FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 17328

FusionGeneSummary for IKZF1_LRBA

check button Fusion gene summary
Fusion gene informationFusion gene name: IKZF1_LRBA
Fusion gene ID: 17328
HgeneTgene
Gene symbol

IKZF1

LRBA

Gene ID

10320

987

Gene nameIKAROS family zinc finger 1LPS responsive beige-like anchor protein
SynonymsCVID13|Hs.54452|IK1|IKAROS|LYF1|LyF-1|PPP1R92|PRO0758|ZNFN1A1BGL|CDC4L|CVID8|LAB300|LBA
Cytomap

7p12.2

4q31.3

Type of geneprotein-codingprotein-coding
DescriptionDNA-binding protein IkarosCLL-associated antigen KW-6ikaros family zinc finger protein 1lymphoid transcription factor LyF-1protein phosphatase 1, regulatory subunit 92zinc finger protein, subfamily 1A, 1 (Ikaros)lipopolysaccharide-responsive and beige-like anchor proteinCDC4-like proteinLPS-responsive vesicle trafficking, beach and anchor containingvesicle trafficking, beach and anchor containing
Modification date2018052720180519
UniProtAcc

Q13422

P50851

Ensembl transtripts involved in fusion geneENST00000440768, ENST00000359197, 
ENST00000343574, ENST00000331340, 
ENST00000349824, ENST00000357364, 
ENST00000346667, ENST00000438033, 
ENST00000439701, ENST00000413698, 
ENST00000492782, 
ENST00000535741, 
ENST00000510413, ENST00000503716, 
ENST00000357115, ENST00000507224, 
Fusion gene scores* DoF score5 X 4 X 3=6015 X 15 X 7=1575
# samples 618
** MAII scorelog2(6/60*10)=0log2(18/1575*10)=-3.12928301694497
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: IKZF1 [Title/Abstract] AND LRBA [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBRCATCGA-D8-A27H-01AIKZF1chr7

50367353

+LRBAchr4

151207186

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000440768ENST00000535741IKZF1chr7

50367353

+LRBAchr4

151207186

-
In-frameENST00000440768ENST00000510413IKZF1chr7

50367353

+LRBAchr4

151207186

-
5CDS-5UTRENST00000440768ENST00000503716IKZF1chr7

50367353

+LRBAchr4

151207186

-
5CDS-5UTRENST00000440768ENST00000357115IKZF1chr7

50367353

+LRBAchr4

151207186

-
5CDS-intronENST00000440768ENST00000507224IKZF1chr7

50367353

+LRBAchr4

151207186

-
In-frameENST00000359197ENST00000535741IKZF1chr7

50367353

+LRBAchr4

151207186

-
In-frameENST00000359197ENST00000510413IKZF1chr7

50367353

+LRBAchr4

151207186

-
5CDS-5UTRENST00000359197ENST00000503716IKZF1chr7

50367353

+LRBAchr4

151207186

-
5CDS-5UTRENST00000359197ENST00000357115IKZF1chr7

50367353

+LRBAchr4

151207186

-
5CDS-intronENST00000359197ENST00000507224IKZF1chr7

50367353

+LRBAchr4

151207186

-
In-frameENST00000343574ENST00000535741IKZF1chr7

50367353

+LRBAchr4

151207186

-
In-frameENST00000343574ENST00000510413IKZF1chr7

50367353

+LRBAchr4

151207186

-
5CDS-5UTRENST00000343574ENST00000503716IKZF1chr7

50367353

+LRBAchr4

151207186

-
5CDS-5UTRENST00000343574ENST00000357115IKZF1chr7

50367353

+LRBAchr4

151207186

-
5CDS-intronENST00000343574ENST00000507224IKZF1chr7

50367353

+LRBAchr4

151207186

-
In-frameENST00000331340ENST00000535741IKZF1chr7

50367353

+LRBAchr4

151207186

-
In-frameENST00000331340ENST00000510413IKZF1chr7

50367353

+LRBAchr4

151207186

-
5CDS-5UTRENST00000331340ENST00000503716IKZF1chr7

50367353

+LRBAchr4

151207186

-
5CDS-5UTRENST00000331340ENST00000357115IKZF1chr7

50367353

+LRBAchr4

151207186

-
5CDS-intronENST00000331340ENST00000507224IKZF1chr7

50367353

+LRBAchr4

151207186

-
In-frameENST00000349824ENST00000535741IKZF1chr7

50367353

+LRBAchr4

151207186

-
In-frameENST00000349824ENST00000510413IKZF1chr7

50367353

+LRBAchr4

151207186

-
5CDS-5UTRENST00000349824ENST00000503716IKZF1chr7

50367353

+LRBAchr4

151207186

-
5CDS-5UTRENST00000349824ENST00000357115IKZF1chr7

50367353

+LRBAchr4

151207186

-
5CDS-intronENST00000349824ENST00000507224IKZF1chr7

50367353

+LRBAchr4

151207186

-
In-frameENST00000357364ENST00000535741IKZF1chr7

50367353

+LRBAchr4

151207186

-
In-frameENST00000357364ENST00000510413IKZF1chr7

50367353

+LRBAchr4

151207186

-
5CDS-5UTRENST00000357364ENST00000503716IKZF1chr7

50367353

+LRBAchr4

151207186

-
5CDS-5UTRENST00000357364ENST00000357115IKZF1chr7

50367353

+LRBAchr4

151207186

-
5CDS-intronENST00000357364ENST00000507224IKZF1chr7

50367353

+LRBAchr4

151207186

-
In-frameENST00000346667ENST00000535741IKZF1chr7

50367353

+LRBAchr4

151207186

-
In-frameENST00000346667ENST00000510413IKZF1chr7

50367353

+LRBAchr4

151207186

-
5CDS-5UTRENST00000346667ENST00000503716IKZF1chr7

50367353

+LRBAchr4

151207186

-
5CDS-5UTRENST00000346667ENST00000357115IKZF1chr7

50367353

+LRBAchr4

151207186

-
5CDS-intronENST00000346667ENST00000507224IKZF1chr7

50367353

+LRBAchr4

151207186

-
In-frameENST00000438033ENST00000535741IKZF1chr7

50367353

+LRBAchr4

151207186

-
In-frameENST00000438033ENST00000510413IKZF1chr7

50367353

+LRBAchr4

151207186

-
5CDS-5UTRENST00000438033ENST00000503716IKZF1chr7

50367353

+LRBAchr4

151207186

-
5CDS-5UTRENST00000438033ENST00000357115IKZF1chr7

50367353

+LRBAchr4

151207186

-
5CDS-intronENST00000438033ENST00000507224IKZF1chr7

50367353

+LRBAchr4

151207186

-
In-frameENST00000439701ENST00000535741IKZF1chr7

50367353

+LRBAchr4

151207186

-
In-frameENST00000439701ENST00000510413IKZF1chr7

50367353

+LRBAchr4

151207186

-
5CDS-5UTRENST00000439701ENST00000503716IKZF1chr7

50367353

+LRBAchr4

151207186

-
5CDS-5UTRENST00000439701ENST00000357115IKZF1chr7

50367353

+LRBAchr4

151207186

-
5CDS-intronENST00000439701ENST00000507224IKZF1chr7

50367353

+LRBAchr4

151207186

-
In-frameENST00000413698ENST00000535741IKZF1chr7

50367353

+LRBAchr4

151207186

-
In-frameENST00000413698ENST00000510413IKZF1chr7

50367353

+LRBAchr4

151207186

-
5CDS-5UTRENST00000413698ENST00000503716IKZF1chr7

50367353

+LRBAchr4

151207186

-
5CDS-5UTRENST00000413698ENST00000357115IKZF1chr7

50367353

+LRBAchr4

151207186

-
5CDS-intronENST00000413698ENST00000507224IKZF1chr7

50367353

+LRBAchr4

151207186

-
3UTR-3CDSENST00000492782ENST00000535741IKZF1chr7

50367353

+LRBAchr4

151207186

-
3UTR-3CDSENST00000492782ENST00000510413IKZF1chr7

50367353

+LRBAchr4

151207186

-
3UTR-5UTRENST00000492782ENST00000503716IKZF1chr7

50367353

+LRBAchr4

151207186

-
3UTR-5UTRENST00000492782ENST00000357115IKZF1chr7

50367353

+LRBAchr4

151207186

-
3UTR-intronENST00000492782ENST00000507224IKZF1chr7

50367353

+LRBAchr4

151207186

-

Top

FusionProtFeatures for IKZF1_LRBA


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
IKZF1

Q13422

LRBA

P50851

Transcription regulator of hematopoietic celldifferentiation (PubMed:17934067). Binds gamma-satellite DNA(PubMed:17135265, PubMed:19141594). Plays a role in thedevelopment of lymphocytes, B- and T-cells. Binds and activatesthe enhancer (delta-A element) of the CD3-delta gene. Repressor ofthe TDT (fikzfterminal deoxynucleotidyltransferase) gene duringthymocyte differentiation. Regulates transcription throughassociation with both HDAC-dependent and HDAC-independentcomplexes. Targets the 2 chromatin-remodeling complexes, NuRD andBAF (SWI/SNF), in a single complex (PYR complex), to the beta-globin locus in adult erythrocytes. Increases normal apoptosis inadult erythroid cells. Confers early temporal competence toretinal progenitor cells (RPCs) (By similarity). Function isisoform-specific and is modulated by dominant-negative inactiveisoforms (PubMed:17135265, PubMed:17934067).{ECO:0000250|UniProtKB:Q03267, ECO:0000269|PubMed:10204490,ECO:0000269|PubMed:17135265, ECO:0000269|PubMed:17934067,ECO:0000269|PubMed:19141594}. May be involved in coupling signal transduction andvesicle trafficking to enable polarized secretion and/or membranedeposition of immune effector molecules. {ECO:0000250}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneLRBAchr7:50367353chr4:151207186ENST00000357115-53582695_273526832864RepeatNote=WD 4
TgeneLRBAchr7:50367353chr4:151207186ENST00000357115-53582777_281626832864RepeatNote=WD 5
TgeneLRBAchr7:50367353chr4:151207186ENST00000357115-53582819_285826832864RepeatNote=WD 6
TgeneLRBAchr7:50367353chr4:151207186ENST00000510413-52572695_273526712852RepeatNote=WD 4
TgeneLRBAchr7:50367353chr4:151207186ENST00000510413-52572777_281626712852RepeatNote=WD 5
TgeneLRBAchr7:50367353chr4:151207186ENST00000510413-52572819_285826712852RepeatNote=WD 6

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneIKZF1chr7:50367353chr4:151207186ENST00000331340+38373_37653520Compositional biasNote=Poly-Leu
HgeneIKZF1chr7:50367353chr4:151207186ENST00000343574+37373_37653433Compositional biasNote=Poly-Leu
HgeneIKZF1chr7:50367353chr4:151207186ENST00000346667+34373_37653290Compositional biasNote=Poly-Leu
HgeneIKZF1chr7:50367353chr4:151207186ENST00000349824+35373_37653377Compositional biasNote=Poly-Leu
HgeneIKZF1chr7:50367353chr4:151207186ENST00000357364+36373_37653433Compositional biasNote=Poly-Leu
HgeneIKZF1chr7:50367353chr4:151207186ENST00000359197+37373_37653478Compositional biasNote=Poly-Leu
HgeneIKZF1chr7:50367353chr4:151207186ENST00000438033+37373_37653433Compositional biasNote=Poly-Leu
HgeneIKZF1chr7:50367353chr4:151207186ENST00000439701+37373_37653478Compositional biasNote=Poly-Leu
HgeneIKZF1chr7:50367353chr4:151207186ENST00000440768+38373_376531049Compositional biasNote=Poly-Leu
HgeneIKZF1chr7:50367353chr4:151207186ENST00000331340+38154_16353520RegionRequired for both high-affinity DNA binding and pericentromeric heterochromatin localization
HgeneIKZF1chr7:50367353chr4:151207186ENST00000331340+38180_19553520RegionRequired for both high-affinity DNA binding and pericentromeric heterochromatin localization
HgeneIKZF1chr7:50367353chr4:151207186ENST00000331340+38468_47153520RegionRequired for binding PP1CC
HgeneIKZF1chr7:50367353chr4:151207186ENST00000343574+37154_16353433RegionRequired for both high-affinity DNA binding and pericentromeric heterochromatin localization
HgeneIKZF1chr7:50367353chr4:151207186ENST00000343574+37180_19553433RegionRequired for both high-affinity DNA binding and pericentromeric heterochromatin localization
HgeneIKZF1chr7:50367353chr4:151207186ENST00000343574+37468_47153433RegionRequired for binding PP1CC
HgeneIKZF1chr7:50367353chr4:151207186ENST00000346667+34154_16353290RegionRequired for both high-affinity DNA binding and pericentromeric heterochromatin localization
HgeneIKZF1chr7:50367353chr4:151207186ENST00000346667+34180_19553290RegionRequired for both high-affinity DNA binding and pericentromeric heterochromatin localization
HgeneIKZF1chr7:50367353chr4:151207186ENST00000346667+34468_47153290RegionRequired for binding PP1CC
HgeneIKZF1chr7:50367353chr4:151207186ENST00000349824+35154_16353377RegionRequired for both high-affinity DNA binding and pericentromeric heterochromatin localization
HgeneIKZF1chr7:50367353chr4:151207186ENST00000349824+35180_19553377RegionRequired for both high-affinity DNA binding and pericentromeric heterochromatin localization
HgeneIKZF1chr7:50367353chr4:151207186ENST00000349824+35468_47153377RegionRequired for binding PP1CC
HgeneIKZF1chr7:50367353chr4:151207186ENST00000357364+36154_16353433RegionRequired for both high-affinity DNA binding and pericentromeric heterochromatin localization
HgeneIKZF1chr7:50367353chr4:151207186ENST00000357364+36180_19553433RegionRequired for both high-affinity DNA binding and pericentromeric heterochromatin localization
HgeneIKZF1chr7:50367353chr4:151207186ENST00000357364+36468_47153433RegionRequired for binding PP1CC
HgeneIKZF1chr7:50367353chr4:151207186ENST00000359197+37154_16353478RegionRequired for both high-affinity DNA binding and pericentromeric heterochromatin localization
HgeneIKZF1chr7:50367353chr4:151207186ENST00000359197+37180_19553478RegionRequired for both high-affinity DNA binding and pericentromeric heterochromatin localization
HgeneIKZF1chr7:50367353chr4:151207186ENST00000359197+37468_47153478RegionRequired for binding PP1CC
HgeneIKZF1chr7:50367353chr4:151207186ENST00000438033+37154_16353433RegionRequired for both high-affinity DNA binding and pericentromeric heterochromatin localization
HgeneIKZF1chr7:50367353chr4:151207186ENST00000438033+37180_19553433RegionRequired for both high-affinity DNA binding and pericentromeric heterochromatin localization
HgeneIKZF1chr7:50367353chr4:151207186ENST00000438033+37468_47153433RegionRequired for binding PP1CC
HgeneIKZF1chr7:50367353chr4:151207186ENST00000439701+37154_16353478RegionRequired for both high-affinity DNA binding and pericentromeric heterochromatin localization
HgeneIKZF1chr7:50367353chr4:151207186ENST00000439701+37180_19553478RegionRequired for both high-affinity DNA binding and pericentromeric heterochromatin localization
HgeneIKZF1chr7:50367353chr4:151207186ENST00000439701+37468_47153478RegionRequired for binding PP1CC
HgeneIKZF1chr7:50367353chr4:151207186ENST00000440768+38154_163531049RegionRequired for both high-affinity DNA binding and pericentromeric heterochromatin localization
HgeneIKZF1chr7:50367353chr4:151207186ENST00000440768+38180_195531049RegionRequired for both high-affinity DNA binding and pericentromeric heterochromatin localization
HgeneIKZF1chr7:50367353chr4:151207186ENST00000440768+38468_471531049RegionRequired for binding PP1CC
HgeneIKZF1chr7:50367353chr4:151207186ENST00000331340+38117_13953520Zinc fingerC2H2-type 1
HgeneIKZF1chr7:50367353chr4:151207186ENST00000331340+38145_16753520Zinc fingerC2H2-type 2
HgeneIKZF1chr7:50367353chr4:151207186ENST00000331340+38173_19553520Zinc fingerC2H2-type 3
HgeneIKZF1chr7:50367353chr4:151207186ENST00000331340+38201_22453520Zinc fingerC2H2-type 4
HgeneIKZF1chr7:50367353chr4:151207186ENST00000331340+38462_48453520Zinc fingerC2H2-type 5
HgeneIKZF1chr7:50367353chr4:151207186ENST00000331340+38490_51453520Zinc fingerC2H2-type 6
HgeneIKZF1chr7:50367353chr4:151207186ENST00000343574+37117_13953433Zinc fingerC2H2-type 1
HgeneIKZF1chr7:50367353chr4:151207186ENST00000343574+37145_16753433Zinc fingerC2H2-type 2
HgeneIKZF1chr7:50367353chr4:151207186ENST00000343574+37173_19553433Zinc fingerC2H2-type 3
HgeneIKZF1chr7:50367353chr4:151207186ENST00000343574+37201_22453433Zinc fingerC2H2-type 4
HgeneIKZF1chr7:50367353chr4:151207186ENST00000343574+37462_48453433Zinc fingerC2H2-type 5
HgeneIKZF1chr7:50367353chr4:151207186ENST00000343574+37490_51453433Zinc fingerC2H2-type 6
HgeneIKZF1chr7:50367353chr4:151207186ENST00000346667+34117_13953290Zinc fingerC2H2-type 1
HgeneIKZF1chr7:50367353chr4:151207186ENST00000346667+34145_16753290Zinc fingerC2H2-type 2
HgeneIKZF1chr7:50367353chr4:151207186ENST00000346667+34173_19553290Zinc fingerC2H2-type 3
HgeneIKZF1chr7:50367353chr4:151207186ENST00000346667+34201_22453290Zinc fingerC2H2-type 4
HgeneIKZF1chr7:50367353chr4:151207186ENST00000346667+34462_48453290Zinc fingerC2H2-type 5
HgeneIKZF1chr7:50367353chr4:151207186ENST00000346667+34490_51453290Zinc fingerC2H2-type 6
HgeneIKZF1chr7:50367353chr4:151207186ENST00000349824+35117_13953377Zinc fingerC2H2-type 1
HgeneIKZF1chr7:50367353chr4:151207186ENST00000349824+35145_16753377Zinc fingerC2H2-type 2
HgeneIKZF1chr7:50367353chr4:151207186ENST00000349824+35173_19553377Zinc fingerC2H2-type 3
HgeneIKZF1chr7:50367353chr4:151207186ENST00000349824+35201_22453377Zinc fingerC2H2-type 4
HgeneIKZF1chr7:50367353chr4:151207186ENST00000349824+35462_48453377Zinc fingerC2H2-type 5
HgeneIKZF1chr7:50367353chr4:151207186ENST00000349824+35490_51453377Zinc fingerC2H2-type 6
HgeneIKZF1chr7:50367353chr4:151207186ENST00000357364+36117_13953433Zinc fingerC2H2-type 1
HgeneIKZF1chr7:50367353chr4:151207186ENST00000357364+36145_16753433Zinc fingerC2H2-type 2
HgeneIKZF1chr7:50367353chr4:151207186ENST00000357364+36173_19553433Zinc fingerC2H2-type 3
HgeneIKZF1chr7:50367353chr4:151207186ENST00000357364+36201_22453433Zinc fingerC2H2-type 4
HgeneIKZF1chr7:50367353chr4:151207186ENST00000357364+36462_48453433Zinc fingerC2H2-type 5
HgeneIKZF1chr7:50367353chr4:151207186ENST00000357364+36490_51453433Zinc fingerC2H2-type 6
HgeneIKZF1chr7:50367353chr4:151207186ENST00000359197+37117_13953478Zinc fingerC2H2-type 1
HgeneIKZF1chr7:50367353chr4:151207186ENST00000359197+37145_16753478Zinc fingerC2H2-type 2
HgeneIKZF1chr7:50367353chr4:151207186ENST00000359197+37173_19553478Zinc fingerC2H2-type 3
HgeneIKZF1chr7:50367353chr4:151207186ENST00000359197+37201_22453478Zinc fingerC2H2-type 4
HgeneIKZF1chr7:50367353chr4:151207186ENST00000359197+37462_48453478Zinc fingerC2H2-type 5
HgeneIKZF1chr7:50367353chr4:151207186ENST00000359197+37490_51453478Zinc fingerC2H2-type 6
HgeneIKZF1chr7:50367353chr4:151207186ENST00000438033+37117_13953433Zinc fingerC2H2-type 1
HgeneIKZF1chr7:50367353chr4:151207186ENST00000438033+37145_16753433Zinc fingerC2H2-type 2
HgeneIKZF1chr7:50367353chr4:151207186ENST00000438033+37173_19553433Zinc fingerC2H2-type 3
HgeneIKZF1chr7:50367353chr4:151207186ENST00000438033+37201_22453433Zinc fingerC2H2-type 4
HgeneIKZF1chr7:50367353chr4:151207186ENST00000438033+37462_48453433Zinc fingerC2H2-type 5
HgeneIKZF1chr7:50367353chr4:151207186ENST00000438033+37490_51453433Zinc fingerC2H2-type 6
HgeneIKZF1chr7:50367353chr4:151207186ENST00000439701+37117_13953478Zinc fingerC2H2-type 1
HgeneIKZF1chr7:50367353chr4:151207186ENST00000439701+37145_16753478Zinc fingerC2H2-type 2
HgeneIKZF1chr7:50367353chr4:151207186ENST00000439701+37173_19553478Zinc fingerC2H2-type 3
HgeneIKZF1chr7:50367353chr4:151207186ENST00000439701+37201_22453478Zinc fingerC2H2-type 4
HgeneIKZF1chr7:50367353chr4:151207186ENST00000439701+37462_48453478Zinc fingerC2H2-type 5
HgeneIKZF1chr7:50367353chr4:151207186ENST00000439701+37490_51453478Zinc fingerC2H2-type 6
HgeneIKZF1chr7:50367353chr4:151207186ENST00000440768+38117_139531049Zinc fingerC2H2-type 1
HgeneIKZF1chr7:50367353chr4:151207186ENST00000440768+38145_167531049Zinc fingerC2H2-type 2
HgeneIKZF1chr7:50367353chr4:151207186ENST00000440768+38173_195531049Zinc fingerC2H2-type 3
HgeneIKZF1chr7:50367353chr4:151207186ENST00000440768+38201_224531049Zinc fingerC2H2-type 4
HgeneIKZF1chr7:50367353chr4:151207186ENST00000440768+38462_484531049Zinc fingerC2H2-type 5
HgeneIKZF1chr7:50367353chr4:151207186ENST00000440768+38490_514531049Zinc fingerC2H2-type 6
TgeneLRBAchr7:50367353chr4:151207186ENST00000357115-53581006_105326832864Coiled coilOntology_term=ECO:0000255
TgeneLRBAchr7:50367353chr4:151207186ENST00000510413-52571006_105326712852Coiled coilOntology_term=ECO:0000255
TgeneLRBAchr7:50367353chr4:151207186ENST00000357115-53581990_199426832864Compositional biasNote=Poly-Arg
TgeneLRBAchr7:50367353chr4:151207186ENST00000510413-52571990_199426712852Compositional biasNote=Poly-Arg
TgeneLRBAchr7:50367353chr4:151207186ENST00000357115-53582073_218126832864DomainBEACH-type PH
TgeneLRBAchr7:50367353chr4:151207186ENST00000357115-53582200_248926832864DomainBEACH
TgeneLRBAchr7:50367353chr4:151207186ENST00000510413-52572073_218126712852DomainBEACH-type PH
TgeneLRBAchr7:50367353chr4:151207186ENST00000510413-52572200_248926712852DomainBEACH
TgeneLRBAchr7:50367353chr4:151207186ENST00000357115-53581301_134326832864RepeatNote=WD 1
TgeneLRBAchr7:50367353chr4:151207186ENST00000357115-53582591_263326832864RepeatNote=WD 2
TgeneLRBAchr7:50367353chr4:151207186ENST00000357115-53582636_267926832864RepeatNote=WD 3
TgeneLRBAchr7:50367353chr4:151207186ENST00000510413-52571301_134326712852RepeatNote=WD 1
TgeneLRBAchr7:50367353chr4:151207186ENST00000510413-52572591_263326712852RepeatNote=WD 2
TgeneLRBAchr7:50367353chr4:151207186ENST00000510413-52572636_267926712852RepeatNote=WD 3
TgeneLRBAchr7:50367353chr4:151207186ENST00000357115-53581531_154826832864TransmembraneHelical
TgeneLRBAchr7:50367353chr4:151207186ENST00000510413-52571531_154826712852TransmembraneHelical


