTGCGCCGCAGTTTGGAGTCACT
GTAGTTAAGTGTGGATGCATGTGCGTCACCGTCCACTCCTCCTACTGTATTTTATTGGACAGGTCAGACTCGCCGGGGGCCCGGCGAGGG

>In-frame_ILF3_ENST00000250241_chr19_10782211_+_SMARCA4_ENST00000541122_chr19_11134194_+_2475nt
AAGGAACTCTATCACAATTTGAAAAGATAAGCAAAAGTTTGATTTCCAGACACTACAGAAGAAGTAAAAATGCGTCCAATGCGAATTTTT
GTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCAGTCCAGAACATGGTGTCCCAC
ACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCAGAGTCCGATAACATGGATGTG
CCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGGGGAGTGATGCGGGTGGGCCTG
GTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCCACAACCGCCCTCCTGGACAAG
GTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGGCGTCTCCACAAAGTGCTGCGG
CCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATCAAGTGCGACATGTCTGCGCTG
CAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAGAAGGGCAAAGGCGGCACCAAG
ACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAGGAGTCCTTTTCCGAGCACTTG
GGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGATAGAATTCTTCCCAAACTCCGA
GCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTTGCGTATCGCGGCTTTAAATAC
CTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGCTCTGAGTACTTCATCTTCCTG
CTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGCGACTGGAATCCTCACCAGGAC
CTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACCGTCAACAGCGTGGAGGAGAAG
ATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAGAAGTCCTCCAGCCATGAGCGG
CGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGACGAGACCGTCAACCAGATGATC
GCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGCAACCCCAAGCGGAAGCCGCGC
CTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGTGAGGAGGAGGAGGAGAAGATG
TTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTCAAGACCCTGAAGGCCATCGAG
GAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCCGGCTCCTCCACC
CCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAGAAACTCTCCCCT
AACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGCAGTGGACGTCAGCTCAGCGAG
GTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATAAAGGAGCGC
ATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAACCTGGAGGGC
TCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGTGAAGGCGAG
GAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGCCGGAAGGAG
AAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGACAGTGAGGAG

>In-frame_ILF3_ENST00000250241_chr19_10782211_+_SMARCA4_ENST00000589677_chr19_11134194_+_2472nt
AAGGAACTCTATCACAATTTGAAAAGATAAGCAAAAGTTTGATTTCCAGACACTACAGAAGAAGTAAAAATGCGTCCAATGCGAATTTTT
GTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCAGTCCAGAACATGGTGTCCCAC
ACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCAGAGTCCGATAACATGGATGTG
CCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGGGGAGTGATGCGGGTGGGCCTG
GTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCCACAACCGCCCTCCTGGACAAG
GTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGGCGTCTCCACAAAGTGCTGCGG
CCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATCAAGTGCGACATGTCTGCGCTG
CAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAGAAGGGCAAAGGCGGCACCAAG
ACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAGGAGTCCTTTTCCGAGCACTTG
GGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGATAGAATTCTTCCCAAACTCCGA
GCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTTGCGTATCGCGGCTTTAAATAC
CTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGCTCTGAGTACTTCATCTTCCTG
CTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGCGACTGGAATCCTCACCAGGAC
CTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACCGTCAACAGCGTGGAGGAGAAG
ATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAGAAGTCCTCCAGCCATGAGCGG
CGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGACGAGACCGTCAACCAGATGATC
GCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGCAACCCCAAGCGGAAGCCGCGC
CTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGTGAGGAGGAGGAGGAGAAGATG
TTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTCAAGACCCTGAAGGCCATCGAG
GAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCCGGCTCCTCCACC
CCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAGAAACTCTCCCCT
AACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGTGGACGTCAGCTCAGCGAGGTC
TTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATAAAGGAGCGCATT
CGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAACCTGGAGGGCTCC
CTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGTGAAGGCGAGGAG
AGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGCCGGAAGGAGAAG
GCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGACAGTGAGGAGGAA

>In-frame_ILF3_ENST00000250241_chr19_10782211_+_SMARCA4_ENST00000444061_chr19_11134194_+_2463nt
AAGGAACTCTATCACAATTTGAAAAGATAAGCAAAAGTTTGATTTCCAGACACTACAGAAGAAGTAAAAATGCGTCCAATGCGAATTTTT
GTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCAGTCCAGAACATGGTGTCCCAC
ACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCAGAGTCCGATAACATGGATGTG
CCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGGGGAGTGATGCGGGTGGGCCTG
GTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCCACAACCGCCCTCCTGGACAAG
GTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGGCGTCTCCACAAAGTGCTGCGG
CCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATCAAGTGCGACATGTCTGCGCTG
CAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAGAAGGGCAAAGGCGGCACCAAG
ACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAGGAGTCCTTTTCCGAGCACTTG
GGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGATAGAATTCTTCCCAAACTCCGA
GCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTTGCGTATCGCGGCTTTAAATAC
CTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGCTCTGAGTACTTCATCTTCCTG
CTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGCGACTGGAATCCTCACCAGGAC
CTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACCGTCAACAGCGTGGAGGAGAAG
ATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAGAAGTCCTCCAGCCATGAGCGG
CGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGACGAGACCGTCAACCAGATGATC
GCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGCAACCCCAAGCGGAAGCCGCGC
CTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGTGAGGAGGAGGAGGAGAAGATG
TTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTCAAGGCCATCGAGGAGGGCACG
CTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCCGGCTCCTCCACCCCGACCACC
AGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAGAAACTCTCCCCTAACCCACCC
AACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGTGGACGTCAGCTCAGCGAGGTCTTCATCCAG
CTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATAAAGGAGCGCATTCGCAACCAC
AAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAACCTGGAGGGCTCCCTGATCTAT
GAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGTGAAGGCGAGGAGAGTGAGGAG
GAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGCCGGAAGGAGAAGGCACAGGAC
CGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGACAGTGAGGAGGAACAAGAGGAG

>In-frame_ILF3_ENST00000250241_chr19_10782211_+_SMARCA4_ENST00000590574_chr19_11134194_+_2466nt
AAGGAACTCTATCACAATTTGAAAAGATAAGCAAAAGTTTGATTTCCAGACACTACAGAAGAAGTAAAAATGCGTCCAATGCGAATTTTT
GTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCAGTCCAGAACATGGTGTCCCAC
ACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCAGAGTCCGATAACATGGATGTG
CCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGGGGAGTGATGCGGGTGGGCCTG
GTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCCACAACCGCCCTCCTGGACAAG
GTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGGCGTCTCCACAAAGTGCTGCGG
CCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATCAAGTGCGACATGTCTGCGCTG
CAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAGAAGGGCAAAGGCGGCACCAAG
ACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAGGAGTCCTTTTCCGAGCACTTG
GGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGATAGAATTCTTCCCAAACTCCGA
GCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTTGCGTATCGCGGCTTTAAATAC
CTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGCTCTGAGTACTTCATCTTCCTG
CTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGCGACTGGAATCCTCACCAGGAC
CTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACCGTCAACAGCGTGGAGGAGAAG
ATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAGAAGTCCTCCAGCCATGAGCGG
CGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGACGAGACCGTCAACCAGATGATC
GCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGCAACCCCAAGCGGAAGCCGCGC
CTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGTGAGGAGGAGGAGGAGAAGATG
TTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTCAAGGCCATCGAGGAGGGCACG
CTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCCGGCTCCTCCACCCCGACCACC
AGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAGAAACTCTCCCCTAACCCACCC
AACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGCAGTGGACGTCAGCTCAGCGAGGTCTTCATC
CAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATAAAGGAGCGCATTCGCAAC
CACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAACCTGGAGGGCTCCCTGATC
TATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGTGAAGGCGAGGAGAGTGAG
GAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGCCGGAAGGAGAAGGCACAG
GACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGACAGTGAGGAGGAACAAGAG

>In-frame_ILF3_ENST00000250241_chr19_10782211_+_SMARCA4_ENST00000413806_chr19_11134194_+_2941nt
AAGGAACTCTATCACAATTTGAAAAGATAAGCAAAAGTTTGATTTCCAGACACTACAGAAGAAGTAAAAATGCGTCCAATGCGAATTTTT
GTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCAGTCCAGAACATGGTGTCCCAC
ACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCAGAGTCCGATAACATGGATGTG
CCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGGGGAGTGATGCGGGTGGGCCTG
GTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCCACAACCGCCCTCCTGGACAAG
GTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGGCGTCTCCACAAAGTGCTGCGG
CCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATCAAGTGCGACATGTCTGCGCTG
CAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAGAAGGGCAAAGGCGGCACCAAG
ACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAGGAGTCCTTTTCCGAGCACTTG
GGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGATAGAATTCTTCCCAAACTCCGA
GCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTTGCGTATCGCGGCTTTAAATAC
CTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGCTCTGAGTACTTCATCTTCCTG
CTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGCGACTGGAATCCTCACCAGGAC
CTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACCGTCAACAGCGTGGAGGAGAAG
ATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAGAAGTCCTCCAGCCATGAGCGG
CGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGACGAGACCGTCAACCAGATGATC
GCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGCAACCCCAAGCGGAAGCCGCGC
CTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGTGAGGAGGAGGAGGAGAAGATG
TTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTCAAGACCCTGAAGGCCATCGAG
GAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCCGGCTCCTCCACC
CCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAGAAACTCTCCCCT
AACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGCAGTGGACGTCAGCTCAGCGAG
GTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATAAAGGAGCGC
ATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAACCTGGAGGGC
TCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGTGAAGGCGAG
GAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGCCGGAAGGAG
AAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGACAGTGAGGAG
GAACAAGAGGAGGACCGCTCAGGAAGTGGCAGCGAAGAAGACTGAGCCCCGACATTCCAGTCTCGACCCCGAGCCCCTCGTTCCAGAGCT
GAGATGGCATAGGCCTTAGCAGTAACGGGTAGCAGCAGATGTAGTTTCAGACTTGGAGTAAAACTGTATAAACAAAAGAATCTTCCATAT
TTATACAGCAGAGAAGCTGTAGGACTGTTTGTGACTGGCCCTGTCCTGGCATCAGTAGCATCTGTAACAGCATTAACTGTCTTAAAGAGA
GAGAGAGAGAATTCCGAATTGGGGAACACACGATACCTGTTTTTCTTTTCCGTTGCTGGCAGTACTGTTGCGCCGCAGTTTGGAGTCACT
GTAGTTAAGTGTGGATGCATGTGCGTCACCGTCCACTCCTCCTACTGTATTTTATTGGACAGGTCAGACTCGCCGGGGGCCCGGCGAGGG

>In-frame_ILF3_ENST00000250241_chr19_10782211_+_SMARCA4_ENST00000450717_chr19_11134194_+_2938nt
AAGGAACTCTATCACAATTTGAAAAGATAAGCAAAAGTTTGATTTCCAGACACTACAGAAGAAGTAAAAATGCGTCCAATGCGAATTTTT
GTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCAGTCCAGAACATGGTGTCCCAC
ACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCAGAGTCCGATAACATGGATGTG
CCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGGGGAGTGATGCGGGTGGGCCTG
GTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCCACAACCGCCCTCCTGGACAAG
GTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGGCGTCTCCACAAAGTGCTGCGG
CCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATCAAGTGCGACATGTCTGCGCTG
CAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAGAAGGGCAAAGGCGGCACCAAG
ACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAGGAGTCCTTTTCCGAGCACTTG
GGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGATAGAATTCTTCCCAAACTCCGA
GCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTTGCGTATCGCGGCTTTAAATAC
CTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGCTCTGAGTACTTCATCTTCCTG
CTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGCGACTGGAATCCTCACCAGGAC
CTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACCGTCAACAGCGTGGAGGAGAAG
ATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAGAAGTCCTCCAGCCATGAGCGG
CGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGACGAGACCGTCAACCAGATGATC
GCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGCAACCCCAAGCGGAAGCCGCGC
CTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGTGAGGAGGAGGAGGAGAAGATG
TTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTCAAGACCCTGAAGGCCATCGAG
GAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCCGGCTCCTCCACC
CCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAGAAACTCTCCCCT
AACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGTGGACGTCAGCTCAGCGAGGTC
TTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATAAAGGAGCGCATT
CGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAACCTGGAGGGCTCC
CTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGTGAAGGCGAGGAG
AGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGCCGGAAGGAGAAG
GCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGACAGTGAGGAGGAA
CAAGAGGAGGACCGCTCAGGAAGTGGCAGCGAAGAAGACTGAGCCCCGACATTCCAGTCTCGACCCCGAGCCCCTCGTTCCAGAGCTGAG
ATGGCATAGGCCTTAGCAGTAACGGGTAGCAGCAGATGTAGTTTCAGACTTGGAGTAAAACTGTATAAACAAAAGAATCTTCCATATTTA
TACAGCAGAGAAGCTGTAGGACTGTTTGTGACTGGCCCTGTCCTGGCATCAGTAGCATCTGTAACAGCATTAACTGTCTTAAAGAGAGAG
AGAGAGAATTCCGAATTGGGGAACACACGATACCTGTTTTTCTTTTCCGTTGCTGGCAGTACTGTTGCGCCGCAGTTTGGAGTCACTGTA
GTTAAGTGTGGATGCATGTGCGTCACCGTCCACTCCTCCTACTGTATTTTATTGGACAGGTCAGACTCGCCGGGGGCCCGGCGAGGGTAT