Top

FusionGeneSequence for IKZF1_LRBA


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_IKZF1_ENST00000440768_chr7_50367353_+_LRBA_ENST00000535741_chr4_151207186_-_234aa
MDADEGQDMSQVSGKESPPVSDTPDEGDEPMPIPEDLSTTSGGQQSSKSDRVVGETAAPRAILTGHDTEVTCAAVCAELGLVLSGSQEGP
CLIHSMNGDLLRTLEGPENCLKPKLIQASREGHCVIFTENGLFCTFSVNGKLQATMETDDNIRAIQLSRDGQYLLTGGDRGVVVVRQVSD

>In-frame_IKZF1_ENST00000440768_chr7_50367353_+_LRBA_ENST00000510413_chr4_151207186_-_234aa
MDADEGQDMSQVSGKESPPVSDTPDEGDEPMPIPEDLSTTSGGQQSSKSDRVVGETAAPRAILTGHDTEVTCAAVCAELGLVLSGSQEGP
CLIHSMNGDLLRTLEGPENCLKPKLIQASREGHCVIFTENGLFCTFSVNGKLQATMETDDNIRAIQLSRDGQYLLTGGDRGVVVVRQVSD

>In-frame_IKZF1_ENST00000359197_chr7_50367353_+_LRBA_ENST00000535741_chr4_151207186_-_234aa
MDADEGQDMSQVSGKESPPVSDTPDEGDEPMPIPEDLSTTSGGQQSSKSDRVVGETAAPRAILTGHDTEVTCAAVCAELGLVLSGSQEGP
CLIHSMNGDLLRTLEGPENCLKPKLIQASREGHCVIFTENGLFCTFSVNGKLQATMETDDNIRAIQLSRDGQYLLTGGDRGVVVVRQVSD

>In-frame_IKZF1_ENST00000359197_chr7_50367353_+_LRBA_ENST00000510413_chr4_151207186_-_234aa
MDADEGQDMSQVSGKESPPVSDTPDEGDEPMPIPEDLSTTSGGQQSSKSDRVVGETAAPRAILTGHDTEVTCAAVCAELGLVLSGSQEGP
CLIHSMNGDLLRTLEGPENCLKPKLIQASREGHCVIFTENGLFCTFSVNGKLQATMETDDNIRAIQLSRDGQYLLTGGDRGVVVVRQVSD

>In-frame_IKZF1_ENST00000343574_chr7_50367353_+_LRBA_ENST00000535741_chr4_151207186_-_234aa
MDADEGQDMSQVSGKESPPVSDTPDEGDEPMPIPEDLSTTSGGQQSSKSDRVVGETAAPRAILTGHDTEVTCAAVCAELGLVLSGSQEGP
CLIHSMNGDLLRTLEGPENCLKPKLIQASREGHCVIFTENGLFCTFSVNGKLQATMETDDNIRAIQLSRDGQYLLTGGDRGVVVVRQVSD

>In-frame_IKZF1_ENST00000343574_chr7_50367353_+_LRBA_ENST00000510413_chr4_151207186_-_234aa
MDADEGQDMSQVSGKESPPVSDTPDEGDEPMPIPEDLSTTSGGQQSSKSDRVVGETAAPRAILTGHDTEVTCAAVCAELGLVLSGSQEGP
CLIHSMNGDLLRTLEGPENCLKPKLIQASREGHCVIFTENGLFCTFSVNGKLQATMETDDNIRAIQLSRDGQYLLTGGDRGVVVVRQVSD

>In-frame_IKZF1_ENST00000331340_chr7_50367353_+_LRBA_ENST00000535741_chr4_151207186_-_234aa
MDADEGQDMSQVSGKESPPVSDTPDEGDEPMPIPEDLSTTSGGQQSSKSDRVVGETAAPRAILTGHDTEVTCAAVCAELGLVLSGSQEGP
CLIHSMNGDLLRTLEGPENCLKPKLIQASREGHCVIFTENGLFCTFSVNGKLQATMETDDNIRAIQLSRDGQYLLTGGDRGVVVVRQVSD

>In-frame_IKZF1_ENST00000331340_chr7_50367353_+_LRBA_ENST00000510413_chr4_151207186_-_234aa
MDADEGQDMSQVSGKESPPVSDTPDEGDEPMPIPEDLSTTSGGQQSSKSDRVVGETAAPRAILTGHDTEVTCAAVCAELGLVLSGSQEGP
CLIHSMNGDLLRTLEGPENCLKPKLIQASREGHCVIFTENGLFCTFSVNGKLQATMETDDNIRAIQLSRDGQYLLTGGDRGVVVVRQVSD

>In-frame_IKZF1_ENST00000349824_chr7_50367353_+_LRBA_ENST00000535741_chr4_151207186_-_234aa
MDADEGQDMSQVSGKESPPVSDTPDEGDEPMPIPEDLSTTSGGQQSSKSDRVVGETAAPRAILTGHDTEVTCAAVCAELGLVLSGSQEGP
CLIHSMNGDLLRTLEGPENCLKPKLIQASREGHCVIFTENGLFCTFSVNGKLQATMETDDNIRAIQLSRDGQYLLTGGDRGVVVVRQVSD

>In-frame_IKZF1_ENST00000349824_chr7_50367353_+_LRBA_ENST00000510413_chr4_151207186_-_234aa
MDADEGQDMSQVSGKESPPVSDTPDEGDEPMPIPEDLSTTSGGQQSSKSDRVVGETAAPRAILTGHDTEVTCAAVCAELGLVLSGSQEGP
CLIHSMNGDLLRTLEGPENCLKPKLIQASREGHCVIFTENGLFCTFSVNGKLQATMETDDNIRAIQLSRDGQYLLTGGDRGVVVVRQVSD

>In-frame_IKZF1_ENST00000357364_chr7_50367353_+_LRBA_ENST00000535741_chr4_151207186_-_234aa
MDADEGQDMSQVSGKESPPVSDTPDEGDEPMPIPEDLSTTSGGQQSSKSDRVVGETAAPRAILTGHDTEVTCAAVCAELGLVLSGSQEGP
CLIHSMNGDLLRTLEGPENCLKPKLIQASREGHCVIFTENGLFCTFSVNGKLQATMETDDNIRAIQLSRDGQYLLTGGDRGVVVVRQVSD

>In-frame_IKZF1_ENST00000357364_chr7_50367353_+_LRBA_ENST00000510413_chr4_151207186_-_234aa
MDADEGQDMSQVSGKESPPVSDTPDEGDEPMPIPEDLSTTSGGQQSSKSDRVVGETAAPRAILTGHDTEVTCAAVCAELGLVLSGSQEGP
CLIHSMNGDLLRTLEGPENCLKPKLIQASREGHCVIFTENGLFCTFSVNGKLQATMETDDNIRAIQLSRDGQYLLTGGDRGVVVVRQVSD

>In-frame_IKZF1_ENST00000346667_chr7_50367353_+_LRBA_ENST00000535741_chr4_151207186_-_234aa
MDADEGQDMSQVSGKESPPVSDTPDEGDEPMPIPEDLSTTSGGQQSSKSDRVVGETAAPRAILTGHDTEVTCAAVCAELGLVLSGSQEGP
CLIHSMNGDLLRTLEGPENCLKPKLIQASREGHCVIFTENGLFCTFSVNGKLQATMETDDNIRAIQLSRDGQYLLTGGDRGVVVVRQVSD

>In-frame_IKZF1_ENST00000346667_chr7_50367353_+_LRBA_ENST00000510413_chr4_151207186_-_234aa
MDADEGQDMSQVSGKESPPVSDTPDEGDEPMPIPEDLSTTSGGQQSSKSDRVVGETAAPRAILTGHDTEVTCAAVCAELGLVLSGSQEGP
CLIHSMNGDLLRTLEGPENCLKPKLIQASREGHCVIFTENGLFCTFSVNGKLQATMETDDNIRAIQLSRDGQYLLTGGDRGVVVVRQVSD

>In-frame_IKZF1_ENST00000438033_chr7_50367353_+_LRBA_ENST00000535741_chr4_151207186_-_234aa
MDADEGQDMSQVSGKESPPVSDTPDEGDEPMPIPEDLSTTSGGQQSSKSDRVVGETAAPRAILTGHDTEVTCAAVCAELGLVLSGSQEGP
CLIHSMNGDLLRTLEGPENCLKPKLIQASREGHCVIFTENGLFCTFSVNGKLQATMETDDNIRAIQLSRDGQYLLTGGDRGVVVVRQVSD

>In-frame_IKZF1_ENST00000438033_chr7_50367353_+_LRBA_ENST00000510413_chr4_151207186_-_234aa
MDADEGQDMSQVSGKESPPVSDTPDEGDEPMPIPEDLSTTSGGQQSSKSDRVVGETAAPRAILTGHDTEVTCAAVCAELGLVLSGSQEGP
CLIHSMNGDLLRTLEGPENCLKPKLIQASREGHCVIFTENGLFCTFSVNGKLQATMETDDNIRAIQLSRDGQYLLTGGDRGVVVVRQVSD

>In-frame_IKZF1_ENST00000439701_chr7_50367353_+_LRBA_ENST00000535741_chr4_151207186_-_234aa
MDADEGQDMSQVSGKESPPVSDTPDEGDEPMPIPEDLSTTSGGQQSSKSDRVVGETAAPRAILTGHDTEVTCAAVCAELGLVLSGSQEGP
CLIHSMNGDLLRTLEGPENCLKPKLIQASREGHCVIFTENGLFCTFSVNGKLQATMETDDNIRAIQLSRDGQYLLTGGDRGVVVVRQVSD

>In-frame_IKZF1_ENST00000439701_chr7_50367353_+_LRBA_ENST00000510413_chr4_151207186_-_234aa
MDADEGQDMSQVSGKESPPVSDTPDEGDEPMPIPEDLSTTSGGQQSSKSDRVVGETAAPRAILTGHDTEVTCAAVCAELGLVLSGSQEGP
CLIHSMNGDLLRTLEGPENCLKPKLIQASREGHCVIFTENGLFCTFSVNGKLQATMETDDNIRAIQLSRDGQYLLTGGDRGVVVVRQVSD

>In-frame_IKZF1_ENST00000413698_chr7_50367353_+_LRBA_ENST00000535741_chr4_151207186_-_234aa
MDADEGQDMSQVSGKESPPVSDTPDEGDEPMPIPEDLSTTSGGQQSSKSDRVVGETAAPRAILTGHDTEVTCAAVCAELGLVLSGSQEGP
CLIHSMNGDLLRTLEGPENCLKPKLIQASREGHCVIFTENGLFCTFSVNGKLQATMETDDNIRAIQLSRDGQYLLTGGDRGVVVVRQVSD

>In-frame_IKZF1_ENST00000413698_chr7_50367353_+_LRBA_ENST00000510413_chr4_151207186_-_234aa
MDADEGQDMSQVSGKESPPVSDTPDEGDEPMPIPEDLSTTSGGQQSSKSDRVVGETAAPRAILTGHDTEVTCAAVCAELGLVLSGSQEGP
CLIHSMNGDLLRTLEGPENCLKPKLIQASREGHCVIFTENGLFCTFSVNGKLQATMETDDNIRAIQLSRDGQYLLTGGDRGVVVVRQVSD


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_IKZF1_ENST00000440768_chr7_50367353_+_LRBA_ENST00000535741_chr4_151207186_-_702nt
ATGGATGCTGATGAGGGTCAAGACATGTCCCAAGTTTCAGGGAAGGAAAGCCCCCCTGTAAGCGATACTCCAGATGAGGGCGATGAGCCC
ATGCCGATCCCCGAGGACCTCTCCACCACCTCGGGAGGACAGCAAAGCTCCAAGAGTGACAGAGTCGTGGGTGAGACTGCTGCTCCTCGG
GCCATTTTGACCGGCCATGACTATGAGGTCACATGTGCTGCGGTGTGTGCGGAGCTAGGCCTGGTGTTGAGTGGTTCACAAGAAGGACCA
TGTCTCATACATTCCATGAATGGAGACTTGTTGAGGACCTTGGAGGGTCCTGAAAACTGCCTGAAACCAAAACTCATTCAGGCTTCAAGA
GAGGGTCATTGTGTCATATTCTATGAAAACGGCCTCTTCTGTACATTCAGTGTGAATGGAAAACTCCAGGCCACGATGGAAACAGATGAT
AACATAAGAGCCATCCAGCTGAGCCGAGATGGGCAGTACCTGCTCACAGGAGGAGACAGAGGAGTGGTCGTGGTCCGGCAGGTGTCGGAC
CTCAAGCAGCTCTTTGCCTATCCAGGATGTGACGCTGGAATCCGGGCCATGGCGCTGTCTTACGACCAGAGGTGCATCATTTCTGGCATG

>In-frame_IKZF1_ENST00000440768_chr7_50367353_+_LRBA_ENST00000510413_chr4_151207186_-_702nt
ATGGATGCTGATGAGGGTCAAGACATGTCCCAAGTTTCAGGGAAGGAAAGCCCCCCTGTAAGCGATACTCCAGATGAGGGCGATGAGCCC
ATGCCGATCCCCGAGGACCTCTCCACCACCTCGGGAGGACAGCAAAGCTCCAAGAGTGACAGAGTCGTGGGTGAGACTGCTGCTCCTCGG
GCCATTTTGACCGGCCATGACTATGAGGTCACATGTGCTGCGGTGTGTGCGGAGCTAGGCCTGGTGTTGAGTGGTTCACAAGAAGGACCA
TGTCTCATACATTCCATGAATGGAGACTTGTTGAGGACCTTGGAGGGTCCTGAAAACTGCCTGAAACCAAAACTCATTCAGGCTTCAAGA
GAGGGTCATTGTGTCATATTCTATGAAAACGGCCTCTTCTGTACATTCAGTGTGAATGGAAAACTCCAGGCCACGATGGAAACAGATGAT
AACATAAGAGCCATCCAGCTGAGCCGAGATGGGCAGTACCTGCTCACAGGAGGAGACAGAGGAGTGGTCGTGGTCCGGCAGGTGTCGGAC
CTCAAGCAGCTCTTTGCCTATCCAGGATGTGACGCTGGAATCCGGGCCATGGCGCTGTCTTACGACCAGAGGTGCATCATTTCTGGCATG