>In-frame_ILF3_ENST00000592763_chr19_10782211_+_SMARCA4_ENST00000358026_chr19_11134194_+_3058nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGAGCAGACACTGCAGCACGGGCAGC
GGCAGTGCCAGCTTCGCCCACACTGCCCCTCCGCCAGCGGGCGTCAACCCCGACTTGGAGGAGCCACCTCTAAAGGAGGAAGACGAGGTG
CCCGACGACGAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAG
GAGGCCCGCAACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGG
CTGACCTGTGAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAG
CAGTGGCTCAAGAAAATTACAGGAAAAGATATCCATGACACAGCCAGCAGTGTGGCACGTGGGCTACAATTCCAGCGTGGCCTTCAGTTC
TGCACACGTGCGTCAAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAG
CGAGACAGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGG
CGGCCGCCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGAC
AGCAGCAGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCC
GTGGACTTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAG
AACGCACAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATC
GAGAAGGAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAA
GTGAAGATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCG
GTCGTGAGTGACGATGACAGTGAGGAGGAACAAGAGGAGGACCGCTCAGGAAGTGGCAGCGAAGAAGACTGAGCCCCGACATTCCAGTCT
CGACCCCGAGCCCCTCGTTCCAGAGCTGAGATGGCATAGGCCTTAGCAGTAACGGGTAGCAGCAGATGTAGTTTCAGACTTGGAGTAAAA
CTGTATAAACAAAAGAATCTTCCATATTTATACAGCAGAGAAGCTGTAGGACTGTTTGTGACTGGCCCTGTCCTGGCATCAGTAGCATCT
GTAACAGCATTAACTGTCTTAAAGAGAGAGAGAGAGAATTCCGAATTGGGGAACACACGATACCTGTTTTTCTTTTCCGTTGCTGGCAGT
ACTGTTGCGCCGCAGTTTGGAGTCACTGTAGTTAAGTGTGGATGCATGTGCGTCACCGTCCACTCCTCCTACTGTATTTTATTGGACAGG

>In-frame_ILF3_ENST00000592763_chr19_10782211_+_SMARCA4_ENST00000344626_chr19_11134194_+_2739nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGAGCAGACACTGCAGCACGGGCAGC
GGCAGTGCCAGCTTCGCCCACACTGCCCCTCCGCCAGCGGGCGTCAACCCCGACTTGGAGGAGCCACCTCTAAAGGAGGAAGACGAGGTG
CCCGACGACGAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAG
GAGGCCCGCAACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGG
CTGACCTGTGAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAG
CAGTGGCTCAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGAC
AGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCG
CCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGC
AGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGAC
TTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCA
CAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAG
GAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAG
ATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTG
AGTGACGATGACAGTGAGGAGGAACAAGAGGAGGACCGCTCAGGAAGTGGCAGCGAAGAAGACTGAGCCCCGACATTCCAGTCTCGACCC
CGAGCCCCTCGTTCCAGAGCTGAGATGGCATAGGCCTTAGCAGTAACGGGTAGCAGCAGATGTAGTTTCAGACTTGGAGTAAAACTGTAT
AAACAAAAGAATCTTCCATATTTATACAGCAGAGAAGCTGTAGGACTGTTTGTGACTGGCCCTGTCCTGGCATCAGTAGCATCTGTAACA

>In-frame_ILF3_ENST00000592763_chr19_10782211_+_SMARCA4_ENST00000429416_chr19_11134194_+_2962nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGAGCAGACACTGCAGCACGGGCAGC
GGCAGTGCCAGCTTCGCCCACACTGCCCCTCCGCCAGCGGGCGTCAACCCCGACTTGGAGGAGCCACCTCTAAAGGAGGAAGACGAGGTG
CCCGACGACGAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAG
GAGGCCCGCAACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGG
CTGACCTGTGAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAG
CAGTGGCTCAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGAC
AGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCG
CCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGC
AGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGAC
TTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCA
CAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAG
GAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAG
ATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTG
AGTGACGATGACAGTGAGGAGGAACAAGAGGAGGACCGCTCAGGAAGTGGCAGCGAAGAAGACTGAGCCCCGACATTCCAGTCTCGACCC
CGAGCCCCTCGTTCCAGAGCTGAGATGGCATAGGCCTTAGCAGTAACGGGTAGCAGCAGATGTAGTTTCAGACTTGGAGTAAAACTGTAT
AAACAAAAGAATCTTCCATATTTATACAGCAGAGAAGCTGTAGGACTGTTTGTGACTGGCCCTGTCCTGGCATCAGTAGCATCTGTAACA
GCATTAACTGTCTTAAAGAGAGAGAGAGAGAATTCCGAATTGGGGAACACACGATACCTGTTTTTCTTTTCCGTTGCTGGCAGTACTGTT
GCGCCGCAGTTTGGAGTCACTGTAGTTAAGTGTGGATGCATGTGCGTCACCGTCCACTCCTCCTACTGTATTTTATTGGACAGGTCAGAC

>In-frame_ILF3_ENST00000592763_chr19_10782211_+_SMARCA4_ENST00000541122_chr19_11134194_+_2406nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGAC
GAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGC
AACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGT
GAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTC
AAGACCCTGAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGAC
AGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCG
CCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGC
AGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGAC
TTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCA
CAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAG
GAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAG
ATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTG

>In-frame_ILF3_ENST00000592763_chr19_10782211_+_SMARCA4_ENST00000589677_chr19_11134194_+_2403nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGAC
GAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGC
AACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGT
GAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTC
AAGACCCTGAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGAC
AGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCG
CCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGT
GGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTC
AAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAG
ACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAG
GATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATC
AAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGT

>In-frame_ILF3_ENST00000592763_chr19_10782211_+_SMARCA4_ENST00000444061_chr19_11134194_+_2394nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGAC
GAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGC
AACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGT
GAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTC
AAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCC
GGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAG
AAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGTGGACGTCAG
CTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATA
AAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAAC
CTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGT
GAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGC
CGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGAC

>In-frame_ILF3_ENST00000592763_chr19_10782211_+_SMARCA4_ENST00000590574_chr19_11134194_+_2397nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGAC
GAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGC
AACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGT
GAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTC
AAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCC
GGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAG
AAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGCAGTGGACGT
CAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAG
ATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTC
AACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGAC
AGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTT
GGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGAT

>In-frame_ILF3_ENST00000592763_chr19_10782211_+_SMARCA4_ENST00000413806_chr19_11134194_+_2872nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGAC
GAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGC
AACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGT
GAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTC
AAGACCCTGAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGAC
AGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCG
CCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGC
AGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGAC
TTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCA
CAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAG
GAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAG
ATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTG
AGTGACGATGACAGTGAGGAGGAACAAGAGGAGGACCGCTCAGGAAGTGGCAGCGAAGAAGACTGAGCCCCGACATTCCAGTCTCGACCC
CGAGCCCCTCGTTCCAGAGCTGAGATGGCATAGGCCTTAGCAGTAACGGGTAGCAGCAGATGTAGTTTCAGACTTGGAGTAAAACTGTAT
AAACAAAAGAATCTTCCATATTTATACAGCAGAGAAGCTGTAGGACTGTTTGTGACTGGCCCTGTCCTGGCATCAGTAGCATCTGTAACA
GCATTAACTGTCTTAAAGAGAGAGAGAGAGAATTCCGAATTGGGGAACACACGATACCTGTTTTTCTTTTCCGTTGCTGGCAGTACTGTT
GCGCCGCAGTTTGGAGTCACTGTAGTTAAGTGTGGATGCATGTGCGTCACCGTCCACTCCTCCTACTGTATTTTATTGGACAGGTCAGAC

>In-frame_ILF3_ENST00000592763_chr19_10782211_+_SMARCA4_ENST00000450717_chr19_11134194_+_2869nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGAC
GAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGC
AACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGT
GAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTC
AAGACCCTGAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGAC
AGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCG
CCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGT
GGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTC
AAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAG
ACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAG
GATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATC
AAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGT
GACGATGACAGTGAGGAGGAACAAGAGGAGGACCGCTCAGGAAGTGGCAGCGAAGAAGACTGAGCCCCGACATTCCAGTCTCGACCCCGA
GCCCCTCGTTCCAGAGCTGAGATGGCATAGGCCTTAGCAGTAACGGGTAGCAGCAGATGTAGTTTCAGACTTGGAGTAAAACTGTATAAA
CAAAAGAATCTTCCATATTTATACAGCAGAGAAGCTGTAGGACTGTTTGTGACTGGCCCTGTCCTGGCATCAGTAGCATCTGTAACAGCA
TTAACTGTCTTAAAGAGAGAGAGAGAGAATTCCGAATTGGGGAACACACGATACCTGTTTTTCTTTTCCGTTGCTGGCAGTACTGTTGCG
CCGCAGTTTGGAGTCACTGTAGTTAAGTGTGGATGCATGTGCGTCACCGTCCACTCCTCCTACTGTATTTTATTGGACAGGTCAGACTCG

>In-frame_ILF3_ENST00000588657_chr19_10782211_+_SMARCA4_ENST00000358026_chr19_11134194_+_3058nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGAGCAGACACTGCAGCACGGGCAGC
GGCAGTGCCAGCTTCGCCCACACTGCCCCTCCGCCAGCGGGCGTCAACCCCGACTTGGAGGAGCCACCTCTAAAGGAGGAAGACGAGGTG
CCCGACGACGAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAG
GAGGCCCGCAACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGG
CTGACCTGTGAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAG
CAGTGGCTCAAGAAAATTACAGGAAAAGATATCCATGACACAGCCAGCAGTGTGGCACGTGGGCTACAATTCCAGCGTGGCCTTCAGTTC
TGCACACGTGCGTCAAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAG
CGAGACAGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGG
CGGCCGCCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGAC
AGCAGCAGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCC
GTGGACTTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAG
AACGCACAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATC
GAGAAGGAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAA
GTGAAGATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCG
GTCGTGAGTGACGATGACAGTGAGGAGGAACAAGAGGAGGACCGCTCAGGAAGTGGCAGCGAAGAAGACTGAGCCCCGACATTCCAGTCT
CGACCCCGAGCCCCTCGTTCCAGAGCTGAGATGGCATAGGCCTTAGCAGTAACGGGTAGCAGCAGATGTAGTTTCAGACTTGGAGTAAAA
CTGTATAAACAAAAGAATCTTCCATATTTATACAGCAGAGAAGCTGTAGGACTGTTTGTGACTGGCCCTGTCCTGGCATCAGTAGCATCT
GTAACAGCATTAACTGTCTTAAAGAGAGAGAGAGAGAATTCCGAATTGGGGAACACACGATACCTGTTTTTCTTTTCCGTTGCTGGCAGT
ACTGTTGCGCCGCAGTTTGGAGTCACTGTAGTTAAGTGTGGATGCATGTGCGTCACCGTCCACTCCTCCTACTGTATTTTATTGGACAGG

>In-frame_ILF3_ENST00000588657_chr19_10782211_+_SMARCA4_ENST00000344626_chr19_11134194_+_2739nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGAGCAGACACTGCAGCACGGGCAGC
GGCAGTGCCAGCTTCGCCCACACTGCCCCTCCGCCAGCGGGCGTCAACCCCGACTTGGAGGAGCCACCTCTAAAGGAGGAAGACGAGGTG
CCCGACGACGAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAG
GAGGCCCGCAACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGG
CTGACCTGTGAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAG
CAGTGGCTCAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGAC
AGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCG
CCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGC
AGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGAC
TTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCA
CAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAG
GAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAG
ATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTG
AGTGACGATGACAGTGAGGAGGAACAAGAGGAGGACCGCTCAGGAAGTGGCAGCGAAGAAGACTGAGCCCCGACATTCCAGTCTCGACCC
CGAGCCCCTCGTTCCAGAGCTGAGATGGCATAGGCCTTAGCAGTAACGGGTAGCAGCAGATGTAGTTTCAGACTTGGAGTAAAACTGTAT
AAACAAAAGAATCTTCCATATTTATACAGCAGAGAAGCTGTAGGACTGTTTGTGACTGGCCCTGTCCTGGCATCAGTAGCATCTGTAACA

>In-frame_ILF3_ENST00000588657_chr19_10782211_+_SMARCA4_ENST00000429416_chr19_11134194_+_2962nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGAGCAGACACTGCAGCACGGGCAGC
GGCAGTGCCAGCTTCGCCCACACTGCCCCTCCGCCAGCGGGCGTCAACCCCGACTTGGAGGAGCCACCTCTAAAGGAGGAAGACGAGGTG
CCCGACGACGAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAG
GAGGCCCGCAACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGG
CTGACCTGTGAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAG
CAGTGGCTCAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGAC
AGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCG
CCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGC
AGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGAC
TTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCA
CAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAG
GAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAG
ATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTG
AGTGACGATGACAGTGAGGAGGAACAAGAGGAGGACCGCTCAGGAAGTGGCAGCGAAGAAGACTGAGCCCCGACATTCCAGTCTCGACCC
CGAGCCCCTCGTTCCAGAGCTGAGATGGCATAGGCCTTAGCAGTAACGGGTAGCAGCAGATGTAGTTTCAGACTTGGAGTAAAACTGTAT
AAACAAAAGAATCTTCCATATTTATACAGCAGAGAAGCTGTAGGACTGTTTGTGACTGGCCCTGTCCTGGCATCAGTAGCATCTGTAACA
GCATTAACTGTCTTAAAGAGAGAGAGAGAGAATTCCGAATTGGGGAACACACGATACCTGTTTTTCTTTTCCGTTGCTGGCAGTACTGTT
GCGCCGCAGTTTGGAGTCACTGTAGTTAAGTGTGGATGCATGTGCGTCACCGTCCACTCCTCCTACTGTATTTTATTGGACAGGTCAGAC