>In-frame_IKZF1_ENST00000359197_chr7_50367353_+_LRBA_ENST00000535741_chr4_151207186_-_702nt
ATGGATGCTGATGAGGGTCAAGACATGTCCCAAGTTTCAGGGAAGGAAAGCCCCCCTGTAAGCGATACTCCAGATGAGGGCGATGAGCCC
ATGCCGATCCCCGAGGACCTCTCCACCACCTCGGGAGGACAGCAAAGCTCCAAGAGTGACAGAGTCGTGGGTGAGACTGCTGCTCCTCGG
GCCATTTTGACCGGCCATGACTATGAGGTCACATGTGCTGCGGTGTGTGCGGAGCTAGGCCTGGTGTTGAGTGGTTCACAAGAAGGACCA
TGTCTCATACATTCCATGAATGGAGACTTGTTGAGGACCTTGGAGGGTCCTGAAAACTGCCTGAAACCAAAACTCATTCAGGCTTCAAGA
GAGGGTCATTGTGTCATATTCTATGAAAACGGCCTCTTCTGTACATTCAGTGTGAATGGAAAACTCCAGGCCACGATGGAAACAGATGAT
AACATAAGAGCCATCCAGCTGAGCCGAGATGGGCAGTACCTGCTCACAGGAGGAGACAGAGGAGTGGTCGTGGTCCGGCAGGTGTCGGAC
CTCAAGCAGCTCTTTGCCTATCCAGGATGTGACGCTGGAATCCGGGCCATGGCGCTGTCTTACGACCAGAGGTGCATCATTTCTGGCATG

>In-frame_IKZF1_ENST00000359197_chr7_50367353_+_LRBA_ENST00000510413_chr4_151207186_-_702nt
ATGGATGCTGATGAGGGTCAAGACATGTCCCAAGTTTCAGGGAAGGAAAGCCCCCCTGTAAGCGATACTCCAGATGAGGGCGATGAGCCC
ATGCCGATCCCCGAGGACCTCTCCACCACCTCGGGAGGACAGCAAAGCTCCAAGAGTGACAGAGTCGTGGGTGAGACTGCTGCTCCTCGG
GCCATTTTGACCGGCCATGACTATGAGGTCACATGTGCTGCGGTGTGTGCGGAGCTAGGCCTGGTGTTGAGTGGTTCACAAGAAGGACCA
TGTCTCATACATTCCATGAATGGAGACTTGTTGAGGACCTTGGAGGGTCCTGAAAACTGCCTGAAACCAAAACTCATTCAGGCTTCAAGA
GAGGGTCATTGTGTCATATTCTATGAAAACGGCCTCTTCTGTACATTCAGTGTGAATGGAAAACTCCAGGCCACGATGGAAACAGATGAT
AACATAAGAGCCATCCAGCTGAGCCGAGATGGGCAGTACCTGCTCACAGGAGGAGACAGAGGAGTGGTCGTGGTCCGGCAGGTGTCGGAC
CTCAAGCAGCTCTTTGCCTATCCAGGATGTGACGCTGGAATCCGGGCCATGGCGCTGTCTTACGACCAGAGGTGCATCATTTCTGGCATG

>In-frame_IKZF1_ENST00000343574_chr7_50367353_+_LRBA_ENST00000535741_chr4_151207186_-_702nt
ATGGATGCTGATGAGGGTCAAGACATGTCCCAAGTTTCAGGGAAGGAAAGCCCCCCTGTAAGCGATACTCCAGATGAGGGCGATGAGCCC
ATGCCGATCCCCGAGGACCTCTCCACCACCTCGGGAGGACAGCAAAGCTCCAAGAGTGACAGAGTCGTGGGTGAGACTGCTGCTCCTCGG
GCCATTTTGACCGGCCATGACTATGAGGTCACATGTGCTGCGGTGTGTGCGGAGCTAGGCCTGGTGTTGAGTGGTTCACAAGAAGGACCA
TGTCTCATACATTCCATGAATGGAGACTTGTTGAGGACCTTGGAGGGTCCTGAAAACTGCCTGAAACCAAAACTCATTCAGGCTTCAAGA
GAGGGTCATTGTGTCATATTCTATGAAAACGGCCTCTTCTGTACATTCAGTGTGAATGGAAAACTCCAGGCCACGATGGAAACAGATGAT
AACATAAGAGCCATCCAGCTGAGCCGAGATGGGCAGTACCTGCTCACAGGAGGAGACAGAGGAGTGGTCGTGGTCCGGCAGGTGTCGGAC
CTCAAGCAGCTCTTTGCCTATCCAGGATGTGACGCTGGAATCCGGGCCATGGCGCTGTCTTACGACCAGAGGTGCATCATTTCTGGCATG

>In-frame_IKZF1_ENST00000343574_chr7_50367353_+_LRBA_ENST00000510413_chr4_151207186_-_702nt
ATGGATGCTGATGAGGGTCAAGACATGTCCCAAGTTTCAGGGAAGGAAAGCCCCCCTGTAAGCGATACTCCAGATGAGGGCGATGAGCCC
ATGCCGATCCCCGAGGACCTCTCCACCACCTCGGGAGGACAGCAAAGCTCCAAGAGTGACAGAGTCGTGGGTGAGACTGCTGCTCCTCGG
GCCATTTTGACCGGCCATGACTATGAGGTCACATGTGCTGCGGTGTGTGCGGAGCTAGGCCTGGTGTTGAGTGGTTCACAAGAAGGACCA
TGTCTCATACATTCCATGAATGGAGACTTGTTGAGGACCTTGGAGGGTCCTGAAAACTGCCTGAAACCAAAACTCATTCAGGCTTCAAGA
GAGGGTCATTGTGTCATATTCTATGAAAACGGCCTCTTCTGTACATTCAGTGTGAATGGAAAACTCCAGGCCACGATGGAAACAGATGAT
AACATAAGAGCCATCCAGCTGAGCCGAGATGGGCAGTACCTGCTCACAGGAGGAGACAGAGGAGTGGTCGTGGTCCGGCAGGTGTCGGAC
CTCAAGCAGCTCTTTGCCTATCCAGGATGTGACGCTGGAATCCGGGCCATGGCGCTGTCTTACGACCAGAGGTGCATCATTTCTGGCATG

>In-frame_IKZF1_ENST00000331340_chr7_50367353_+_LRBA_ENST00000535741_chr4_151207186_-_702nt
ATGGATGCTGATGAGGGTCAAGACATGTCCCAAGTTTCAGGGAAGGAAAGCCCCCCTGTAAGCGATACTCCAGATGAGGGCGATGAGCCC
ATGCCGATCCCCGAGGACCTCTCCACCACCTCGGGAGGACAGCAAAGCTCCAAGAGTGACAGAGTCGTGGGTGAGACTGCTGCTCCTCGG
GCCATTTTGACCGGCCATGACTATGAGGTCACATGTGCTGCGGTGTGTGCGGAGCTAGGCCTGGTGTTGAGTGGTTCACAAGAAGGACCA
TGTCTCATACATTCCATGAATGGAGACTTGTTGAGGACCTTGGAGGGTCCTGAAAACTGCCTGAAACCAAAACTCATTCAGGCTTCAAGA
GAGGGTCATTGTGTCATATTCTATGAAAACGGCCTCTTCTGTACATTCAGTGTGAATGGAAAACTCCAGGCCACGATGGAAACAGATGAT
AACATAAGAGCCATCCAGCTGAGCCGAGATGGGCAGTACCTGCTCACAGGAGGAGACAGAGGAGTGGTCGTGGTCCGGCAGGTGTCGGAC
CTCAAGCAGCTCTTTGCCTATCCAGGATGTGACGCTGGAATCCGGGCCATGGCGCTGTCTTACGACCAGAGGTGCATCATTTCTGGCATG

>In-frame_IKZF1_ENST00000331340_chr7_50367353_+_LRBA_ENST00000510413_chr4_151207186_-_702nt
ATGGATGCTGATGAGGGTCAAGACATGTCCCAAGTTTCAGGGAAGGAAAGCCCCCCTGTAAGCGATACTCCAGATGAGGGCGATGAGCCC
ATGCCGATCCCCGAGGACCTCTCCACCACCTCGGGAGGACAGCAAAGCTCCAAGAGTGACAGAGTCGTGGGTGAGACTGCTGCTCCTCGG
GCCATTTTGACCGGCCATGACTATGAGGTCACATGTGCTGCGGTGTGTGCGGAGCTAGGCCTGGTGTTGAGTGGTTCACAAGAAGGACCA
TGTCTCATACATTCCATGAATGGAGACTTGTTGAGGACCTTGGAGGGTCCTGAAAACTGCCTGAAACCAAAACTCATTCAGGCTTCAAGA
GAGGGTCATTGTGTCATATTCTATGAAAACGGCCTCTTCTGTACATTCAGTGTGAATGGAAAACTCCAGGCCACGATGGAAACAGATGAT
AACATAAGAGCCATCCAGCTGAGCCGAGATGGGCAGTACCTGCTCACAGGAGGAGACAGAGGAGTGGTCGTGGTCCGGCAGGTGTCGGAC
CTCAAGCAGCTCTTTGCCTATCCAGGATGTGACGCTGGAATCCGGGCCATGGCGCTGTCTTACGACCAGAGGTGCATCATTTCTGGCATG

>In-frame_IKZF1_ENST00000349824_chr7_50367353_+_LRBA_ENST00000535741_chr4_151207186_-_702nt
ATGGATGCTGATGAGGGTCAAGACATGTCCCAAGTTTCAGGGAAGGAAAGCCCCCCTGTAAGCGATACTCCAGATGAGGGCGATGAGCCC
ATGCCGATCCCCGAGGACCTCTCCACCACCTCGGGAGGACAGCAAAGCTCCAAGAGTGACAGAGTCGTGGGTGAGACTGCTGCTCCTCGG
GCCATTTTGACCGGCCATGACTATGAGGTCACATGTGCTGCGGTGTGTGCGGAGCTAGGCCTGGTGTTGAGTGGTTCACAAGAAGGACCA
TGTCTCATACATTCCATGAATGGAGACTTGTTGAGGACCTTGGAGGGTCCTGAAAACTGCCTGAAACCAAAACTCATTCAGGCTTCAAGA
GAGGGTCATTGTGTCATATTCTATGAAAACGGCCTCTTCTGTACATTCAGTGTGAATGGAAAACTCCAGGCCACGATGGAAACAGATGAT
AACATAAGAGCCATCCAGCTGAGCCGAGATGGGCAGTACCTGCTCACAGGAGGAGACAGAGGAGTGGTCGTGGTCCGGCAGGTGTCGGAC
CTCAAGCAGCTCTTTGCCTATCCAGGATGTGACGCTGGAATCCGGGCCATGGCGCTGTCTTACGACCAGAGGTGCATCATTTCTGGCATG

>In-frame_IKZF1_ENST00000349824_chr7_50367353_+_LRBA_ENST00000510413_chr4_151207186_-_702nt
ATGGATGCTGATGAGGGTCAAGACATGTCCCAAGTTTCAGGGAAGGAAAGCCCCCCTGTAAGCGATACTCCAGATGAGGGCGATGAGCCC
ATGCCGATCCCCGAGGACCTCTCCACCACCTCGGGAGGACAGCAAAGCTCCAAGAGTGACAGAGTCGTGGGTGAGACTGCTGCTCCTCGG
GCCATTTTGACCGGCCATGACTATGAGGTCACATGTGCTGCGGTGTGTGCGGAGCTAGGCCTGGTGTTGAGTGGTTCACAAGAAGGACCA
TGTCTCATACATTCCATGAATGGAGACTTGTTGAGGACCTTGGAGGGTCCTGAAAACTGCCTGAAACCAAAACTCATTCAGGCTTCAAGA
GAGGGTCATTGTGTCATATTCTATGAAAACGGCCTCTTCTGTACATTCAGTGTGAATGGAAAACTCCAGGCCACGATGGAAACAGATGAT
AACATAAGAGCCATCCAGCTGAGCCGAGATGGGCAGTACCTGCTCACAGGAGGAGACAGAGGAGTGGTCGTGGTCCGGCAGGTGTCGGAC
CTCAAGCAGCTCTTTGCCTATCCAGGATGTGACGCTGGAATCCGGGCCATGGCGCTGTCTTACGACCAGAGGTGCATCATTTCTGGCATG

>In-frame_IKZF1_ENST00000357364_chr7_50367353_+_LRBA_ENST00000535741_chr4_151207186_-_702nt
ATGGATGCTGATGAGGGTCAAGACATGTCCCAAGTTTCAGGGAAGGAAAGCCCCCCTGTAAGCGATACTCCAGATGAGGGCGATGAGCCC
ATGCCGATCCCCGAGGACCTCTCCACCACCTCGGGAGGACAGCAAAGCTCCAAGAGTGACAGAGTCGTGGGTGAGACTGCTGCTCCTCGG
GCCATTTTGACCGGCCATGACTATGAGGTCACATGTGCTGCGGTGTGTGCGGAGCTAGGCCTGGTGTTGAGTGGTTCACAAGAAGGACCA
TGTCTCATACATTCCATGAATGGAGACTTGTTGAGGACCTTGGAGGGTCCTGAAAACTGCCTGAAACCAAAACTCATTCAGGCTTCAAGA
GAGGGTCATTGTGTCATATTCTATGAAAACGGCCTCTTCTGTACATTCAGTGTGAATGGAAAACTCCAGGCCACGATGGAAACAGATGAT
AACATAAGAGCCATCCAGCTGAGCCGAGATGGGCAGTACCTGCTCACAGGAGGAGACAGAGGAGTGGTCGTGGTCCGGCAGGTGTCGGAC
CTCAAGCAGCTCTTTGCCTATCCAGGATGTGACGCTGGAATCCGGGCCATGGCGCTGTCTTACGACCAGAGGTGCATCATTTCTGGCATG

>In-frame_IKZF1_ENST00000357364_chr7_50367353_+_LRBA_ENST00000510413_chr4_151207186_-_702nt
ATGGATGCTGATGAGGGTCAAGACATGTCCCAAGTTTCAGGGAAGGAAAGCCCCCCTGTAAGCGATACTCCAGATGAGGGCGATGAGCCC
ATGCCGATCCCCGAGGACCTCTCCACCACCTCGGGAGGACAGCAAAGCTCCAAGAGTGACAGAGTCGTGGGTGAGACTGCTGCTCCTCGG
GCCATTTTGACCGGCCATGACTATGAGGTCACATGTGCTGCGGTGTGTGCGGAGCTAGGCCTGGTGTTGAGTGGTTCACAAGAAGGACCA
TGTCTCATACATTCCATGAATGGAGACTTGTTGAGGACCTTGGAGGGTCCTGAAAACTGCCTGAAACCAAAACTCATTCAGGCTTCAAGA
GAGGGTCATTGTGTCATATTCTATGAAAACGGCCTCTTCTGTACATTCAGTGTGAATGGAAAACTCCAGGCCACGATGGAAACAGATGAT
AACATAAGAGCCATCCAGCTGAGCCGAGATGGGCAGTACCTGCTCACAGGAGGAGACAGAGGAGTGGTCGTGGTCCGGCAGGTGTCGGAC
CTCAAGCAGCTCTTTGCCTATCCAGGATGTGACGCTGGAATCCGGGCCATGGCGCTGTCTTACGACCAGAGGTGCATCATTTCTGGCATG

>In-frame_IKZF1_ENST00000346667_chr7_50367353_+_LRBA_ENST00000535741_chr4_151207186_-_702nt
ATGGATGCTGATGAGGGTCAAGACATGTCCCAAGTTTCAGGGAAGGAAAGCCCCCCTGTAAGCGATACTCCAGATGAGGGCGATGAGCCC
ATGCCGATCCCCGAGGACCTCTCCACCACCTCGGGAGGACAGCAAAGCTCCAAGAGTGACAGAGTCGTGGGTGAGACTGCTGCTCCTCGG
GCCATTTTGACCGGCCATGACTATGAGGTCACATGTGCTGCGGTGTGTGCGGAGCTAGGCCTGGTGTTGAGTGGTTCACAAGAAGGACCA
TGTCTCATACATTCCATGAATGGAGACTTGTTGAGGACCTTGGAGGGTCCTGAAAACTGCCTGAAACCAAAACTCATTCAGGCTTCAAGA
GAGGGTCATTGTGTCATATTCTATGAAAACGGCCTCTTCTGTACATTCAGTGTGAATGGAAAACTCCAGGCCACGATGGAAACAGATGAT
AACATAAGAGCCATCCAGCTGAGCCGAGATGGGCAGTACCTGCTCACAGGAGGAGACAGAGGAGTGGTCGTGGTCCGGCAGGTGTCGGAC
CTCAAGCAGCTCTTTGCCTATCCAGGATGTGACGCTGGAATCCGGGCCATGGCGCTGTCTTACGACCAGAGGTGCATCATTTCTGGCATG

>In-frame_IKZF1_ENST00000346667_chr7_50367353_+_LRBA_ENST00000510413_chr4_151207186_-_702nt
ATGGATGCTGATGAGGGTCAAGACATGTCCCAAGTTTCAGGGAAGGAAAGCCCCCCTGTAAGCGATACTCCAGATGAGGGCGATGAGCCC
ATGCCGATCCCCGAGGACCTCTCCACCACCTCGGGAGGACAGCAAAGCTCCAAGAGTGACAGAGTCGTGGGTGAGACTGCTGCTCCTCGG
GCCATTTTGACCGGCCATGACTATGAGGTCACATGTGCTGCGGTGTGTGCGGAGCTAGGCCTGGTGTTGAGTGGTTCACAAGAAGGACCA
TGTCTCATACATTCCATGAATGGAGACTTGTTGAGGACCTTGGAGGGTCCTGAAAACTGCCTGAAACCAAAACTCATTCAGGCTTCAAGA
GAGGGTCATTGTGTCATATTCTATGAAAACGGCCTCTTCTGTACATTCAGTGTGAATGGAAAACTCCAGGCCACGATGGAAACAGATGAT
AACATAAGAGCCATCCAGCTGAGCCGAGATGGGCAGTACCTGCTCACAGGAGGAGACAGAGGAGTGGTCGTGGTCCGGCAGGTGTCGGAC
CTCAAGCAGCTCTTTGCCTATCCAGGATGTGACGCTGGAATCCGGGCCATGGCGCTGTCTTACGACCAGAGGTGCATCATTTCTGGCATG