>In-frame_ILF3_ENST00000588657_chr19_10782211_+_SMARCA4_ENST00000541122_chr19_11134194_+_2406nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGAC
GAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGC
AACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGT
GAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTC
AAGACCCTGAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGAC
AGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCG
CCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGC
AGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGAC
TTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCA
CAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAG
GAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAG
ATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTG

>In-frame_ILF3_ENST00000588657_chr19_10782211_+_SMARCA4_ENST00000589677_chr19_11134194_+_2403nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGAC
GAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGC
AACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGT
GAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTC
AAGACCCTGAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGAC
AGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCG
CCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGT
GGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTC
AAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAG
ACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAG
GATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATC
AAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGT

>In-frame_ILF3_ENST00000588657_chr19_10782211_+_SMARCA4_ENST00000444061_chr19_11134194_+_2394nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGAC
GAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGC
AACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGT
GAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTC
AAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCC
GGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAG
AAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGTGGACGTCAG
CTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATA
AAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAAC
CTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGT
GAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGC
CGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGAC

>In-frame_ILF3_ENST00000588657_chr19_10782211_+_SMARCA4_ENST00000590574_chr19_11134194_+_2397nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGAC
GAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGC
AACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGT
GAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTC
AAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCC
GGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAG
AAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGCAGTGGACGT
CAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAG
ATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTC
AACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGAC
AGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTT
GGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGAT

>In-frame_ILF3_ENST00000588657_chr19_10782211_+_SMARCA4_ENST00000413806_chr19_11134194_+_2872nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGAC
GAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGC
AACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGT
GAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTC
AAGACCCTGAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGAC
AGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCG
CCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGC
AGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGAC
TTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCA
CAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAG
GAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAG
ATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTG
AGTGACGATGACAGTGAGGAGGAACAAGAGGAGGACCGCTCAGGAAGTGGCAGCGAAGAAGACTGAGCCCCGACATTCCAGTCTCGACCC
CGAGCCCCTCGTTCCAGAGCTGAGATGGCATAGGCCTTAGCAGTAACGGGTAGCAGCAGATGTAGTTTCAGACTTGGAGTAAAACTGTAT
AAACAAAAGAATCTTCCATATTTATACAGCAGAGAAGCTGTAGGACTGTTTGTGACTGGCCCTGTCCTGGCATCAGTAGCATCTGTAACA
GCATTAACTGTCTTAAAGAGAGAGAGAGAGAATTCCGAATTGGGGAACACACGATACCTGTTTTTCTTTTCCGTTGCTGGCAGTACTGTT
GCGCCGCAGTTTGGAGTCACTGTAGTTAAGTGTGGATGCATGTGCGTCACCGTCCACTCCTCCTACTGTATTTTATTGGACAGGTCAGAC

>In-frame_ILF3_ENST00000588657_chr19_10782211_+_SMARCA4_ENST00000450717_chr19_11134194_+_2869nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGAC
GAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGC
AACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGT
GAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTC
AAGACCCTGAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGAC
AGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCG
CCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGT
GGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTC
AAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAG
ACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAG
GATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATC
AAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGT
GACGATGACAGTGAGGAGGAACAAGAGGAGGACCGCTCAGGAAGTGGCAGCGAAGAAGACTGAGCCCCGACATTCCAGTCTCGACCCCGA
GCCCCTCGTTCCAGAGCTGAGATGGCATAGGCCTTAGCAGTAACGGGTAGCAGCAGATGTAGTTTCAGACTTGGAGTAAAACTGTATAAA
CAAAAGAATCTTCCATATTTATACAGCAGAGAAGCTGTAGGACTGTTTGTGACTGGCCCTGTCCTGGCATCAGTAGCATCTGTAACAGCA
TTAACTGTCTTAAAGAGAGAGAGAGAGAATTCCGAATTGGGGAACACACGATACCTGTTTTTCTTTTCCGTTGCTGGCAGTACTGTTGCG
CCGCAGTTTGGAGTCACTGTAGTTAAGTGTGGATGCATGTGCGTCACCGTCCACTCCTCCTACTGTATTTTATTGGACAGGTCAGACTCG

>In-frame_ILF3_ENST00000590261_chr19_10782211_+_SMARCA4_ENST00000358026_chr19_11134194_+_3058nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGAGCAGACACTGCAGCACGGGCAGC
GGCAGTGCCAGCTTCGCCCACACTGCCCCTCCGCCAGCGGGCGTCAACCCCGACTTGGAGGAGCCACCTCTAAAGGAGGAAGACGAGGTG
CCCGACGACGAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAG
GAGGCCCGCAACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGG
CTGACCTGTGAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAG
CAGTGGCTCAAGAAAATTACAGGAAAAGATATCCATGACACAGCCAGCAGTGTGGCACGTGGGCTACAATTCCAGCGTGGCCTTCAGTTC
TGCACACGTGCGTCAAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAG
CGAGACAGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGG
CGGCCGCCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGAC
AGCAGCAGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCC
GTGGACTTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAG
AACGCACAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATC
GAGAAGGAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAA
GTGAAGATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCG
GTCGTGAGTGACGATGACAGTGAGGAGGAACAAGAGGAGGACCGCTCAGGAAGTGGCAGCGAAGAAGACTGAGCCCCGACATTCCAGTCT
CGACCCCGAGCCCCTCGTTCCAGAGCTGAGATGGCATAGGCCTTAGCAGTAACGGGTAGCAGCAGATGTAGTTTCAGACTTGGAGTAAAA
CTGTATAAACAAAAGAATCTTCCATATTTATACAGCAGAGAAGCTGTAGGACTGTTTGTGACTGGCCCTGTCCTGGCATCAGTAGCATCT
GTAACAGCATTAACTGTCTTAAAGAGAGAGAGAGAGAATTCCGAATTGGGGAACACACGATACCTGTTTTTCTTTTCCGTTGCTGGCAGT
ACTGTTGCGCCGCAGTTTGGAGTCACTGTAGTTAAGTGTGGATGCATGTGCGTCACCGTCCACTCCTCCTACTGTATTTTATTGGACAGG

>In-frame_ILF3_ENST00000590261_chr19_10782211_+_SMARCA4_ENST00000344626_chr19_11134194_+_2739nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGAGCAGACACTGCAGCACGGGCAGC
GGCAGTGCCAGCTTCGCCCACACTGCCCCTCCGCCAGCGGGCGTCAACCCCGACTTGGAGGAGCCACCTCTAAAGGAGGAAGACGAGGTG
CCCGACGACGAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAG
GAGGCCCGCAACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGG
CTGACCTGTGAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAG
CAGTGGCTCAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGAC
AGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCG
CCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGC
AGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGAC
TTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCA
CAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAG
GAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAG
ATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTG
AGTGACGATGACAGTGAGGAGGAACAAGAGGAGGACCGCTCAGGAAGTGGCAGCGAAGAAGACTGAGCCCCGACATTCCAGTCTCGACCC
CGAGCCCCTCGTTCCAGAGCTGAGATGGCATAGGCCTTAGCAGTAACGGGTAGCAGCAGATGTAGTTTCAGACTTGGAGTAAAACTGTAT
AAACAAAAGAATCTTCCATATTTATACAGCAGAGAAGCTGTAGGACTGTTTGTGACTGGCCCTGTCCTGGCATCAGTAGCATCTGTAACA

>In-frame_ILF3_ENST00000590261_chr19_10782211_+_SMARCA4_ENST00000429416_chr19_11134194_+_2962nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGAGCAGACACTGCAGCACGGGCAGC
GGCAGTGCCAGCTTCGCCCACACTGCCCCTCCGCCAGCGGGCGTCAACCCCGACTTGGAGGAGCCACCTCTAAAGGAGGAAGACGAGGTG
CCCGACGACGAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAG
GAGGCCCGCAACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGG
CTGACCTGTGAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAG
CAGTGGCTCAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGAC
AGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCG
CCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGC
AGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGAC
TTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCA
CAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAG
GAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAG
ATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTG
AGTGACGATGACAGTGAGGAGGAACAAGAGGAGGACCGCTCAGGAAGTGGCAGCGAAGAAGACTGAGCCCCGACATTCCAGTCTCGACCC
CGAGCCCCTCGTTCCAGAGCTGAGATGGCATAGGCCTTAGCAGTAACGGGTAGCAGCAGATGTAGTTTCAGACTTGGAGTAAAACTGTAT
AAACAAAAGAATCTTCCATATTTATACAGCAGAGAAGCTGTAGGACTGTTTGTGACTGGCCCTGTCCTGGCATCAGTAGCATCTGTAACA
GCATTAACTGTCTTAAAGAGAGAGAGAGAGAATTCCGAATTGGGGAACACACGATACCTGTTTTTCTTTTCCGTTGCTGGCAGTACTGTT
GCGCCGCAGTTTGGAGTCACTGTAGTTAAGTGTGGATGCATGTGCGTCACCGTCCACTCCTCCTACTGTATTTTATTGGACAGGTCAGAC

>In-frame_ILF3_ENST00000590261_chr19_10782211_+_SMARCA4_ENST00000541122_chr19_11134194_+_2406nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGAC
GAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGC
AACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGT
GAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTC
AAGACCCTGAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGAC
AGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCG
CCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGC
AGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGAC
TTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCA
CAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAG
GAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAG
ATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTG

>In-frame_ILF3_ENST00000590261_chr19_10782211_+_SMARCA4_ENST00000589677_chr19_11134194_+_2403nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGAC
GAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGC
AACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGT
GAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTC
AAGACCCTGAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGAC
AGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCG
CCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGT
GGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTC
AAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAG
ACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAG
GATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATC
AAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGT

>In-frame_ILF3_ENST00000590261_chr19_10782211_+_SMARCA4_ENST00000444061_chr19_11134194_+_2394nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGAC
GAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGC
AACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGT
GAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTC
AAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCC
GGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAG
AAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGTGGACGTCAG
CTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATA
AAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAAC
CTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGT
GAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGC
CGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGAC

>In-frame_ILF3_ENST00000590261_chr19_10782211_+_SMARCA4_ENST00000590574_chr19_11134194_+_2397nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGAC
GAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGC
AACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGT
GAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTC
AAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCC
GGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAG
AAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGCAGTGGACGT
CAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAG
ATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTC
AACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGAC
AGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTT
GGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGAT

>In-frame_ILF3_ENST00000590261_chr19_10782211_+_SMARCA4_ENST00000413806_chr19_11134194_+_2872nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGAC
GAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGC
AACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGT
GAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTC
AAGACCCTGAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGAC
AGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCG
CCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGC
AGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGAC
TTCAAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCA
CAGACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAG
GAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAG
ATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTG
AGTGACGATGACAGTGAGGAGGAACAAGAGGAGGACCGCTCAGGAAGTGGCAGCGAAGAAGACTGAGCCCCGACATTCCAGTCTCGACCC
CGAGCCCCTCGTTCCAGAGCTGAGATGGCATAGGCCTTAGCAGTAACGGGTAGCAGCAGATGTAGTTTCAGACTTGGAGTAAAACTGTAT
AAACAAAAGAATCTTCCATATTTATACAGCAGAGAAGCTGTAGGACTGTTTGTGACTGGCCCTGTCCTGGCATCAGTAGCATCTGTAACA
GCATTAACTGTCTTAAAGAGAGAGAGAGAGAATTCCGAATTGGGGAACACACGATACCTGTTTTTCTTTTCCGTTGCTGGCAGTACTGTT
GCGCCGCAGTTTGGAGTCACTGTAGTTAAGTGTGGATGCATGTGCGTCACCGTCCACTCCTCCTACTGTATTTTATTGGACAGGTCAGAC