>In-frame_IKZF1_ENST00000438033_chr7_50367353_+_LRBA_ENST00000535741_chr4_151207186_-_702nt
ATGGATGCTGATGAGGGTCAAGACATGTCCCAAGTTTCAGGGAAGGAAAGCCCCCCTGTAAGCGATACTCCAGATGAGGGCGATGAGCCC
ATGCCGATCCCCGAGGACCTCTCCACCACCTCGGGAGGACAGCAAAGCTCCAAGAGTGACAGAGTCGTGGGTGAGACTGCTGCTCCTCGG
GCCATTTTGACCGGCCATGACTATGAGGTCACATGTGCTGCGGTGTGTGCGGAGCTAGGCCTGGTGTTGAGTGGTTCACAAGAAGGACCA
TGTCTCATACATTCCATGAATGGAGACTTGTTGAGGACCTTGGAGGGTCCTGAAAACTGCCTGAAACCAAAACTCATTCAGGCTTCAAGA
GAGGGTCATTGTGTCATATTCTATGAAAACGGCCTCTTCTGTACATTCAGTGTGAATGGAAAACTCCAGGCCACGATGGAAACAGATGAT
AACATAAGAGCCATCCAGCTGAGCCGAGATGGGCAGTACCTGCTCACAGGAGGAGACAGAGGAGTGGTCGTGGTCCGGCAGGTGTCGGAC
CTCAAGCAGCTCTTTGCCTATCCAGGATGTGACGCTGGAATCCGGGCCATGGCGCTGTCTTACGACCAGAGGTGCATCATTTCTGGCATG

>In-frame_IKZF1_ENST00000438033_chr7_50367353_+_LRBA_ENST00000510413_chr4_151207186_-_702nt
ATGGATGCTGATGAGGGTCAAGACATGTCCCAAGTTTCAGGGAAGGAAAGCCCCCCTGTAAGCGATACTCCAGATGAGGGCGATGAGCCC
ATGCCGATCCCCGAGGACCTCTCCACCACCTCGGGAGGACAGCAAAGCTCCAAGAGTGACAGAGTCGTGGGTGAGACTGCTGCTCCTCGG
GCCATTTTGACCGGCCATGACTATGAGGTCACATGTGCTGCGGTGTGTGCGGAGCTAGGCCTGGTGTTGAGTGGTTCACAAGAAGGACCA
TGTCTCATACATTCCATGAATGGAGACTTGTTGAGGACCTTGGAGGGTCCTGAAAACTGCCTGAAACCAAAACTCATTCAGGCTTCAAGA
GAGGGTCATTGTGTCATATTCTATGAAAACGGCCTCTTCTGTACATTCAGTGTGAATGGAAAACTCCAGGCCACGATGGAAACAGATGAT
AACATAAGAGCCATCCAGCTGAGCCGAGATGGGCAGTACCTGCTCACAGGAGGAGACAGAGGAGTGGTCGTGGTCCGGCAGGTGTCGGAC
CTCAAGCAGCTCTTTGCCTATCCAGGATGTGACGCTGGAATCCGGGCCATGGCGCTGTCTTACGACCAGAGGTGCATCATTTCTGGCATG

>In-frame_IKZF1_ENST00000439701_chr7_50367353_+_LRBA_ENST00000535741_chr4_151207186_-_702nt
ATGGATGCTGATGAGGGTCAAGACATGTCCCAAGTTTCAGGGAAGGAAAGCCCCCCTGTAAGCGATACTCCAGATGAGGGCGATGAGCCC
ATGCCGATCCCCGAGGACCTCTCCACCACCTCGGGAGGACAGCAAAGCTCCAAGAGTGACAGAGTCGTGGGTGAGACTGCTGCTCCTCGG
GCCATTTTGACCGGCCATGACTATGAGGTCACATGTGCTGCGGTGTGTGCGGAGCTAGGCCTGGTGTTGAGTGGTTCACAAGAAGGACCA
TGTCTCATACATTCCATGAATGGAGACTTGTTGAGGACCTTGGAGGGTCCTGAAAACTGCCTGAAACCAAAACTCATTCAGGCTTCAAGA
GAGGGTCATTGTGTCATATTCTATGAAAACGGCCTCTTCTGTACATTCAGTGTGAATGGAAAACTCCAGGCCACGATGGAAACAGATGAT
AACATAAGAGCCATCCAGCTGAGCCGAGATGGGCAGTACCTGCTCACAGGAGGAGACAGAGGAGTGGTCGTGGTCCGGCAGGTGTCGGAC
CTCAAGCAGCTCTTTGCCTATCCAGGATGTGACGCTGGAATCCGGGCCATGGCGCTGTCTTACGACCAGAGGTGCATCATTTCTGGCATG

>In-frame_IKZF1_ENST00000439701_chr7_50367353_+_LRBA_ENST00000510413_chr4_151207186_-_702nt
ATGGATGCTGATGAGGGTCAAGACATGTCCCAAGTTTCAGGGAAGGAAAGCCCCCCTGTAAGCGATACTCCAGATGAGGGCGATGAGCCC
ATGCCGATCCCCGAGGACCTCTCCACCACCTCGGGAGGACAGCAAAGCTCCAAGAGTGACAGAGTCGTGGGTGAGACTGCTGCTCCTCGG
GCCATTTTGACCGGCCATGACTATGAGGTCACATGTGCTGCGGTGTGTGCGGAGCTAGGCCTGGTGTTGAGTGGTTCACAAGAAGGACCA
TGTCTCATACATTCCATGAATGGAGACTTGTTGAGGACCTTGGAGGGTCCTGAAAACTGCCTGAAACCAAAACTCATTCAGGCTTCAAGA
GAGGGTCATTGTGTCATATTCTATGAAAACGGCCTCTTCTGTACATTCAGTGTGAATGGAAAACTCCAGGCCACGATGGAAACAGATGAT
AACATAAGAGCCATCCAGCTGAGCCGAGATGGGCAGTACCTGCTCACAGGAGGAGACAGAGGAGTGGTCGTGGTCCGGCAGGTGTCGGAC
CTCAAGCAGCTCTTTGCCTATCCAGGATGTGACGCTGGAATCCGGGCCATGGCGCTGTCTTACGACCAGAGGTGCATCATTTCTGGCATG

>In-frame_IKZF1_ENST00000413698_chr7_50367353_+_LRBA_ENST00000535741_chr4_151207186_-_702nt
ATGGATGCTGATGAGGGTCAAGACATGTCCCAAGTTTCAGGGAAGGAAAGCCCCCCTGTAAGCGATACTCCAGATGAGGGCGATGAGCCC
ATGCCGATCCCCGAGGACCTCTCCACCACCTCGGGAGGACAGCAAAGCTCCAAGAGTGACAGAGTCGTGGGTGAGACTGCTGCTCCTCGG
GCCATTTTGACCGGCCATGACTATGAGGTCACATGTGCTGCGGTGTGTGCGGAGCTAGGCCTGGTGTTGAGTGGTTCACAAGAAGGACCA
TGTCTCATACATTCCATGAATGGAGACTTGTTGAGGACCTTGGAGGGTCCTGAAAACTGCCTGAAACCAAAACTCATTCAGGCTTCAAGA
GAGGGTCATTGTGTCATATTCTATGAAAACGGCCTCTTCTGTACATTCAGTGTGAATGGAAAACTCCAGGCCACGATGGAAACAGATGAT
AACATAAGAGCCATCCAGCTGAGCCGAGATGGGCAGTACCTGCTCACAGGAGGAGACAGAGGAGTGGTCGTGGTCCGGCAGGTGTCGGAC
CTCAAGCAGCTCTTTGCCTATCCAGGATGTGACGCTGGAATCCGGGCCATGGCGCTGTCTTACGACCAGAGGTGCATCATTTCTGGCATG

>In-frame_IKZF1_ENST00000413698_chr7_50367353_+_LRBA_ENST00000510413_chr4_151207186_-_702nt
ATGGATGCTGATGAGGGTCAAGACATGTCCCAAGTTTCAGGGAAGGAAAGCCCCCCTGTAAGCGATACTCCAGATGAGGGCGATGAGCCC
ATGCCGATCCCCGAGGACCTCTCCACCACCTCGGGAGGACAGCAAAGCTCCAAGAGTGACAGAGTCGTGGGTGAGACTGCTGCTCCTCGG
GCCATTTTGACCGGCCATGACTATGAGGTCACATGTGCTGCGGTGTGTGCGGAGCTAGGCCTGGTGTTGAGTGGTTCACAAGAAGGACCA
TGTCTCATACATTCCATGAATGGAGACTTGTTGAGGACCTTGGAGGGTCCTGAAAACTGCCTGAAACCAAAACTCATTCAGGCTTCAAGA
GAGGGTCATTGTGTCATATTCTATGAAAACGGCCTCTTCTGTACATTCAGTGTGAATGGAAAACTCCAGGCCACGATGGAAACAGATGAT
AACATAAGAGCCATCCAGCTGAGCCGAGATGGGCAGTACCTGCTCACAGGAGGAGACAGAGGAGTGGTCGTGGTCCGGCAGGTGTCGGAC
CTCAAGCAGCTCTTTGCCTATCCAGGATGTGACGCTGGAATCCGGGCCATGGCGCTGTCTTACGACCAGAGGTGCATCATTTCTGGCATG


* Fusion transcript sequences (Full-length transcript).
>In-frame_IKZF1_ENST00000440768_chr7_50367353_+_LRBA_ENST00000535741_chr4_151207186_-_2137nt
CGCGGCGCATCCCAGCCTGGGCGGGACGCTCGGCCGCGGCGAGGCGGGCAAGCCTGGCAGGGCAGAGGGAGCCCCGGCTCCGAGGTTGCT
CTTCGCACCCGAGGATCAGTCTTGGCCCCAAAGCGCGACGCACAAATCCACATAACCTGAGGACCATGGATGCTGATGAGGGTCAAGACA
TGTCCCAAGTTTCAGGGAAGGAAAGCCCCCCTGTAAGCGATACTCCAGATGAGGGCGATGAGCCCATGCCGATCCCCGAGGACCTCTCCA
CCACCTCGGGAGGACAGCAAAGCTCCAAGAGTGACAGAGTCGTGGGTGAGACTGCTGCTCCTCGGGCCATTTTGACCGGCCATGACTATG
AGGTCACATGTGCTGCGGTGTGTGCGGAGCTAGGCCTGGTGTTGAGTGGTTCACAAGAAGGACCATGTCTCATACATTCCATGAATGGAG
ACTTGTTGAGGACCTTGGAGGGTCCTGAAAACTGCCTGAAACCAAAACTCATTCAGGCTTCAAGAGAGGGTCATTGTGTCATATTCTATG
AAAACGGCCTCTTCTGTACATTCAGTGTGAATGGAAAACTCCAGGCCACGATGGAAACAGATGATAACATAAGAGCCATCCAGCTGAGCC
GAGATGGGCAGTACCTGCTCACAGGAGGAGACAGAGGAGTGGTCGTGGTCCGGCAGGTGTCGGACCTCAAGCAGCTCTTTGCCTATCCAG
GATGTGACGCTGGAATCCGGGCCATGGCGCTGTCTTACGACCAGAGGTGCATCATTTCTGGCATGGCTTCAGGAAGCATTGTGCTATTTT
ACAACGACTTTAACCGGTGGCATCATGAATACCAAACCCGCTACTGATGGTGACAGCTGTACATCAACTCTGCCCCTAGGATGAGCAGAA
GTACCTGGAGCATCATTCTCTTCTACCACATCTGAATGTAACTTAAATTTGCTCAAAGAAGCAAAATATTTTTTAAAGTTATTAATAATT
GCTATTTTTGTAGTCTTTGCTTGACTTTTTTGGGGGGGATTAGCAAAGCAGAAAACTGGCTGCTGGGTTCTGTAGTTTTAAAAAATCTAT
ATTTTTAGTCATAATGAGAAGTCTATTTTCACCAATTATGGAAACATACAGTGGAGCAAGTAAACCACTTATTCCAGCTATAATATTATG
AAGAACATTTCCCATGCATCTACAAGCTTGAGAAATAGGATTTTCACAGTGGGGAAGTGGGTTACAATATTGGAATAGGAAAATTTGATG
CTGTAATTTGGGTCCTGTATTTTTCCAAACAACTGTGCTTCTTCAGCACTAATATTTCTGGGATTTAAATAGTAATGTTTAAATTATGGT
AAATGTAATTTAAAACATCTCAATTAAGTCTGTCTATCAATATTGTTCTTCAAGCATGTTTTAGACCTAGAAAAGTATGGTTTGGGGGAG
GCTATTTTATTGTGTGGTTAGCACAAGGAATCTAATTTATAGCAAGTGTGAAATAGTTACCATTTTTTCCTGATCTGTCATCTTCATAGC
ACAACAAAACGAAATGATGGAAATGCTCTTGAGCTCACAACATTTGTTTTTCTTTTAAAGTAAATGCAAGTACCAAAGCTCACTACTGCG
GTTTGCCTGTGCCTGGACAATGAGGCGGAGCCACTGTTGTTTTGTTGGGGCACCCCCTTCCCTCCCCGGGTTTGCAAATAGAGGCTACCG
GGTGCTGTATTCAGCAACACCTGTTTTACTATTTGTTATTAAACTATCATCTCCACCTTCCTTTTGATTAGCAATTTGTACTAAGAAACG
AAACAATGTTATTTGGTGGTGTATAATTCTACTTTTCTAGTAGATTACTGTGTGGAATTCTGTGAAAAATATTTGAGAAAAGGCCTGTAT
TGCATAAATAAATTCTTTGTATGTTGTGAACTTTGATCTCTATTTCTCTTGCAACAGACTTCAAGTGGTCCCTCTTTTTTTCCTACACAC
TCAGCTCTTCTCTAAAAGCAAGGATTTGGAATGAACAATTCAGTTTGACAGAAAAAGCTGAATAAAATGGCATCTGTAATTGAATTGTTG

>In-frame_IKZF1_ENST00000440768_chr7_50367353_+_LRBA_ENST00000510413_chr4_151207186_-_2048nt
CGCGGCGCATCCCAGCCTGGGCGGGACGCTCGGCCGCGGCGAGGCGGGCAAGCCTGGCAGGGCAGAGGGAGCCCCGGCTCCGAGGTTGCT
CTTCGCACCCGAGGATCAGTCTTGGCCCCAAAGCGCGACGCACAAATCCACATAACCTGAGGACCATGGATGCTGATGAGGGTCAAGACA
TGTCCCAAGTTTCAGGGAAGGAAAGCCCCCCTGTAAGCGATACTCCAGATGAGGGCGATGAGCCCATGCCGATCCCCGAGGACCTCTCCA
CCACCTCGGGAGGACAGCAAAGCTCCAAGAGTGACAGAGTCGTGGGTGAGACTGCTGCTCCTCGGGCCATTTTGACCGGCCATGACTATG
AGGTCACATGTGCTGCGGTGTGTGCGGAGCTAGGCCTGGTGTTGAGTGGTTCACAAGAAGGACCATGTCTCATACATTCCATGAATGGAG
ACTTGTTGAGGACCTTGGAGGGTCCTGAAAACTGCCTGAAACCAAAACTCATTCAGGCTTCAAGAGAGGGTCATTGTGTCATATTCTATG
AAAACGGCCTCTTCTGTACATTCAGTGTGAATGGAAAACTCCAGGCCACGATGGAAACAGATGATAACATAAGAGCCATCCAGCTGAGCC
GAGATGGGCAGTACCTGCTCACAGGAGGAGACAGAGGAGTGGTCGTGGTCCGGCAGGTGTCGGACCTCAAGCAGCTCTTTGCCTATCCAG
GATGTGACGCTGGAATCCGGGCCATGGCGCTGTCTTACGACCAGAGGTGCATCATTTCTGGCATGGCTTCAGGAAGCATTGTGCTATTTT
ACAACGACTTTAACCGGTGGCATCATGAATACCAAACCCGCTACTGATGGTGACAGCTGTACATCAACTCTGCCCCTAGGATGAGCAGAA
GTACCTGGAGCATCATTCTCTTCTACCACATCTGAATGTAACTTAAATTTGCTCAAAGAAGCAAAATATTTTTTAAAGTTATTAATAATT
GCTATTTTTGTAGTCTTTGCTTGACTTTTTTGGGGGGGATTAGCAAAGCAGAAAACTGGCTGCTGGGTTCTGTAGTTTTAAAAAATCTAT
ATTTTTAGTCATAATGAGAAGTCTATTTTCACCAATTATGGAAACATACAGTGGAGCAAGTAAACCACTTATTCCAGCTATAATATTATG
AAGAACATTTCCCATGCATCTACAAGCTTGAGAAATAGGATTTTCACAGTGGGGAAGTGGGTTACAATATTGGAATAGGAAAATTTGATG
CTGTAATTTGGGTCCTGTATTTTTCCAAACAACTGTGCTTCTTCAGCACTAATATTTCTGGGATTTAAATAGTAATGTTTAAATTATGGT
AAATGTAATTTAAAACATCTCAATTAAGTCTGTCTATCAATATTGTTCTTCAAGCATGTTTTAGACCTAGAAAAGTATGGTTTGGGGGAG
GCTATTTTATTGTGTGGTTAGCACAAGGAATCTAATTTATAGCAAGTGTGAAATAGTTACCATTTTTTCCTGATCTGTCATCTTCATAGC
ACAACAAAACGAAATGATGGAAATGCTCTTGAGCTCACAACATTTGTTTTTCTTTTAAAGTAAATGCAAGTACCAAAGCTCACTACTGCG
GTTTGCCTGTGCCTGGACAATGAGGCGGAGCCACTGTTGTTTTGTTGGGGCACCCCCTTCCCTCCCCGGGTTTGCAAATAGAGGCTACCG
GGTGCTGTATTCAGCAACACCTGTTTTACTATTTGTTATTAAACTATCATCTCCACCTTCCTTTTGATTAGCAATTTGTACTAAGAAACG
AAACAATGTTATTTGGTGGTGTATAATTCTACTTTTCTAGTAGATTACTGTGTGGAATTCTGTGAAAAATATTTGAGAAAAGGCCTGTAT
TGCATAAATAAATTCTTTGTATGTTGTGAACTTTGATCTCTATTTCTCTTGCAACAGACTTCAAGTGGTCCCTCTTTTTTTCCTACACAC