>In-frame_ILF3_ENST00000590261_chr19_10782211_+_SMARCA4_ENST00000450717_chr19_11134194_+_2869nt
ATGCGTCCAATGCGAATTTTTGTGAATGATGACCGCCATGTGATGGCAAAGCATTCTTCCGTTTATCCAACACAAGAGGAGCTGGAGGCA
GTCCAGAACATGGTGTCCCACACGGAGCGGGCGCTCAAAGCTGTGTCCGACTGGATAGACGAGCAGGAAAAGGGTAGCAGCGAGCAGGCA
GAGTCCGATAACATGGATGTGCCCCCAGAGGACGACAGTAAAGAAGGGGCTGGGGAACAGAAGACGGAGCACATGACCAGAACCCTGCGG
GGAGTGATGCGGGTGGGCCTGGTGGCAAAGGGCCTCCTACTCAAGGGGGACTTGGATCTGGAGCTGGTGCTGCTGTGTAAGGAGAAGCCC
ACAACCGCCCTCCTGGACAAGGTGGCCGACAACCTGGCCATCCAGCTTGCTGTGGACCTGAATGAGGAGGAAACCATTCTCATCATCCGG
CGTCTCCACAAAGTGCTGCGGCCCTTCTTGCTCCGACGACTCAAGAAGGAAGTCGAGGCCCAGTTGCCCGAAAAGGTGGAGTACGTCATC
AAGTGCGACATGTCTGCGCTGCAGCGAGTGCTCTACCGCCACATGCAGGCCAAGGGCGTGCTGCTGACTGATGGCTCCGAGAAGGACAAG
AAGGGCAAAGGCGGCACCAAGACCCTGATGAACACCATCATGCAGCTGCGGAAGATCTGCAACCACCCCTACATGTTCCAGCACATCGAG
GAGTCCTTTTCCGAGCACTTGGGGTTCACTGGCGGCATTGTCCAAGGGCTGGACCTGTACCGAGCCTCGGGTAAATTTGAGCTTCTTGAT
AGAATTCTTCCCAAACTCCGAGCAACCAACCACAAAGTGCTGCTGTTCTGCCAAATGACCTCCCTCATGACCATCATGGAAGATTACTTT
GCGTATCGCGGCTTTAAATACCTCAGGCTTGATGGAACCACGAAGGCGGAGGACCGGGGCATGCTGCTGAAAACCTTCAACGAGCCCGGC
TCTGAGTACTTCATCTTCCTGCTCAGCACCCGGGCTGGGGGGCTCGGCCTGAACCTCCAGTCGGCAGACACTGTGATCATTTTTGACAGC
GACTGGAATCCTCACCAGGACCTGCAAGCGCAGGACCGAGCCCACCGCATCGGGCAGCAGAACGAGGTGCGTGTGCTCCGCCTCTGCACC
GTCAACAGCGTGGAGGAGAAGATCCTAGCTGCAGCCAAGTACAAGCTCAACGTGGACCAGAAGGTGATCCAGGCCGGCATGTTCGACCAG
AAGTCCTCCAGCCATGAGCGGCGCGCCTTCCTGCAGGCCATCCTGGAGCACGAGGAGCAGGATGAGGAGGAAGACGAGGTGCCCGACGAC
GAGACCGTCAACCAGATGATCGCCCGGCACGAGGAGGAGTTTGATCTGTTCATGCGCATGGACCTGGACCGCAGGCGCGAGGAGGCCCGC
AACCCCAAGCGGAAGCCGCGCCTCATGGAGGAGGACGAGCTCCCCTCGTGGATCATCAAGGACGACGCGGAGGTGGAGCGGCTGACCTGT
GAGGAGGAGGAGGAGAAGATGTTCGGCCGTGGCTCCCGCCACCGCAAGGAGGTGGACTACAGCGACTCACTGACGGAGAAGCAGTGGCTC
AAGACCCTGAAGGCCATCGAGGAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGAC
AGCGACGCCGGCTCCTCCACCCCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCG
CCTGCCGAGAAACTCTCCCCTAACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGT
GGACGTCAGCTCAGCGAGGTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTC
AAGAAGATAAAGGAGCGCATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAG
ACCTTCAACCTGGAGGGCTCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAG
GATGACAGTGAAGGCGAGGAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATC
AAGCTTGGCCGGAAGGAGAAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGT
GACGATGACAGTGAGGAGGAACAAGAGGAGGACCGCTCAGGAAGTGGCAGCGAAGAAGACTGAGCCCCGACATTCCAGTCTCGACCCCGA
GCCCCTCGTTCCAGAGCTGAGATGGCATAGGCCTTAGCAGTAACGGGTAGCAGCAGATGTAGTTTCAGACTTGGAGTAAAACTGTATAAA
CAAAAGAATCTTCCATATTTATACAGCAGAGAAGCTGTAGGACTGTTTGTGACTGGCCCTGTCCTGGCATCAGTAGCATCTGTAACAGCA
TTAACTGTCTTAAAGAGAGAGAGAGAGAATTCCGAATTGGGGAACACACGATACCTGTTTTTCTTTTCCGTTGCTGGCAGTACTGTTGCG
CCGCAGTTTGGAGTCACTGTAGTTAAGTGTGGATGCATGTGCGTCACCGTCCACTCCTCCTACTGTATTTTATTGGACAGGTCAGACTCG


Top

FusionGenePPI for ILF3_SMARCA4


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ILF3MAGEA11, TRIP6, KRTAP4-12, MDFI, PLSCR1, PRMT1, GDF9, ILF2, EIF2AK2, FUS, PRKDC, XPO5, RRP1B, HNRNPA1, MEPCE, RPAP1, KHDRBS2, YY1, TADA2A, DGCR8, HDAC5, NOP56, STAU1, ZNF346, NR5A2, SMARCAD1, NDRG1, XRCC6, SF3A2, ARRB2, CUL3, CUL5, CUL2, CDK2, CUL1, COPS5, DCUN1D1, CAND1, NEDD8, LNX1, BIRC2, RAE1, GRK5, DHX9, RPL14, RPS13, RPL13, RPL4, RPL8, RPL19, RPL17, RPL29, RPL21, RPL18, RPL6, RPL11, RPS2, RPS3A, RPS15A, RPL37A, NCL, RPL23, RPL7A, RPL24, RPL7, RPS6, RPL23A, RPL12, RPL15, RPL18A, HNRNPK, RPS26, SF3B1, RPS3, SYNCRIP, MOV10, RPS4X, PABPC1, RPL31, RPS24, RPL27, RPL3, RPS16, RPS8, RPL10A, RPS23, RPL32, RPL5, LMNB1, RPL22, RPS17, HNRNPR, RPS14, RPL9, HSPA5, SRSF5, SRSF3, SART1, RPS28, RNPS1, SF3B5, SF3B6, SNRNP70, SF3B4, TRA2B, RPS25, LSM2, SRRM2, RPS20, RBM39, POLR2A, SFPQ, PHB2, ZNF326, DHX30, PTRF, SON, MRPL41, LETM1, SERINC1, EMC1, RTN4, MRPS14, MRPL42, RCN1, MRPL44, KRT17, QSOX2, MRPL45, MRPL15, OPA1, SSR4, PPT2, PC, RPS27L, MRPL40, SARS2, MRPL4, PTPN1, STOM, PRKCDBP, PGRMC1, TUBA4A, MRPL11, MRPL23, LAMP1, RPN2, NFXL1, RAB31, MYO1C, RAP1A, JUP, IARS2, CHCHD4, MRPL39, UQCRH, RRBP1, MRPS27, NUPL1, MRPS35, PLP2, MRPS5, MRPS9, MRPL1, MRPS10, RPN1, SLIRP, MRPL9, PTBP3, NDUFA2, VTN, UQCRC1, VAMP2, MRPL10, MRPL32, PTCD1, PTDSS2, PPAP2A, SSR1, NUP35, OCIAD2, MYO1E, MRPL20, PDIA4, MRPL12, NOMO1, SLC25A17, PRPH, SNCG, NDUFS6, ALDH18A1, NDUFV1, GAA, RAB2A, TMPO, MYH10, RMDN3, SSBP1, LRRC59, LMO7, PICALM, RPLP0P6, NCLN, RAB14, TPM4, RAB11A, SENP3, MFF, MRPL38, TXN2, SLC12A4, TRIM56, RCN2, RALA, MRPL55, NUCKS1, LPCAT1, DHODH, NDUFB9, LRPPRC, LAMTOR2, NDUFV3, SFXN1, MRPL17, TOMM22, SPCS2, PYROXD1, NXF1, HNRNPC, EIF2A, MAGOH, EIF4A3, FN1, VCAM1, SNRPC, SF1, RBM5, XAB2, ZNF830, HNRNPH2, RNF113A, IFIT2, IFIT3, IL7R, UBL4A, ITGA4, UNC45B, SCARNA22, SNORD88C, SNORD95, RMRP, SNORA34, SNORD50A, SNORD50B, RNU5A-1, KIAA0825, KIF5C, SNORD3C, PCBD2, SNORA57, SNORD19, SNORD10, ELOVL7, SNORD1C, IGKC, HIST1H1E, RPL10, RNU5B-1, HIST2H2BE, ACTG1, SNORD116-18, SNORD116-1, SNORD116-24, MALAT1, HIST1H2AM, HSP90AA1, EEF1A1, SNORA71D, SNORD116-22, RNU2-4P, SNORD116-29, CBX8, IGSF8, ICAM1, CSF2, FBXO6, TARDBP, HNRNPL, VEGFA, VHL, RPA3, RPA2, RPA1, ERG, LGR4, IVNS1ABP, MDM2, AURKA, HUWE1, FBXW11, RBPMS, CUL7, OBSL1, CCDC8, EZH2, SUZ12, EED, RNF2, BMI1, ABL1, ILK, SGK2, SRPK1, TNK1, ESR1, RAD50, MCM5, EP300, NTRK1, DHX16, LSM3, HIST1H3E, HNRNPU, PPP1CB, PPP1CC, SNCA, MATR3, MPHOSPH8, CRY1, MCM2, CDC5L, MEX3C, U2AF2, EGFR, ZNF746, RBM3, EIF2AK3, UBC, CYLD, TRIM25, BRCA1, LMNA, MTF1SMARCA4ESR1, FANCA, ARID1B, RELB, MYC, BRCA1, CTNNB1, NR3C1, SMARCD1, SMARCB1, POLR2A, SMARCC1, SIN3A, HDAC2, RBBP4, KLF1, GATA1, SP1, CCNE1, TP53, HSF1, PHB, RB1, AHR, STAT2, ARID1A, SMARCC2, SMARCE1, ACTL6A, STK11, CBX5, MED17, HSP90B1, NCOR2, NCOR1, ACTB, CREBBP, NCOA1, ING1, PABPN1, AR, ZMYND8, TAF10, PMS2, MYOD1, SMARCA2, JUNB, LMNB1, SRF, MYOCD, CDKN2A, SS18L1, HDAC1, HDAC3, CDYL, ADD1, NR4A2, MCPH1, REST, DDX5, H2AFX, NFE2L2, BCL7C, BRD7, PAX6, CREB1, HSF4, CEBPA, CDX2, MYOG, MYEF2, ATF3, PRMT5, SMARCD2, SIN3B, CHD4, BRWD1, HNRNPC, STAT1, USF1, IRF1, RCOR1, CIITA, ZMIZ2, GMNN, NEUROG2, NEUROD1, NF1, PBX1, NR1H2, RXRA, HIF1A, STAT3, NONO, SMAD2, SMAD3, CARM1, ADNP, STAT5A, CEBPB, PML, MKL1, DPF2, NPM1, KPNA2, BCL7A, ZEB1, HDAC9, TOPBP1, TRIM28, RUNX1, WDR77, HIST1H3A, BCL6, CHD7, PBRM1, ARID2, MARK4, BRD4, WHSC1L1, SMARCAD1, MBD3, KLF4, CDK19, CDK8, MED6, SIRT7, ANGPTL4, ACTC1, SETD7, DPF3, PHF10, DPF1, CHFR, KDM6A, TBX5, SMARCD3, NR2C1, CUL3, COPS5, CAND1, HIST1H4F, HIST2H3C, HIST2H2BE, CHMP5, IKZF1, RBL1, RBL2, RPS6KA5, BAZ1B, TOP2B, CPSF2, SMARCA1, CAD, NOTCH1, RBPJ, MAML1, EPAS1, PPARG, MPP6, FBXO6, WWOX, OBSL1, EED, RNF2, BMI1, SS18, HSPB1, NTRK1, BYSL, EP400, HMGB1, MDC1, MYO18A, PELO, BCL7B, GTF3C3, NOP56, POLR3A, POLR3C, POLR3F, SMC3, UPF1, SCARNA22, MDM2, HIST1H3E, CAT, KPNA1, RAB5C, REEP5, VAPA, PARD6A, NEIL3, ATL2, PAPD5, GLI1, NFATC1, FOXE1, FOXO1, CDC5L, NFATC2, CHEK1, NCL, SPTA1, TRIM25, YAP1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneILF3chr19:10782211chr19:11134194ENST00000250241+317609_894137691PRMT1
HgeneILF3chr19:10782211chr19:11134194ENST00000318511+420609_894137895PRMT1
HgeneILF3chr19:10782211chr19:11134194ENST00000407004+418609_894137707PRMT1
HgeneILF3chr19:10782211chr19:11134194ENST00000420083+418609_894137691PRMT1
HgeneILF3chr19:10782211chr19:11134194ENST00000449870+420609_894137899PRMT1
HgeneILF3chr19:10782211chr19:11134194ENST00000588657+319609_894137899PRMT1
HgeneILF3chr19:10782211chr19:11134194ENST00000589998+418609_894137703PRMT1
HgeneILF3chr19:10782211chr19:11134194ENST00000590261+319609_894137895PRMT1
HgeneILF3chr19:10782211chr19:11134194ENST00000592763+316609_894137699PRMT1


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ILF3_SMARCA4


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for ILF3_SMARCA4


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneSMARCA4C0262584Carcinoma, Small Cell4CTD_human
TgeneSMARCA4C0919267ovarian neoplasm4CTD_human
TgeneSMARCA4C0006413Burkitt Lymphoma1CTD_human
TgeneSMARCA4C0036920Sezary Syndrome1CTD_human
TgeneSMARCA4C0039981Thoracic Neoplasms1CTD_human
TgeneSMARCA4C0149925Small cell carcinoma of lung1CTD_human
TgeneSMARCA4C0265338Coffin-Siris syndrome1CTD_human;ORPHANET
TgeneSMARCA4C1261473Sarcoma1CTD_human
TgeneSMARCA4C3553249MENTAL RETARDATION, AUTOSOMAL DOMINANT 161UNIPROT