>In-frame_IKZF1_ENST00000359197_chr7_50367353_+_LRBA_ENST00000535741_chr4_151207186_-_2137nt
CGCGGCGCATCCCAGCCTGGGCGGGACGCTCGGCCGCGGCGAGGCGGGCAAGCCTGGCAGGGCAGAGGGAGCCCCGGCTCCGAGGTTGCT
CTTCGCACCCGAGGATCAGTCTTGGCCCCAAAGCGCGACGCACAAATCCACATAACCTGAGGACCATGGATGCTGATGAGGGTCAAGACA
TGTCCCAAGTTTCAGGGAAGGAAAGCCCCCCTGTAAGCGATACTCCAGATGAGGGCGATGAGCCCATGCCGATCCCCGAGGACCTCTCCA
CCACCTCGGGAGGACAGCAAAGCTCCAAGAGTGACAGAGTCGTGGGTGAGACTGCTGCTCCTCGGGCCATTTTGACCGGCCATGACTATG
AGGTCACATGTGCTGCGGTGTGTGCGGAGCTAGGCCTGGTGTTGAGTGGTTCACAAGAAGGACCATGTCTCATACATTCCATGAATGGAG
ACTTGTTGAGGACCTTGGAGGGTCCTGAAAACTGCCTGAAACCAAAACTCATTCAGGCTTCAAGAGAGGGTCATTGTGTCATATTCTATG
AAAACGGCCTCTTCTGTACATTCAGTGTGAATGGAAAACTCCAGGCCACGATGGAAACAGATGATAACATAAGAGCCATCCAGCTGAGCC
GAGATGGGCAGTACCTGCTCACAGGAGGAGACAGAGGAGTGGTCGTGGTCCGGCAGGTGTCGGACCTCAAGCAGCTCTTTGCCTATCCAG
GATGTGACGCTGGAATCCGGGCCATGGCGCTGTCTTACGACCAGAGGTGCATCATTTCTGGCATGGCTTCAGGAAGCATTGTGCTATTTT
ACAACGACTTTAACCGGTGGCATCATGAATACCAAACCCGCTACTGATGGTGACAGCTGTACATCAACTCTGCCCCTAGGATGAGCAGAA
GTACCTGGAGCATCATTCTCTTCTACCACATCTGAATGTAACTTAAATTTGCTCAAAGAAGCAAAATATTTTTTAAAGTTATTAATAATT
GCTATTTTTGTAGTCTTTGCTTGACTTTTTTGGGGGGGATTAGCAAAGCAGAAAACTGGCTGCTGGGTTCTGTAGTTTTAAAAAATCTAT
ATTTTTAGTCATAATGAGAAGTCTATTTTCACCAATTATGGAAACATACAGTGGAGCAAGTAAACCACTTATTCCAGCTATAATATTATG
AAGAACATTTCCCATGCATCTACAAGCTTGAGAAATAGGATTTTCACAGTGGGGAAGTGGGTTACAATATTGGAATAGGAAAATTTGATG
CTGTAATTTGGGTCCTGTATTTTTCCAAACAACTGTGCTTCTTCAGCACTAATATTTCTGGGATTTAAATAGTAATGTTTAAATTATGGT
AAATGTAATTTAAAACATCTCAATTAAGTCTGTCTATCAATATTGTTCTTCAAGCATGTTTTAGACCTAGAAAAGTATGGTTTGGGGGAG
GCTATTTTATTGTGTGGTTAGCACAAGGAATCTAATTTATAGCAAGTGTGAAATAGTTACCATTTTTTCCTGATCTGTCATCTTCATAGC
ACAACAAAACGAAATGATGGAAATGCTCTTGAGCTCACAACATTTGTTTTTCTTTTAAAGTAAATGCAAGTACCAAAGCTCACTACTGCG
GTTTGCCTGTGCCTGGACAATGAGGCGGAGCCACTGTTGTTTTGTTGGGGCACCCCCTTCCCTCCCCGGGTTTGCAAATAGAGGCTACCG
GGTGCTGTATTCAGCAACACCTGTTTTACTATTTGTTATTAAACTATCATCTCCACCTTCCTTTTGATTAGCAATTTGTACTAAGAAACG
AAACAATGTTATTTGGTGGTGTATAATTCTACTTTTCTAGTAGATTACTGTGTGGAATTCTGTGAAAAATATTTGAGAAAAGGCCTGTAT
TGCATAAATAAATTCTTTGTATGTTGTGAACTTTGATCTCTATTTCTCTTGCAACAGACTTCAAGTGGTCCCTCTTTTTTTCCTACACAC
TCAGCTCTTCTCTAAAAGCAAGGATTTGGAATGAACAATTCAGTTTGACAGAAAAAGCTGAATAAAATGGCATCTGTAATTGAATTGTTG

>In-frame_IKZF1_ENST00000359197_chr7_50367353_+_LRBA_ENST00000510413_chr4_151207186_-_2048nt
CGCGGCGCATCCCAGCCTGGGCGGGACGCTCGGCCGCGGCGAGGCGGGCAAGCCTGGCAGGGCAGAGGGAGCCCCGGCTCCGAGGTTGCT
CTTCGCACCCGAGGATCAGTCTTGGCCCCAAAGCGCGACGCACAAATCCACATAACCTGAGGACCATGGATGCTGATGAGGGTCAAGACA
TGTCCCAAGTTTCAGGGAAGGAAAGCCCCCCTGTAAGCGATACTCCAGATGAGGGCGATGAGCCCATGCCGATCCCCGAGGACCTCTCCA
CCACCTCGGGAGGACAGCAAAGCTCCAAGAGTGACAGAGTCGTGGGTGAGACTGCTGCTCCTCGGGCCATTTTGACCGGCCATGACTATG
AGGTCACATGTGCTGCGGTGTGTGCGGAGCTAGGCCTGGTGTTGAGTGGTTCACAAGAAGGACCATGTCTCATACATTCCATGAATGGAG
ACTTGTTGAGGACCTTGGAGGGTCCTGAAAACTGCCTGAAACCAAAACTCATTCAGGCTTCAAGAGAGGGTCATTGTGTCATATTCTATG
AAAACGGCCTCTTCTGTACATTCAGTGTGAATGGAAAACTCCAGGCCACGATGGAAACAGATGATAACATAAGAGCCATCCAGCTGAGCC
GAGATGGGCAGTACCTGCTCACAGGAGGAGACAGAGGAGTGGTCGTGGTCCGGCAGGTGTCGGACCTCAAGCAGCTCTTTGCCTATCCAG
GATGTGACGCTGGAATCCGGGCCATGGCGCTGTCTTACGACCAGAGGTGCATCATTTCTGGCATGGCTTCAGGAAGCATTGTGCTATTTT
ACAACGACTTTAACCGGTGGCATCATGAATACCAAACCCGCTACTGATGGTGACAGCTGTACATCAACTCTGCCCCTAGGATGAGCAGAA
GTACCTGGAGCATCATTCTCTTCTACCACATCTGAATGTAACTTAAATTTGCTCAAAGAAGCAAAATATTTTTTAAAGTTATTAATAATT
GCTATTTTTGTAGTCTTTGCTTGACTTTTTTGGGGGGGATTAGCAAAGCAGAAAACTGGCTGCTGGGTTCTGTAGTTTTAAAAAATCTAT
ATTTTTAGTCATAATGAGAAGTCTATTTTCACCAATTATGGAAACATACAGTGGAGCAAGTAAACCACTTATTCCAGCTATAATATTATG
AAGAACATTTCCCATGCATCTACAAGCTTGAGAAATAGGATTTTCACAGTGGGGAAGTGGGTTACAATATTGGAATAGGAAAATTTGATG
CTGTAATTTGGGTCCTGTATTTTTCCAAACAACTGTGCTTCTTCAGCACTAATATTTCTGGGATTTAAATAGTAATGTTTAAATTATGGT
AAATGTAATTTAAAACATCTCAATTAAGTCTGTCTATCAATATTGTTCTTCAAGCATGTTTTAGACCTAGAAAAGTATGGTTTGGGGGAG
GCTATTTTATTGTGTGGTTAGCACAAGGAATCTAATTTATAGCAAGTGTGAAATAGTTACCATTTTTTCCTGATCTGTCATCTTCATAGC
ACAACAAAACGAAATGATGGAAATGCTCTTGAGCTCACAACATTTGTTTTTCTTTTAAAGTAAATGCAAGTACCAAAGCTCACTACTGCG
GTTTGCCTGTGCCTGGACAATGAGGCGGAGCCACTGTTGTTTTGTTGGGGCACCCCCTTCCCTCCCCGGGTTTGCAAATAGAGGCTACCG
GGTGCTGTATTCAGCAACACCTGTTTTACTATTTGTTATTAAACTATCATCTCCACCTTCCTTTTGATTAGCAATTTGTACTAAGAAACG
AAACAATGTTATTTGGTGGTGTATAATTCTACTTTTCTAGTAGATTACTGTGTGGAATTCTGTGAAAAATATTTGAGAAAAGGCCTGTAT
TGCATAAATAAATTCTTTGTATGTTGTGAACTTTGATCTCTATTTCTCTTGCAACAGACTTCAAGTGGTCCCTCTTTTTTTCCTACACAC

>In-frame_IKZF1_ENST00000343574_chr7_50367353_+_LRBA_ENST00000535741_chr4_151207186_-_2137nt
CGCGGCGCATCCCAGCCTGGGCGGGACGCTCGGCCGCGGCGAGGCGGGCAAGCCTGGCAGGGCAGAGGGAGCCCCGGCTCCGAGGTTGCT
CTTCGCACCCGAGGATCAGTCTTGGCCCCAAAGCGCGACGCACAAATCCACATAACCTGAGGACCATGGATGCTGATGAGGGTCAAGACA
TGTCCCAAGTTTCAGGGAAGGAAAGCCCCCCTGTAAGCGATACTCCAGATGAGGGCGATGAGCCCATGCCGATCCCCGAGGACCTCTCCA
CCACCTCGGGAGGACAGCAAAGCTCCAAGAGTGACAGAGTCGTGGGTGAGACTGCTGCTCCTCGGGCCATTTTGACCGGCCATGACTATG
AGGTCACATGTGCTGCGGTGTGTGCGGAGCTAGGCCTGGTGTTGAGTGGTTCACAAGAAGGACCATGTCTCATACATTCCATGAATGGAG
ACTTGTTGAGGACCTTGGAGGGTCCTGAAAACTGCCTGAAACCAAAACTCATTCAGGCTTCAAGAGAGGGTCATTGTGTCATATTCTATG
AAAACGGCCTCTTCTGTACATTCAGTGTGAATGGAAAACTCCAGGCCACGATGGAAACAGATGATAACATAAGAGCCATCCAGCTGAGCC
GAGATGGGCAGTACCTGCTCACAGGAGGAGACAGAGGAGTGGTCGTGGTCCGGCAGGTGTCGGACCTCAAGCAGCTCTTTGCCTATCCAG
GATGTGACGCTGGAATCCGGGCCATGGCGCTGTCTTACGACCAGAGGTGCATCATTTCTGGCATGGCTTCAGGAAGCATTGTGCTATTTT
ACAACGACTTTAACCGGTGGCATCATGAATACCAAACCCGCTACTGATGGTGACAGCTGTACATCAACTCTGCCCCTAGGATGAGCAGAA
GTACCTGGAGCATCATTCTCTTCTACCACATCTGAATGTAACTTAAATTTGCTCAAAGAAGCAAAATATTTTTTAAAGTTATTAATAATT
GCTATTTTTGTAGTCTTTGCTTGACTTTTTTGGGGGGGATTAGCAAAGCAGAAAACTGGCTGCTGGGTTCTGTAGTTTTAAAAAATCTAT
ATTTTTAGTCATAATGAGAAGTCTATTTTCACCAATTATGGAAACATACAGTGGAGCAAGTAAACCACTTATTCCAGCTATAATATTATG
AAGAACATTTCCCATGCATCTACAAGCTTGAGAAATAGGATTTTCACAGTGGGGAAGTGGGTTACAATATTGGAATAGGAAAATTTGATG
CTGTAATTTGGGTCCTGTATTTTTCCAAACAACTGTGCTTCTTCAGCACTAATATTTCTGGGATTTAAATAGTAATGTTTAAATTATGGT
AAATGTAATTTAAAACATCTCAATTAAGTCTGTCTATCAATATTGTTCTTCAAGCATGTTTTAGACCTAGAAAAGTATGGTTTGGGGGAG
GCTATTTTATTGTGTGGTTAGCACAAGGAATCTAATTTATAGCAAGTGTGAAATAGTTACCATTTTTTCCTGATCTGTCATCTTCATAGC
ACAACAAAACGAAATGATGGAAATGCTCTTGAGCTCACAACATTTGTTTTTCTTTTAAAGTAAATGCAAGTACCAAAGCTCACTACTGCG
GTTTGCCTGTGCCTGGACAATGAGGCGGAGCCACTGTTGTTTTGTTGGGGCACCCCCTTCCCTCCCCGGGTTTGCAAATAGAGGCTACCG
GGTGCTGTATTCAGCAACACCTGTTTTACTATTTGTTATTAAACTATCATCTCCACCTTCCTTTTGATTAGCAATTTGTACTAAGAAACG
AAACAATGTTATTTGGTGGTGTATAATTCTACTTTTCTAGTAGATTACTGTGTGGAATTCTGTGAAAAATATTTGAGAAAAGGCCTGTAT
TGCATAAATAAATTCTTTGTATGTTGTGAACTTTGATCTCTATTTCTCTTGCAACAGACTTCAAGTGGTCCCTCTTTTTTTCCTACACAC
TCAGCTCTTCTCTAAAAGCAAGGATTTGGAATGAACAATTCAGTTTGACAGAAAAAGCTGAATAAAATGGCATCTGTAATTGAATTGTTG

>In-frame_IKZF1_ENST00000343574_chr7_50367353_+_LRBA_ENST00000510413_chr4_151207186_-_2048nt
CGCGGCGCATCCCAGCCTGGGCGGGACGCTCGGCCGCGGCGAGGCGGGCAAGCCTGGCAGGGCAGAGGGAGCCCCGGCTCCGAGGTTGCT
CTTCGCACCCGAGGATCAGTCTTGGCCCCAAAGCGCGACGCACAAATCCACATAACCTGAGGACCATGGATGCTGATGAGGGTCAAGACA
TGTCCCAAGTTTCAGGGAAGGAAAGCCCCCCTGTAAGCGATACTCCAGATGAGGGCGATGAGCCCATGCCGATCCCCGAGGACCTCTCCA
CCACCTCGGGAGGACAGCAAAGCTCCAAGAGTGACAGAGTCGTGGGTGAGACTGCTGCTCCTCGGGCCATTTTGACCGGCCATGACTATG
AGGTCACATGTGCTGCGGTGTGTGCGGAGCTAGGCCTGGTGTTGAGTGGTTCACAAGAAGGACCATGTCTCATACATTCCATGAATGGAG
ACTTGTTGAGGACCTTGGAGGGTCCTGAAAACTGCCTGAAACCAAAACTCATTCAGGCTTCAAGAGAGGGTCATTGTGTCATATTCTATG
AAAACGGCCTCTTCTGTACATTCAGTGTGAATGGAAAACTCCAGGCCACGATGGAAACAGATGATAACATAAGAGCCATCCAGCTGAGCC
GAGATGGGCAGTACCTGCTCACAGGAGGAGACAGAGGAGTGGTCGTGGTCCGGCAGGTGTCGGACCTCAAGCAGCTCTTTGCCTATCCAG
GATGTGACGCTGGAATCCGGGCCATGGCGCTGTCTTACGACCAGAGGTGCATCATTTCTGGCATGGCTTCAGGAAGCATTGTGCTATTTT
ACAACGACTTTAACCGGTGGCATCATGAATACCAAACCCGCTACTGATGGTGACAGCTGTACATCAACTCTGCCCCTAGGATGAGCAGAA
GTACCTGGAGCATCATTCTCTTCTACCACATCTGAATGTAACTTAAATTTGCTCAAAGAAGCAAAATATTTTTTAAAGTTATTAATAATT
GCTATTTTTGTAGTCTTTGCTTGACTTTTTTGGGGGGGATTAGCAAAGCAGAAAACTGGCTGCTGGGTTCTGTAGTTTTAAAAAATCTAT
ATTTTTAGTCATAATGAGAAGTCTATTTTCACCAATTATGGAAACATACAGTGGAGCAAGTAAACCACTTATTCCAGCTATAATATTATG
AAGAACATTTCCCATGCATCTACAAGCTTGAGAAATAGGATTTTCACAGTGGGGAAGTGGGTTACAATATTGGAATAGGAAAATTTGATG
CTGTAATTTGGGTCCTGTATTTTTCCAAACAACTGTGCTTCTTCAGCACTAATATTTCTGGGATTTAAATAGTAATGTTTAAATTATGGT
AAATGTAATTTAAAACATCTCAATTAAGTCTGTCTATCAATATTGTTCTTCAAGCATGTTTTAGACCTAGAAAAGTATGGTTTGGGGGAG
GCTATTTTATTGTGTGGTTAGCACAAGGAATCTAATTTATAGCAAGTGTGAAATAGTTACCATTTTTTCCTGATCTGTCATCTTCATAGC
ACAACAAAACGAAATGATGGAAATGCTCTTGAGCTCACAACATTTGTTTTTCTTTTAAAGTAAATGCAAGTACCAAAGCTCACTACTGCG
GTTTGCCTGTGCCTGGACAATGAGGCGGAGCCACTGTTGTTTTGTTGGGGCACCCCCTTCCCTCCCCGGGTTTGCAAATAGAGGCTACCG
GGTGCTGTATTCAGCAACACCTGTTTTACTATTTGTTATTAAACTATCATCTCCACCTTCCTTTTGATTAGCAATTTGTACTAAGAAACG
AAACAATGTTATTTGGTGGTGTATAATTCTACTTTTCTAGTAGATTACTGTGTGGAATTCTGTGAAAAATATTTGAGAAAAGGCCTGTAT
TGCATAAATAAATTCTTTGTATGTTGTGAACTTTGATCTCTATTTCTCTTGCAACAGACTTCAAGTGGTCCCTCTTTTTTTCCTACACAC

>In-frame_IKZF1_ENST00000331340_chr7_50367353_+_LRBA_ENST00000535741_chr4_151207186_-_2137nt
CGCGGCGCATCCCAGCCTGGGCGGGACGCTCGGCCGCGGCGAGGCGGGCAAGCCTGGCAGGGCAGAGGGAGCCCCGGCTCCGAGGTTGCT
CTTCGCACCCGAGGATCAGTCTTGGCCCCAAAGCGCGACGCACAAATCCACATAACCTGAGGACCATGGATGCTGATGAGGGTCAAGACA
TGTCCCAAGTTTCAGGGAAGGAAAGCCCCCCTGTAAGCGATACTCCAGATGAGGGCGATGAGCCCATGCCGATCCCCGAGGACCTCTCCA
CCACCTCGGGAGGACAGCAAAGCTCCAAGAGTGACAGAGTCGTGGGTGAGACTGCTGCTCCTCGGGCCATTTTGACCGGCCATGACTATG
AGGTCACATGTGCTGCGGTGTGTGCGGAGCTAGGCCTGGTGTTGAGTGGTTCACAAGAAGGACCATGTCTCATACATTCCATGAATGGAG
ACTTGTTGAGGACCTTGGAGGGTCCTGAAAACTGCCTGAAACCAAAACTCATTCAGGCTTCAAGAGAGGGTCATTGTGTCATATTCTATG
AAAACGGCCTCTTCTGTACATTCAGTGTGAATGGAAAACTCCAGGCCACGATGGAAACAGATGATAACATAAGAGCCATCCAGCTGAGCC
GAGATGGGCAGTACCTGCTCACAGGAGGAGACAGAGGAGTGGTCGTGGTCCGGCAGGTGTCGGACCTCAAGCAGCTCTTTGCCTATCCAG
GATGTGACGCTGGAATCCGGGCCATGGCGCTGTCTTACGACCAGAGGTGCATCATTTCTGGCATGGCTTCAGGAAGCATTGTGCTATTTT
ACAACGACTTTAACCGGTGGCATCATGAATACCAAACCCGCTACTGATGGTGACAGCTGTACATCAACTCTGCCCCTAGGATGAGCAGAA
GTACCTGGAGCATCATTCTCTTCTACCACATCTGAATGTAACTTAAATTTGCTCAAAGAAGCAAAATATTTTTTAAAGTTATTAATAATT
GCTATTTTTGTAGTCTTTGCTTGACTTTTTTGGGGGGGATTAGCAAAGCAGAAAACTGGCTGCTGGGTTCTGTAGTTTTAAAAAATCTAT
ATTTTTAGTCATAATGAGAAGTCTATTTTCACCAATTATGGAAACATACAGTGGAGCAAGTAAACCACTTATTCCAGCTATAATATTATG
AAGAACATTTCCCATGCATCTACAAGCTTGAGAAATAGGATTTTCACAGTGGGGAAGTGGGTTACAATATTGGAATAGGAAAATTTGATG
CTGTAATTTGGGTCCTGTATTTTTCCAAACAACTGTGCTTCTTCAGCACTAATATTTCTGGGATTTAAATAGTAATGTTTAAATTATGGT
AAATGTAATTTAAAACATCTCAATTAAGTCTGTCTATCAATATTGTTCTTCAAGCATGTTTTAGACCTAGAAAAGTATGGTTTGGGGGAG
GCTATTTTATTGTGTGGTTAGCACAAGGAATCTAATTTATAGCAAGTGTGAAATAGTTACCATTTTTTCCTGATCTGTCATCTTCATAGC
ACAACAAAACGAAATGATGGAAATGCTCTTGAGCTCACAACATTTGTTTTTCTTTTAAAGTAAATGCAAGTACCAAAGCTCACTACTGCG
GTTTGCCTGTGCCTGGACAATGAGGCGGAGCCACTGTTGTTTTGTTGGGGCACCCCCTTCCCTCCCCGGGTTTGCAAATAGAGGCTACCG
GGTGCTGTATTCAGCAACACCTGTTTTACTATTTGTTATTAAACTATCATCTCCACCTTCCTTTTGATTAGCAATTTGTACTAAGAAACG
AAACAATGTTATTTGGTGGTGTATAATTCTACTTTTCTAGTAGATTACTGTGTGGAATTCTGTGAAAAATATTTGAGAAAAGGCCTGTAT
TGCATAAATAAATTCTTTGTATGTTGTGAACTTTGATCTCTATTTCTCTTGCAACAGACTTCAAGTGGTCCCTCTTTTTTTCCTACACAC
TCAGCTCTTCTCTAAAAGCAAGGATTTGGAATGAACAATTCAGTTTGACAGAAAAAGCTGAATAAAATGGCATCTGTAATTGAATTGTTG

>In-frame_IKZF1_ENST00000331340_chr7_50367353_+_LRBA_ENST00000510413_chr4_151207186_-_2048nt
CGCGGCGCATCCCAGCCTGGGCGGGACGCTCGGCCGCGGCGAGGCGGGCAAGCCTGGCAGGGCAGAGGGAGCCCCGGCTCCGAGGTTGCT
CTTCGCACCCGAGGATCAGTCTTGGCCCCAAAGCGCGACGCACAAATCCACATAACCTGAGGACCATGGATGCTGATGAGGGTCAAGACA
TGTCCCAAGTTTCAGGGAAGGAAAGCCCCCCTGTAAGCGATACTCCAGATGAGGGCGATGAGCCCATGCCGATCCCCGAGGACCTCTCCA
CCACCTCGGGAGGACAGCAAAGCTCCAAGAGTGACAGAGTCGTGGGTGAGACTGCTGCTCCTCGGGCCATTTTGACCGGCCATGACTATG
AGGTCACATGTGCTGCGGTGTGTGCGGAGCTAGGCCTGGTGTTGAGTGGTTCACAAGAAGGACCATGTCTCATACATTCCATGAATGGAG
ACTTGTTGAGGACCTTGGAGGGTCCTGAAAACTGCCTGAAACCAAAACTCATTCAGGCTTCAAGAGAGGGTCATTGTGTCATATTCTATG
AAAACGGCCTCTTCTGTACATTCAGTGTGAATGGAAAACTCCAGGCCACGATGGAAACAGATGATAACATAAGAGCCATCCAGCTGAGCC
GAGATGGGCAGTACCTGCTCACAGGAGGAGACAGAGGAGTGGTCGTGGTCCGGCAGGTGTCGGACCTCAAGCAGCTCTTTGCCTATCCAG
GATGTGACGCTGGAATCCGGGCCATGGCGCTGTCTTACGACCAGAGGTGCATCATTTCTGGCATGGCTTCAGGAAGCATTGTGCTATTTT
ACAACGACTTTAACCGGTGGCATCATGAATACCAAACCCGCTACTGATGGTGACAGCTGTACATCAACTCTGCCCCTAGGATGAGCAGAA
GTACCTGGAGCATCATTCTCTTCTACCACATCTGAATGTAACTTAAATTTGCTCAAAGAAGCAAAATATTTTTTAAAGTTATTAATAATT
GCTATTTTTGTAGTCTTTGCTTGACTTTTTTGGGGGGGATTAGCAAAGCAGAAAACTGGCTGCTGGGTTCTGTAGTTTTAAAAAATCTAT
ATTTTTAGTCATAATGAGAAGTCTATTTTCACCAATTATGGAAACATACAGTGGAGCAAGTAAACCACTTATTCCAGCTATAATATTATG
AAGAACATTTCCCATGCATCTACAAGCTTGAGAAATAGGATTTTCACAGTGGGGAAGTGGGTTACAATATTGGAATAGGAAAATTTGATG
CTGTAATTTGGGTCCTGTATTTTTCCAAACAACTGTGCTTCTTCAGCACTAATATTTCTGGGATTTAAATAGTAATGTTTAAATTATGGT
AAATGTAATTTAAAACATCTCAATTAAGTCTGTCTATCAATATTGTTCTTCAAGCATGTTTTAGACCTAGAAAAGTATGGTTTGGGGGAG
GCTATTTTATTGTGTGGTTAGCACAAGGAATCTAATTTATAGCAAGTGTGAAATAGTTACCATTTTTTCCTGATCTGTCATCTTCATAGC
ACAACAAAACGAAATGATGGAAATGCTCTTGAGCTCACAACATTTGTTTTTCTTTTAAAGTAAATGCAAGTACCAAAGCTCACTACTGCG
GTTTGCCTGTGCCTGGACAATGAGGCGGAGCCACTGTTGTTTTGTTGGGGCACCCCCTTCCCTCCCCGGGTTTGCAAATAGAGGCTACCG
GGTGCTGTATTCAGCAACACCTGTTTTACTATTTGTTATTAAACTATCATCTCCACCTTCCTTTTGATTAGCAATTTGTACTAAGAAACG
AAACAATGTTATTTGGTGGTGTATAATTCTACTTTTCTAGTAGATTACTGTGTGGAATTCTGTGAAAAATATTTGAGAAAAGGCCTGTAT
TGCATAAATAAATTCTTTGTATGTTGTGAACTTTGATCTCTATTTCTCTTGCAACAGACTTCAAGTGGTCCCTCTTTTTTTCCTACACAC

>In-frame_IKZF1_ENST00000349824_chr7_50367353_+_LRBA_ENST00000535741_chr4_151207186_-_2137nt
CGCGGCGCATCCCAGCCTGGGCGGGACGCTCGGCCGCGGCGAGGCGGGCAAGCCTGGCAGGGCAGAGGGAGCCCCGGCTCCGAGGTTGCT
CTTCGCACCCGAGGATCAGTCTTGGCCCCAAAGCGCGACGCACAAATCCACATAACCTGAGGACCATGGATGCTGATGAGGGTCAAGACA
TGTCCCAAGTTTCAGGGAAGGAAAGCCCCCCTGTAAGCGATACTCCAGATGAGGGCGATGAGCCCATGCCGATCCCCGAGGACCTCTCCA
CCACCTCGGGAGGACAGCAAAGCTCCAAGAGTGACAGAGTCGTGGGTGAGACTGCTGCTCCTCGGGCCATTTTGACCGGCCATGACTATG
AGGTCACATGTGCTGCGGTGTGTGCGGAGCTAGGCCTGGTGTTGAGTGGTTCACAAGAAGGACCATGTCTCATACATTCCATGAATGGAG
ACTTGTTGAGGACCTTGGAGGGTCCTGAAAACTGCCTGAAACCAAAACTCATTCAGGCTTCAAGAGAGGGTCATTGTGTCATATTCTATG
AAAACGGCCTCTTCTGTACATTCAGTGTGAATGGAAAACTCCAGGCCACGATGGAAACAGATGATAACATAAGAGCCATCCAGCTGAGCC
GAGATGGGCAGTACCTGCTCACAGGAGGAGACAGAGGAGTGGTCGTGGTCCGGCAGGTGTCGGACCTCAAGCAGCTCTTTGCCTATCCAG
GATGTGACGCTGGAATCCGGGCCATGGCGCTGTCTTACGACCAGAGGTGCATCATTTCTGGCATGGCTTCAGGAAGCATTGTGCTATTTT
ACAACGACTTTAACCGGTGGCATCATGAATACCAAACCCGCTACTGATGGTGACAGCTGTACATCAACTCTGCCCCTAGGATGAGCAGAA
GTACCTGGAGCATCATTCTCTTCTACCACATCTGAATGTAACTTAAATTTGCTCAAAGAAGCAAAATATTTTTTAAAGTTATTAATAATT
GCTATTTTTGTAGTCTTTGCTTGACTTTTTTGGGGGGGATTAGCAAAGCAGAAAACTGGCTGCTGGGTTCTGTAGTTTTAAAAAATCTAT
ATTTTTAGTCATAATGAGAAGTCTATTTTCACCAATTATGGAAACATACAGTGGAGCAAGTAAACCACTTATTCCAGCTATAATATTATG
AAGAACATTTCCCATGCATCTACAAGCTTGAGAAATAGGATTTTCACAGTGGGGAAGTGGGTTACAATATTGGAATAGGAAAATTTGATG
CTGTAATTTGGGTCCTGTATTTTTCCAAACAACTGTGCTTCTTCAGCACTAATATTTCTGGGATTTAAATAGTAATGTTTAAATTATGGT
AAATGTAATTTAAAACATCTCAATTAAGTCTGTCTATCAATATTGTTCTTCAAGCATGTTTTAGACCTAGAAAAGTATGGTTTGGGGGAG
GCTATTTTATTGTGTGGTTAGCACAAGGAATCTAATTTATAGCAAGTGTGAAATAGTTACCATTTTTTCCTGATCTGTCATCTTCATAGC
ACAACAAAACGAAATGATGGAAATGCTCTTGAGCTCACAACATTTGTTTTTCTTTTAAAGTAAATGCAAGTACCAAAGCTCACTACTGCG
GTTTGCCTGTGCCTGGACAATGAGGCGGAGCCACTGTTGTTTTGTTGGGGCACCCCCTTCCCTCCCCGGGTTTGCAAATAGAGGCTACCG
GGTGCTGTATTCAGCAACACCTGTTTTACTATTTGTTATTAAACTATCATCTCCACCTTCCTTTTGATTAGCAATTTGTACTAAGAAACG
AAACAATGTTATTTGGTGGTGTATAATTCTACTTTTCTAGTAGATTACTGTGTGGAATTCTGTGAAAAATATTTGAGAAAAGGCCTGTAT
TGCATAAATAAATTCTTTGTATGTTGTGAACTTTGATCTCTATTTCTCTTGCAACAGACTTCAAGTGGTCCCTCTTTTTTTCCTACACAC
TCAGCTCTTCTCTAAAAGCAAGGATTTGGAATGAACAATTCAGTTTGACAGAAAAAGCTGAATAAAATGGCATCTGTAATTGAATTGTTG

>In-frame_IKZF1_ENST00000349824_chr7_50367353_+_LRBA_ENST00000510413_chr4_151207186_-_2048nt
CGCGGCGCATCCCAGCCTGGGCGGGACGCTCGGCCGCGGCGAGGCGGGCAAGCCTGGCAGGGCAGAGGGAGCCCCGGCTCCGAGGTTGCT
CTTCGCACCCGAGGATCAGTCTTGGCCCCAAAGCGCGACGCACAAATCCACATAACCTGAGGACCATGGATGCTGATGAGGGTCAAGACA
TGTCCCAAGTTTCAGGGAAGGAAAGCCCCCCTGTAAGCGATACTCCAGATGAGGGCGATGAGCCCATGCCGATCCCCGAGGACCTCTCCA
CCACCTCGGGAGGACAGCAAAGCTCCAAGAGTGACAGAGTCGTGGGTGAGACTGCTGCTCCTCGGGCCATTTTGACCGGCCATGACTATG
AGGTCACATGTGCTGCGGTGTGTGCGGAGCTAGGCCTGGTGTTGAGTGGTTCACAAGAAGGACCATGTCTCATACATTCCATGAATGGAG
ACTTGTTGAGGACCTTGGAGGGTCCTGAAAACTGCCTGAAACCAAAACTCATTCAGGCTTCAAGAGAGGGTCATTGTGTCATATTCTATG
AAAACGGCCTCTTCTGTACATTCAGTGTGAATGGAAAACTCCAGGCCACGATGGAAACAGATGATAACATAAGAGCCATCCAGCTGAGCC
GAGATGGGCAGTACCTGCTCACAGGAGGAGACAGAGGAGTGGTCGTGGTCCGGCAGGTGTCGGACCTCAAGCAGCTCTTTGCCTATCCAG
GATGTGACGCTGGAATCCGGGCCATGGCGCTGTCTTACGACCAGAGGTGCATCATTTCTGGCATGGCTTCAGGAAGCATTGTGCTATTTT
ACAACGACTTTAACCGGTGGCATCATGAATACCAAACCCGCTACTGATGGTGACAGCTGTACATCAACTCTGCCCCTAGGATGAGCAGAA
GTACCTGGAGCATCATTCTCTTCTACCACATCTGAATGTAACTTAAATTTGCTCAAAGAAGCAAAATATTTTTTAAAGTTATTAATAATT
GCTATTTTTGTAGTCTTTGCTTGACTTTTTTGGGGGGGATTAGCAAAGCAGAAAACTGGCTGCTGGGTTCTGTAGTTTTAAAAAATCTAT
ATTTTTAGTCATAATGAGAAGTCTATTTTCACCAATTATGGAAACATACAGTGGAGCAAGTAAACCACTTATTCCAGCTATAATATTATG
AAGAACATTTCCCATGCATCTACAAGCTTGAGAAATAGGATTTTCACAGTGGGGAAGTGGGTTACAATATTGGAATAGGAAAATTTGATG
CTGTAATTTGGGTCCTGTATTTTTCCAAACAACTGTGCTTCTTCAGCACTAATATTTCTGGGATTTAAATAGTAATGTTTAAATTATGGT
AAATGTAATTTAAAACATCTCAATTAAGTCTGTCTATCAATATTGTTCTTCAAGCATGTTTTAGACCTAGAAAAGTATGGTTTGGGGGAG
GCTATTTTATTGTGTGGTTAGCACAAGGAATCTAATTTATAGCAAGTGTGAAATAGTTACCATTTTTTCCTGATCTGTCATCTTCATAGC
ACAACAAAACGAAATGATGGAAATGCTCTTGAGCTCACAACATTTGTTTTTCTTTTAAAGTAAATGCAAGTACCAAAGCTCACTACTGCG
GTTTGCCTGTGCCTGGACAATGAGGCGGAGCCACTGTTGTTTTGTTGGGGCACCCCCTTCCCTCCCCGGGTTTGCAAATAGAGGCTACCG
GGTGCTGTATTCAGCAACACCTGTTTTACTATTTGTTATTAAACTATCATCTCCACCTTCCTTTTGATTAGCAATTTGTACTAAGAAACG
AAACAATGTTATTTGGTGGTGTATAATTCTACTTTTCTAGTAGATTACTGTGTGGAATTCTGTGAAAAATATTTGAGAAAAGGCCTGTAT
TGCATAAATAAATTCTTTGTATGTTGTGAACTTTGATCTCTATTTCTCTTGCAACAGACTTCAAGTGGTCCCTCTTTTTTTCCTACACAC

>In-frame_IKZF1_ENST00000357364_chr7_50367353_+_LRBA_ENST00000535741_chr4_151207186_-_2137nt
CGCGGCGCATCCCAGCCTGGGCGGGACGCTCGGCCGCGGCGAGGCGGGCAAGCCTGGCAGGGCAGAGGGAGCCCCGGCTCCGAGGTTGCT
CTTCGCACCCGAGGATCAGTCTTGGCCCCAAAGCGCGACGCACAAATCCACATAACCTGAGGACCATGGATGCTGATGAGGGTCAAGACA
TGTCCCAAGTTTCAGGGAAGGAAAGCCCCCCTGTAAGCGATACTCCAGATGAGGGCGATGAGCCCATGCCGATCCCCGAGGACCTCTCCA
CCACCTCGGGAGGACAGCAAAGCTCCAAGAGTGACAGAGTCGTGGGTGAGACTGCTGCTCCTCGGGCCATTTTGACCGGCCATGACTATG
AGGTCACATGTGCTGCGGTGTGTGCGGAGCTAGGCCTGGTGTTGAGTGGTTCACAAGAAGGACCATGTCTCATACATTCCATGAATGGAG
ACTTGTTGAGGACCTTGGAGGGTCCTGAAAACTGCCTGAAACCAAAACTCATTCAGGCTTCAAGAGAGGGTCATTGTGTCATATTCTATG
AAAACGGCCTCTTCTGTACATTCAGTGTGAATGGAAAACTCCAGGCCACGATGGAAACAGATGATAACATAAGAGCCATCCAGCTGAGCC
GAGATGGGCAGTACCTGCTCACAGGAGGAGACAGAGGAGTGGTCGTGGTCCGGCAGGTGTCGGACCTCAAGCAGCTCTTTGCCTATCCAG
GATGTGACGCTGGAATCCGGGCCATGGCGCTGTCTTACGACCAGAGGTGCATCATTTCTGGCATGGCTTCAGGAAGCATTGTGCTATTTT
ACAACGACTTTAACCGGTGGCATCATGAATACCAAACCCGCTACTGATGGTGACAGCTGTACATCAACTCTGCCCCTAGGATGAGCAGAA
GTACCTGGAGCATCATTCTCTTCTACCACATCTGAATGTAACTTAAATTTGCTCAAAGAAGCAAAATATTTTTTAAAGTTATTAATAATT
GCTATTTTTGTAGTCTTTGCTTGACTTTTTTGGGGGGGATTAGCAAAGCAGAAAACTGGCTGCTGGGTTCTGTAGTTTTAAAAAATCTAT
ATTTTTAGTCATAATGAGAAGTCTATTTTCACCAATTATGGAAACATACAGTGGAGCAAGTAAACCACTTATTCCAGCTATAATATTATG
AAGAACATTTCCCATGCATCTACAAGCTTGAGAAATAGGATTTTCACAGTGGGGAAGTGGGTTACAATATTGGAATAGGAAAATTTGATG
CTGTAATTTGGGTCCTGTATTTTTCCAAACAACTGTGCTTCTTCAGCACTAATATTTCTGGGATTTAAATAGTAATGTTTAAATTATGGT
AAATGTAATTTAAAACATCTCAATTAAGTCTGTCTATCAATATTGTTCTTCAAGCATGTTTTAGACCTAGAAAAGTATGGTTTGGGGGAG
GCTATTTTATTGTGTGGTTAGCACAAGGAATCTAATTTATAGCAAGTGTGAAATAGTTACCATTTTTTCCTGATCTGTCATCTTCATAGC
ACAACAAAACGAAATGATGGAAATGCTCTTGAGCTCACAACATTTGTTTTTCTTTTAAAGTAAATGCAAGTACCAAAGCTCACTACTGCG
GTTTGCCTGTGCCTGGACAATGAGGCGGAGCCACTGTTGTTTTGTTGGGGCACCCCCTTCCCTCCCCGGGTTTGCAAATAGAGGCTACCG
GGTGCTGTATTCAGCAACACCTGTTTTACTATTTGTTATTAAACTATCATCTCCACCTTCCTTTTGATTAGCAATTTGTACTAAGAAACG
AAACAATGTTATTTGGTGGTGTATAATTCTACTTTTCTAGTAGATTACTGTGTGGAATTCTGTGAAAAATATTTGAGAAAAGGCCTGTAT
TGCATAAATAAATTCTTTGTATGTTGTGAACTTTGATCTCTATTTCTCTTGCAACAGACTTCAAGTGGTCCCTCTTTTTTTCCTACACAC
TCAGCTCTTCTCTAAAAGCAAGGATTTGGAATGAACAATTCAGTTTGACAGAAAAAGCTGAATAAAATGGCATCTGTAATTGAATTGTTG

>In-frame_IKZF1_ENST00000357364_chr7_50367353_+_LRBA_ENST00000510413_chr4_151207186_-_2048nt
CGCGGCGCATCCCAGCCTGGGCGGGACGCTCGGCCGCGGCGAGGCGGGCAAGCCTGGCAGGGCAGAGGGAGCCCCGGCTCCGAGGTTGCT
CTTCGCACCCGAGGATCAGTCTTGGCCCCAAAGCGCGACGCACAAATCCACATAACCTGAGGACCATGGATGCTGATGAGGGTCAAGACA
TGTCCCAAGTTTCAGGGAAGGAAAGCCCCCCTGTAAGCGATACTCCAGATGAGGGCGATGAGCCCATGCCGATCCCCGAGGACCTCTCCA
CCACCTCGGGAGGACAGCAAAGCTCCAAGAGTGACAGAGTCGTGGGTGAGACTGCTGCTCCTCGGGCCATTTTGACCGGCCATGACTATG
AGGTCACATGTGCTGCGGTGTGTGCGGAGCTAGGCCTGGTGTTGAGTGGTTCACAAGAAGGACCATGTCTCATACATTCCATGAATGGAG
ACTTGTTGAGGACCTTGGAGGGTCCTGAAAACTGCCTGAAACCAAAACTCATTCAGGCTTCAAGAGAGGGTCATTGTGTCATATTCTATG
AAAACGGCCTCTTCTGTACATTCAGTGTGAATGGAAAACTCCAGGCCACGATGGAAACAGATGATAACATAAGAGCCATCCAGCTGAGCC
GAGATGGGCAGTACCTGCTCACAGGAGGAGACAGAGGAGTGGTCGTGGTCCGGCAGGTGTCGGACCTCAAGCAGCTCTTTGCCTATCCAG
GATGTGACGCTGGAATCCGGGCCATGGCGCTGTCTTACGACCAGAGGTGCATCATTTCTGGCATGGCTTCAGGAAGCATTGTGCTATTTT
ACAACGACTTTAACCGGTGGCATCATGAATACCAAACCCGCTACTGATGGTGACAGCTGTACATCAACTCTGCCCCTAGGATGAGCAGAA
GTACCTGGAGCATCATTCTCTTCTACCACATCTGAATGTAACTTAAATTTGCTCAAAGAAGCAAAATATTTTTTAAAGTTATTAATAATT
GCTATTTTTGTAGTCTTTGCTTGACTTTTTTGGGGGGGATTAGCAAAGCAGAAAACTGGCTGCTGGGTTCTGTAGTTTTAAAAAATCTAT
ATTTTTAGTCATAATGAGAAGTCTATTTTCACCAATTATGGAAACATACAGTGGAGCAAGTAAACCACTTATTCCAGCTATAATATTATG
AAGAACATTTCCCATGCATCTACAAGCTTGAGAAATAGGATTTTCACAGTGGGGAAGTGGGTTACAATATTGGAATAGGAAAATTTGATG
CTGTAATTTGGGTCCTGTATTTTTCCAAACAACTGTGCTTCTTCAGCACTAATATTTCTGGGATTTAAATAGTAATGTTTAAATTATGGT
AAATGTAATTTAAAACATCTCAATTAAGTCTGTCTATCAATATTGTTCTTCAAGCATGTTTTAGACCTAGAAAAGTATGGTTTGGGGGAG
GCTATTTTATTGTGTGGTTAGCACAAGGAATCTAATTTATAGCAAGTGTGAAATAGTTACCATTTTTTCCTGATCTGTCATCTTCATAGC
ACAACAAAACGAAATGATGGAAATGCTCTTGAGCTCACAACATTTGTTTTTCTTTTAAAGTAAATGCAAGTACCAAAGCTCACTACTGCG
GTTTGCCTGTGCCTGGACAATGAGGCGGAGCCACTGTTGTTTTGTTGGGGCACCCCCTTCCCTCCCCGGGTTTGCAAATAGAGGCTACCG
GGTGCTGTATTCAGCAACACCTGTTTTACTATTTGTTATTAAACTATCATCTCCACCTTCCTTTTGATTAGCAATTTGTACTAAGAAACG
AAACAATGTTATTTGGTGGTGTATAATTCTACTTTTCTAGTAGATTACTGTGTGGAATTCTGTGAAAAATATTTGAGAAAAGGCCTGTAT
TGCATAAATAAATTCTTTGTATGTTGTGAACTTTGATCTCTATTTCTCTTGCAACAGACTTCAAGTGGTCCCTCTTTTTTTCCTACACAC

>In-frame_IKZF1_ENST00000346667_chr7_50367353_+_LRBA_ENST00000535741_chr4_151207186_-_2137nt
CGCGGCGCATCCCAGCCTGGGCGGGACGCTCGGCCGCGGCGAGGCGGGCAAGCCTGGCAGGGCAGAGGGAGCCCCGGCTCCGAGGTTGCT
CTTCGCACCCGAGGATCAGTCTTGGCCCCAAAGCGCGACGCACAAATCCACATAACCTGAGGACCATGGATGCTGATGAGGGTCAAGACA
TGTCCCAAGTTTCAGGGAAGGAAAGCCCCCCTGTAAGCGATACTCCAGATGAGGGCGATGAGCCCATGCCGATCCCCGAGGACCTCTCCA
CCACCTCGGGAGGACAGCAAAGCTCCAAGAGTGACAGAGTCGTGGGTGAGACTGCTGCTCCTCGGGCCATTTTGACCGGCCATGACTATG
AGGTCACATGTGCTGCGGTGTGTGCGGAGCTAGGCCTGGTGTTGAGTGGTTCACAAGAAGGACCATGTCTCATACATTCCATGAATGGAG
ACTTGTTGAGGACCTTGGAGGGTCCTGAAAACTGCCTGAAACCAAAACTCATTCAGGCTTCAAGAGAGGGTCATTGTGTCATATTCTATG
AAAACGGCCTCTTCTGTACATTCAGTGTGAATGGAAAACTCCAGGCCACGATGGAAACAGATGATAACATAAGAGCCATCCAGCTGAGCC
GAGATGGGCAGTACCTGCTCACAGGAGGAGACAGAGGAGTGGTCGTGGTCCGGCAGGTGTCGGACCTCAAGCAGCTCTTTGCCTATCCAG
GATGTGACGCTGGAATCCGGGCCATGGCGCTGTCTTACGACCAGAGGTGCATCATTTCTGGCATGGCTTCAGGAAGCATTGTGCTATTTT
ACAACGACTTTAACCGGTGGCATCATGAATACCAAACCCGCTACTGATGGTGACAGCTGTACATCAACTCTGCCCCTAGGATGAGCAGAA
GTACCTGGAGCATCATTCTCTTCTACCACATCTGAATGTAACTTAAATTTGCTCAAAGAAGCAAAATATTTTTTAAAGTTATTAATAATT
GCTATTTTTGTAGTCTTTGCTTGACTTTTTTGGGGGGGATTAGCAAAGCAGAAAACTGGCTGCTGGGTTCTGTAGTTTTAAAAAATCTAT
ATTTTTAGTCATAATGAGAAGTCTATTTTCACCAATTATGGAAACATACAGTGGAGCAAGTAAACCACTTATTCCAGCTATAATATTATG
AAGAACATTTCCCATGCATCTACAAGCTTGAGAAATAGGATTTTCACAGTGGGGAAGTGGGTTACAATATTGGAATAGGAAAATTTGATG
CTGTAATTTGGGTCCTGTATTTTTCCAAACAACTGTGCTTCTTCAGCACTAATATTTCTGGGATTTAAATAGTAATGTTTAAATTATGGT
AAATGTAATTTAAAACATCTCAATTAAGTCTGTCTATCAATATTGTTCTTCAAGCATGTTTTAGACCTAGAAAAGTATGGTTTGGGGGAG
GCTATTTTATTGTGTGGTTAGCACAAGGAATCTAATTTATAGCAAGTGTGAAATAGTTACCATTTTTTCCTGATCTGTCATCTTCATAGC
ACAACAAAACGAAATGATGGAAATGCTCTTGAGCTCACAACATTTGTTTTTCTTTTAAAGTAAATGCAAGTACCAAAGCTCACTACTGCG
GTTTGCCTGTGCCTGGACAATGAGGCGGAGCCACTGTTGTTTTGTTGGGGCACCCCCTTCCCTCCCCGGGTTTGCAAATAGAGGCTACCG
GGTGCTGTATTCAGCAACACCTGTTTTACTATTTGTTATTAAACTATCATCTCCACCTTCCTTTTGATTAGCAATTTGTACTAAGAAACG
AAACAATGTTATTTGGTGGTGTATAATTCTACTTTTCTAGTAGATTACTGTGTGGAATTCTGTGAAAAATATTTGAGAAAAGGCCTGTAT
TGCATAAATAAATTCTTTGTATGTTGTGAACTTTGATCTCTATTTCTCTTGCAACAGACTTCAAGTGGTCCCTCTTTTTTTCCTACACAC
TCAGCTCTTCTCTAAAAGCAAGGATTTGGAATGAACAATTCAGTTTGACAGAAAAAGCTGAATAAAATGGCATCTGTAATTGAATTGTTG

>In-frame_IKZF1_ENST00000346667_chr7_50367353_+_LRBA_ENST00000510413_chr4_151207186_-_2048nt
CGCGGCGCATCCCAGCCTGGGCGGGACGCTCGGCCGCGGCGAGGCGGGCAAGCCTGGCAGGGCAGAGGGAGCCCCGGCTCCGAGGTTGCT
CTTCGCACCCGAGGATCAGTCTTGGCCCCAAAGCGCGACGCACAAATCCACATAACCTGAGGACCATGGATGCTGATGAGGGTCAAGACA
TGTCCCAAGTTTCAGGGAAGGAAAGCCCCCCTGTAAGCGATACTCCAGATGAGGGCGATGAGCCCATGCCGATCCCCGAGGACCTCTCCA
CCACCTCGGGAGGACAGCAAAGCTCCAAGAGTGACAGAGTCGTGGGTGAGACTGCTGCTCCTCGGGCCATTTTGACCGGCCATGACTATG
AGGTCACATGTGCTGCGGTGTGTGCGGAGCTAGGCCTGGTGTTGAGTGGTTCACAAGAAGGACCATGTCTCATACATTCCATGAATGGAG
ACTTGTTGAGGACCTTGGAGGGTCCTGAAAACTGCCTGAAACCAAAACTCATTCAGGCTTCAAGAGAGGGTCATTGTGTCATATTCTATG
AAAACGGCCTCTTCTGTACATTCAGTGTGAATGGAAAACTCCAGGCCACGATGGAAACAGATGATAACATAAGAGCCATCCAGCTGAGCC
GAGATGGGCAGTACCTGCTCACAGGAGGAGACAGAGGAGTGGTCGTGGTCCGGCAGGTGTCGGACCTCAAGCAGCTCTTTGCCTATCCAG
GATGTGACGCTGGAATCCGGGCCATGGCGCTGTCTTACGACCAGAGGTGCATCATTTCTGGCATGGCTTCAGGAAGCATTGTGCTATTTT
ACAACGACTTTAACCGGTGGCATCATGAATACCAAACCCGCTACTGATGGTGACAGCTGTACATCAACTCTGCCCCTAGGATGAGCAGAA
GTACCTGGAGCATCATTCTCTTCTACCACATCTGAATGTAACTTAAATTTGCTCAAAGAAGCAAAATATTTTTTAAAGTTATTAATAATT
GCTATTTTTGTAGTCTTTGCTTGACTTTTTTGGGGGGGATTAGCAAAGCAGAAAACTGGCTGCTGGGTTCTGTAGTTTTAAAAAATCTAT
ATTTTTAGTCATAATGAGAAGTCTATTTTCACCAATTATGGAAACATACAGTGGAGCAAGTAAACCACTTATTCCAGCTATAATATTATG
AAGAACATTTCCCATGCATCTACAAGCTTGAGAAATAGGATTTTCACAGTGGGGAAGTGGGTTACAATATTGGAATAGGAAAATTTGATG
CTGTAATTTGGGTCCTGTATTTTTCCAAACAACTGTGCTTCTTCAGCACTAATATTTCTGGGATTTAAATAGTAATGTTTAAATTATGGT
AAATGTAATTTAAAACATCTCAATTAAGTCTGTCTATCAATATTGTTCTTCAAGCATGTTTTAGACCTAGAAAAGTATGGTTTGGGGGAG
GCTATTTTATTGTGTGGTTAGCACAAGGAATCTAATTTATAGCAAGTGTGAAATAGTTACCATTTTTTCCTGATCTGTCATCTTCATAGC
ACAACAAAACGAAATGATGGAAATGCTCTTGAGCTCACAACATTTGTTTTTCTTTTAAAGTAAATGCAAGTACCAAAGCTCACTACTGCG
GTTTGCCTGTGCCTGGACAATGAGGCGGAGCCACTGTTGTTTTGTTGGGGCACCCCCTTCCCTCCCCGGGTTTGCAAATAGAGGCTACCG
GGTGCTGTATTCAGCAACACCTGTTTTACTATTTGTTATTAAACTATCATCTCCACCTTCCTTTTGATTAGCAATTTGTACTAAGAAACG
AAACAATGTTATTTGGTGGTGTATAATTCTACTTTTCTAGTAGATTACTGTGTGGAATTCTGTGAAAAATATTTGAGAAAAGGCCTGTAT
TGCATAAATAAATTCTTTGTATGTTGTGAACTTTGATCTCTATTTCTCTTGCAACAGACTTCAAGTGGTCCCTCTTTTTTTCCTACACAC

>In-frame_IKZF1_ENST00000438033_chr7_50367353_+_LRBA_ENST00000535741_chr4_151207186_-_2182nt
AGTGTGAAGGCAGCAGAGGAACCTTTTGGAGGAGGAAGAGGACACAGAGGCCCTGTAGCCAGGCACCAAGATCCCTCCCAGGTGGCTGGG
TCTGAGGGGAACTCCGAGCAGCCCTAGGTCCTCAAAGTCTGGATTTGTGTGGAAAAGGCAGCTCTCACTTGGCCTTGGCGAGGCCTCGGT
TGGTTGATAACCTGAGGACCATGGATGCTGATGAGGGTCAAGACATGTCCCAAGTTTCAGGGAAGGAAAGCCCCCCTGTAAGCGATACTC
CAGATGAGGGCGATGAGCCCATGCCGATCCCCGAGGACCTCTCCACCACCTCGGGAGGACAGCAAAGCTCCAAGAGTGACAGAGTCGTGG
GTGAGACTGCTGCTCCTCGGGCCATTTTGACCGGCCATGACTATGAGGTCACATGTGCTGCGGTGTGTGCGGAGCTAGGCCTGGTGTTGA
GTGGTTCACAAGAAGGACCATGTCTCATACATTCCATGAATGGAGACTTGTTGAGGACCTTGGAGGGTCCTGAAAACTGCCTGAAACCAA
AACTCATTCAGGCTTCAAGAGAGGGTCATTGTGTCATATTCTATGAAAACGGCCTCTTCTGTACATTCAGTGTGAATGGAAAACTCCAGG
CCACGATGGAAACAGATGATAACATAAGAGCCATCCAGCTGAGCCGAGATGGGCAGTACCTGCTCACAGGAGGAGACAGAGGAGTGGTCG
TGGTCCGGCAGGTGTCGGACCTCAAGCAGCTCTTTGCCTATCCAGGATGTGACGCTGGAATCCGGGCCATGGCGCTGTCTTACGACCAGA
GGTGCATCATTTCTGGCATGGCTTCAGGAAGCATTGTGCTATTTTACAACGACTTTAACCGGTGGCATCATGAATACCAAACCCGCTACT
GATGGTGACAGCTGTACATCAACTCTGCCCCTAGGATGAGCAGAAGTACCTGGAGCATCATTCTCTTCTACCACATCTGAATGTAACTTA
AATTTGCTCAAAGAAGCAAAATATTTTTTAAAGTTATTAATAATTGCTATTTTTGTAGTCTTTGCTTGACTTTTTTGGGGGGGATTAGCA
AAGCAGAAAACTGGCTGCTGGGTTCTGTAGTTTTAAAAAATCTATATTTTTAGTCATAATGAGAAGTCTATTTTCACCAATTATGGAAAC
ATACAGTGGAGCAAGTAAACCACTTATTCCAGCTATAATATTATGAAGAACATTTCCCATGCATCTACAAGCTTGAGAAATAGGATTTTC
ACAGTGGGGAAGTGGGTTACAATATTGGAATAGGAAAATTTGATGCTGTAATTTGGGTCCTGTATTTTTCCAAACAACTGTGCTTCTTCA
GCACTAATATTTCTGGGATTTAAATAGTAATGTTTAAATTATGGTAAATGTAATTTAAAACATCTCAATTAAGTCTGTCTATCAATATTG
TTCTTCAAGCATGTTTTAGACCTAGAAAAGTATGGTTTGGGGGAGGCTATTTTATTGTGTGGTTAGCACAAGGAATCTAATTTATAGCAA
GTGTGAAATAGTTACCATTTTTTCCTGATCTGTCATCTTCATAGCACAACAAAACGAAATGATGGAAATGCTCTTGAGCTCACAACATTT
GTTTTTCTTTTAAAGTAAATGCAAGTACCAAAGCTCACTACTGCGGTTTGCCTGTGCCTGGACAATGAGGCGGAGCCACTGTTGTTTTGT
TGGGGCACCCCCTTCCCTCCCCGGGTTTGCAAATAGAGGCTACCGGGTGCTGTATTCAGCAACACCTGTTTTACTATTTGTTATTAAACT
ATCATCTCCACCTTCCTTTTGATTAGCAATTTGTACTAAGAAACGAAACAATGTTATTTGGTGGTGTATAATTCTACTTTTCTAGTAGAT
TACTGTGTGGAATTCTGTGAAAAATATTTGAGAAAAGGCCTGTATTGCATAAATAAATTCTTTGTATGTTGTGAACTTTGATCTCTATTT
CTCTTGCAACAGACTTCAAGTGGTCCCTCTTTTTTTCCTACACACTCAGCTCTTCTCTAAAAGCAAGGATTTGGAATGAACAATTCAGTT
TGACAGAAAAAGCTGAATAAAATGGCATCTGTAATTGAATTGTTGGAAATGCCTTTTTTGCTCCTAAATTTTAAACATCATTAATAAAAT

>In-frame_IKZF1_ENST00000438033_chr7_50367353_+_LRBA_ENST00000510413_chr4_151207186_-_2093nt
AGTGTGAAGGCAGCAGAGGAACCTTTTGGAGGAGGAAGAGGACACAGAGGCCCTGTAGCCAGGCACCAAGATCCCTCCCAGGTGGCTGGG
TCTGAGGGGAACTCCGAGCAGCCCTAGGTCCTCAAAGTCTGGATTTGTGTGGAAAAGGCAGCTCTCACTTGGCCTTGGCGAGGCCTCGGT
TGGTTGATAACCTGAGGACCATGGATGCTGATGAGGGTCAAGACATGTCCCAAGTTTCAGGGAAGGAAAGCCCCCCTGTAAGCGATACTC
CAGATGAGGGCGATGAGCCCATGCCGATCCCCGAGGACCTCTCCACCACCTCGGGAGGACAGCAAAGCTCCAAGAGTGACAGAGTCGTGG
GTGAGACTGCTGCTCCTCGGGCCATTTTGACCGGCCATGACTATGAGGTCACATGTGCTGCGGTGTGTGCGGAGCTAGGCCTGGTGTTGA
GTGGTTCACAAGAAGGACCATGTCTCATACATTCCATGAATGGAGACTTGTTGAGGACCTTGGAGGGTCCTGAAAACTGCCTGAAACCAA
AACTCATTCAGGCTTCAAGAGAGGGTCATTGTGTCATATTCTATGAAAACGGCCTCTTCTGTACATTCAGTGTGAATGGAAAACTCCAGG
CCACGATGGAAACAGATGATAACATAAGAGCCATCCAGCTGAGCCGAGATGGGCAGTACCTGCTCACAGGAGGAGACAGAGGAGTGGTCG
TGGTCCGGCAGGTGTCGGACCTCAAGCAGCTCTTTGCCTATCCAGGATGTGACGCTGGAATCCGGGCCATGGCGCTGTCTTACGACCAGA
GGTGCATCATTTCTGGCATGGCTTCAGGAAGCATTGTGCTATTTTACAACGACTTTAACCGGTGGCATCATGAATACCAAACCCGCTACT
GATGGTGACAGCTGTACATCAACTCTGCCCCTAGGATGAGCAGAAGTACCTGGAGCATCATTCTCTTCTACCACATCTGAATGTAACTTA
AATTTGCTCAAAGAAGCAAAATATTTTTTAAAGTTATTAATAATTGCTATTTTTGTAGTCTTTGCTTGACTTTTTTGGGGGGGATTAGCA
AAGCAGAAAACTGGCTGCTGGGTTCTGTAGTTTTAAAAAATCTATATTTTTAGTCATAATGAGAAGTCTATTTTCACCAATTATGGAAAC
ATACAGTGGAGCAAGTAAACCACTTATTCCAGCTATAATATTATGAAGAACATTTCCCATGCATCTACAAGCTTGAGAAATAGGATTTTC
ACAGTGGGGAAGTGGGTTACAATATTGGAATAGGAAAATTTGATGCTGTAATTTGGGTCCTGTATTTTTCCAAACAACTGTGCTTCTTCA
GCACTAATATTTCTGGGATTTAAATAGTAATGTTTAAATTATGGTAAATGTAATTTAAAACATCTCAATTAAGTCTGTCTATCAATATTG
TTCTTCAAGCATGTTTTAGACCTAGAAAAGTATGGTTTGGGGGAGGCTATTTTATTGTGTGGTTAGCACAAGGAATCTAATTTATAGCAA
GTGTGAAATAGTTACCATTTTTTCCTGATCTGTCATCTTCATAGCACAACAAAACGAAATGATGGAAATGCTCTTGAGCTCACAACATTT
GTTTTTCTTTTAAAGTAAATGCAAGTACCAAAGCTCACTACTGCGGTTTGCCTGTGCCTGGACAATGAGGCGGAGCCACTGTTGTTTTGT
TGGGGCACCCCCTTCCCTCCCCGGGTTTGCAAATAGAGGCTACCGGGTGCTGTATTCAGCAACACCTGTTTTACTATTTGTTATTAAACT
ATCATCTCCACCTTCCTTTTGATTAGCAATTTGTACTAAGAAACGAAACAATGTTATTTGGTGGTGTATAATTCTACTTTTCTAGTAGAT
TACTGTGTGGAATTCTGTGAAAAATATTTGAGAAAAGGCCTGTATTGCATAAATAAATTCTTTGTATGTTGTGAACTTTGATCTCTATTT
CTCTTGCAACAGACTTCAAGTGGTCCCTCTTTTTTTCCTACACACTCAGCTCTTCTCTAAAAGCAAGGATTTGGAATGAACAATTCAGTT

>In-frame_IKZF1_ENST00000439701_chr7_50367353_+_LRBA_ENST00000535741_chr4_151207186_-_2181nt
GTGTGAAGGCAGCAGAGGAACCTTTTGGAGGAGGAAGAGGACACAGAGGCCCTGTAGCCAGGCACCAAGATCCCTCCCAGGTGGCTGGGT
CTGAGGGGAACTCCGAGCAGCCCTAGGTCCTCAAAGTCTGGATTTGTGTGGAAAAGGCAGCTCTCACTTGGCCTTGGCGAGGCCTCGGTT
GGTTGATAACCTGAGGACCATGGATGCTGATGAGGGTCAAGACATGTCCCAAGTTTCAGGGAAGGAAAGCCCCCCTGTAAGCGATACTCC
AGATGAGGGCGATGAGCCCATGCCGATCCCCGAGGACCTCTCCACCACCTCGGGAGGACAGCAAAGCTCCAAGAGTGACAGAGTCGTGGG
TGAGACTGCTGCTCCTCGGGCCATTTTGACCGGCCATGACTATGAGGTCACATGTGCTGCGGTGTGTGCGGAGCTAGGCCTGGTGTTGAG
TGGTTCACAAGAAGGACCATGTCTCATACATTCCATGAATGGAGACTTGTTGAGGACCTTGGAGGGTCCTGAAAACTGCCTGAAACCAAA
ACTCATTCAGGCTTCAAGAGAGGGTCATTGTGTCATATTCTATGAAAACGGCCTCTTCTGTACATTCAGTGTGAATGGAAAACTCCAGGC
CACGATGGAAACAGATGATAACATAAGAGCCATCCAGCTGAGCCGAGATGGGCAGTACCTGCTCACAGGAGGAGACAGAGGAGTGGTCGT
GGTCCGGCAGGTGTCGGACCTCAAGCAGCTCTTTGCCTATCCAGGATGTGACGCTGGAATCCGGGCCATGGCGCTGTCTTACGACCAGAG
GTGCATCATTTCTGGCATGGCTTCAGGAAGCATTGTGCTATTTTACAACGACTTTAACCGGTGGCATCATGAATACCAAACCCGCTACTG
ATGGTGACAGCTGTACATCAACTCTGCCCCTAGGATGAGCAGAAGTACCTGGAGCATCATTCTCTTCTACCACATCTGAATGTAACTTAA
ATTTGCTCAAAGAAGCAAAATATTTTTTAAAGTTATTAATAATTGCTATTTTTGTAGTCTTTGCTTGACTTTTTTGGGGGGGATTAGCAA
AGCAGAAAACTGGCTGCTGGGTTCTGTAGTTTTAAAAAATCTATATTTTTAGTCATAATGAGAAGTCTATTTTCACCAATTATGGAAACA
TACAGTGGAGCAAGTAAACCACTTATTCCAGCTATAATATTATGAAGAACATTTCCCATGCATCTACAAGCTTGAGAAATAGGATTTTCA
CAGTGGGGAAGTGGGTTACAATATTGGAATAGGAAAATTTGATGCTGTAATTTGGGTCCTGTATTTTTCCAAACAACTGTGCTTCTTCAG
CACTAATATTTCTGGGATTTAAATAGTAATGTTTAAATTATGGTAAATGTAATTTAAAACATCTCAATTAAGTCTGTCTATCAATATTGT
TCTTCAAGCATGTTTTAGACCTAGAAAAGTATGGTTTGGGGGAGGCTATTTTATTGTGTGGTTAGCACAAGGAATCTAATTTATAGCAAG
TGTGAAATAGTTACCATTTTTTCCTGATCTGTCATCTTCATAGCACAACAAAACGAAATGATGGAAATGCTCTTGAGCTCACAACATTTG
TTTTTCTTTTAAAGTAAATGCAAGTACCAAAGCTCACTACTGCGGTTTGCCTGTGCCTGGACAATGAGGCGGAGCCACTGTTGTTTTGTT
GGGGCACCCCCTTCCCTCCCCGGGTTTGCAAATAGAGGCTACCGGGTGCTGTATTCAGCAACACCTGTTTTACTATTTGTTATTAAACTA
TCATCTCCACCTTCCTTTTGATTAGCAATTTGTACTAAGAAACGAAACAATGTTATTTGGTGGTGTATAATTCTACTTTTCTAGTAGATT
ACTGTGTGGAATTCTGTGAAAAATATTTGAGAAAAGGCCTGTATTGCATAAATAAATTCTTTGTATGTTGTGAACTTTGATCTCTATTTC
TCTTGCAACAGACTTCAAGTGGTCCCTCTTTTTTTCCTACACACTCAGCTCTTCTCTAAAAGCAAGGATTTGGAATGAACAATTCAGTTT
GACAGAAAAAGCTGAATAAAATGGCATCTGTAATTGAATTGTTGGAAATGCCTTTTTTGCTCCTAAATTTTAAACATCATTAATAAAATA

>In-frame_IKZF1_ENST00000439701_chr7_50367353_+_LRBA_ENST00000510413_chr4_151207186_-_2092nt
GTGTGAAGGCAGCAGAGGAACCTTTTGGAGGAGGAAGAGGACACAGAGGCCCTGTAGCCAGGCACCAAGATCCCTCCCAGGTGGCTGGGT
CTGAGGGGAACTCCGAGCAGCCCTAGGTCCTCAAAGTCTGGATTTGTGTGGAAAAGGCAGCTCTCACTTGGCCTTGGCGAGGCCTCGGTT
GGTTGATAACCTGAGGACCATGGATGCTGATGAGGGTCAAGACATGTCCCAAGTTTCAGGGAAGGAAAGCCCCCCTGTAAGCGATACTCC
AGATGAGGGCGATGAGCCCATGCCGATCCCCGAGGACCTCTCCACCACCTCGGGAGGACAGCAAAGCTCCAAGAGTGACAGAGTCGTGGG
TGAGACTGCTGCTCCTCGGGCCATTTTGACCGGCCATGACTATGAGGTCACATGTGCTGCGGTGTGTGCGGAGCTAGGCCTGGTGTTGAG
TGGTTCACAAGAAGGACCATGTCTCATACATTCCATGAATGGAGACTTGTTGAGGACCTTGGAGGGTCCTGAAAACTGCCTGAAACCAAA
ACTCATTCAGGCTTCAAGAGAGGGTCATTGTGTCATATTCTATGAAAACGGCCTCTTCTGTACATTCAGTGTGAATGGAAAACTCCAGGC
CACGATGGAAACAGATGATAACATAAGAGCCATCCAGCTGAGCCGAGATGGGCAGTACCTGCTCACAGGAGGAGACAGAGGAGTGGTCGT
GGTCCGGCAGGTGTCGGACCTCAAGCAGCTCTTTGCCTATCCAGGATGTGACGCTGGAATCCGGGCCATGGCGCTGTCTTACGACCAGAG
GTGCATCATTTCTGGCATGGCTTCAGGAAGCATTGTGCTATTTTACAACGACTTTAACCGGTGGCATCATGAATACCAAACCCGCTACTG
ATGGTGACAGCTGTACATCAACTCTGCCCCTAGGATGAGCAGAAGTACCTGGAGCATCATTCTCTTCTACCACATCTGAATGTAACTTAA
ATTTGCTCAAAGAAGCAAAATATTTTTTAAAGTTATTAATAATTGCTATTTTTGTAGTCTTTGCTTGACTTTTTTGGGGGGGATTAGCAA
AGCAGAAAACTGGCTGCTGGGTTCTGTAGTTTTAAAAAATCTATATTTTTAGTCATAATGAGAAGTCTATTTTCACCAATTATGGAAACA
TACAGTGGAGCAAGTAAACCACTTATTCCAGCTATAATATTATGAAGAACATTTCCCATGCATCTACAAGCTTGAGAAATAGGATTTTCA
CAGTGGGGAAGTGGGTTACAATATTGGAATAGGAAAATTTGATGCTGTAATTTGGGTCCTGTATTTTTCCAAACAACTGTGCTTCTTCAG
CACTAATATTTCTGGGATTTAAATAGTAATGTTTAAATTATGGTAAATGTAATTTAAAACATCTCAATTAAGTCTGTCTATCAATATTGT
TCTTCAAGCATGTTTTAGACCTAGAAAAGTATGGTTTGGGGGAGGCTATTTTATTGTGTGGTTAGCACAAGGAATCTAATTTATAGCAAG
TGTGAAATAGTTACCATTTTTTCCTGATCTGTCATCTTCATAGCACAACAAAACGAAATGATGGAAATGCTCTTGAGCTCACAACATTTG
TTTTTCTTTTAAAGTAAATGCAAGTACCAAAGCTCACTACTGCGGTTTGCCTGTGCCTGGACAATGAGGCGGAGCCACTGTTGTTTTGTT
GGGGCACCCCCTTCCCTCCCCGGGTTTGCAAATAGAGGCTACCGGGTGCTGTATTCAGCAACACCTGTTTTACTATTTGTTATTAAACTA
TCATCTCCACCTTCCTTTTGATTAGCAATTTGTACTAAGAAACGAAACAATGTTATTTGGTGGTGTATAATTCTACTTTTCTAGTAGATT
ACTGTGTGGAATTCTGTGAAAAATATTTGAGAAAAGGCCTGTATTGCATAAATAAATTCTTTGTATGTTGTGAACTTTGATCTCTATTTC
TCTTGCAACAGACTTCAAGTGGTCCCTCTTTTTTTCCTACACACTCAGCTCTTCTCTAAAAGCAAGGATTTGGAATGAACAATTCAGTTT

>In-frame_IKZF1_ENST00000413698_chr7_50367353_+_LRBA_ENST00000535741_chr4_151207186_-_2191nt
GACTGCGCGGCCCGCGCCCGGGGCGGTGACTGCGGCAAGCCCCCTGGGTCCCCGCGCGGCGCATCCCAGCCTGGGCGGGACGCTCGGCCG
CGGCGAGGCGGGCAAGCCTGGCAGGGCAGAGGGAGCCCCGGCTCCGAGGTTGCTCTTCGCACCCGAGGATCAGTCTTGGCCCCAAAGCGC
GACGCACAAATCCACATAACCTGAGGACCATGGATGCTGATGAGGGTCAAGACATGTCCCAAGTTTCAGGGAAGGAAAGCCCCCCTGTAA
GCGATACTCCAGATGAGGGCGATGAGCCCATGCCGATCCCCGAGGACCTCTCCACCACCTCGGGAGGACAGCAAAGCTCCAAGAGTGACA
GAGTCGTGGGTGAGACTGCTGCTCCTCGGGCCATTTTGACCGGCCATGACTATGAGGTCACATGTGCTGCGGTGTGTGCGGAGCTAGGCC
TGGTGTTGAGTGGTTCACAAGAAGGACCATGTCTCATACATTCCATGAATGGAGACTTGTTGAGGACCTTGGAGGGTCCTGAAAACTGCC
TGAAACCAAAACTCATTCAGGCTTCAAGAGAGGGTCATTGTGTCATATTCTATGAAAACGGCCTCTTCTGTACATTCAGTGTGAATGGAA
AACTCCAGGCCACGATGGAAACAGATGATAACATAAGAGCCATCCAGCTGAGCCGAGATGGGCAGTACCTGCTCACAGGAGGAGACAGAG
GAGTGGTCGTGGTCCGGCAGGTGTCGGACCTCAAGCAGCTCTTTGCCTATCCAGGATGTGACGCTGGAATCCGGGCCATGGCGCTGTCTT
ACGACCAGAGGTGCATCATTTCTGGCATGGCTTCAGGAAGCATTGTGCTATTTTACAACGACTTTAACCGGTGGCATCATGAATACCAAA
CCCGCTACTGATGGTGACAGCTGTACATCAACTCTGCCCCTAGGATGAGCAGAAGTACCTGGAGCATCATTCTCTTCTACCACATCTGAA
TGTAACTTAAATTTGCTCAAAGAAGCAAAATATTTTTTAAAGTTATTAATAATTGCTATTTTTGTAGTCTTTGCTTGACTTTTTTGGGGG
GGATTAGCAAAGCAGAAAACTGGCTGCTGGGTTCTGTAGTTTTAAAAAATCTATATTTTTAGTCATAATGAGAAGTCTATTTTCACCAAT
TATGGAAACATACAGTGGAGCAAGTAAACCACTTATTCCAGCTATAATATTATGAAGAACATTTCCCATGCATCTACAAGCTTGAGAAAT
AGGATTTTCACAGTGGGGAAGTGGGTTACAATATTGGAATAGGAAAATTTGATGCTGTAATTTGGGTCCTGTATTTTTCCAAACAACTGT
GCTTCTTCAGCACTAATATTTCTGGGATTTAAATAGTAATGTTTAAATTATGGTAAATGTAATTTAAAACATCTCAATTAAGTCTGTCTA
TCAATATTGTTCTTCAAGCATGTTTTAGACCTAGAAAAGTATGGTTTGGGGGAGGCTATTTTATTGTGTGGTTAGCACAAGGAATCTAAT
TTATAGCAAGTGTGAAATAGTTACCATTTTTTCCTGATCTGTCATCTTCATAGCACAACAAAACGAAATGATGGAAATGCTCTTGAGCTC
ACAACATTTGTTTTTCTTTTAAAGTAAATGCAAGTACCAAAGCTCACTACTGCGGTTTGCCTGTGCCTGGACAATGAGGCGGAGCCACTG
TTGTTTTGTTGGGGCACCCCCTTCCCTCCCCGGGTTTGCAAATAGAGGCTACCGGGTGCTGTATTCAGCAACACCTGTTTTACTATTTGT
TATTAAACTATCATCTCCACCTTCCTTTTGATTAGCAATTTGTACTAAGAAACGAAACAATGTTATTTGGTGGTGTATAATTCTACTTTT
CTAGTAGATTACTGTGTGGAATTCTGTGAAAAATATTTGAGAAAAGGCCTGTATTGCATAAATAAATTCTTTGTATGTTGTGAACTTTGA
TCTCTATTTCTCTTGCAACAGACTTCAAGTGGTCCCTCTTTTTTTCCTACACACTCAGCTCTTCTCTAAAAGCAAGGATTTGGAATGAAC
AATTCAGTTTGACAGAAAAAGCTGAATAAAATGGCATCTGTAATTGAATTGTTGGAAATGCCTTTTTTGCTCCTAAATTTTAAACATCAT

>In-frame_IKZF1_ENST00000413698_chr7_50367353_+_LRBA_ENST00000510413_chr4_151207186_-_2102nt
GACTGCGCGGCCCGCGCCCGGGGCGGTGACTGCGGCAAGCCCCCTGGGTCCCCGCGCGGCGCATCCCAGCCTGGGCGGGACGCTCGGCCG
CGGCGAGGCGGGCAAGCCTGGCAGGGCAGAGGGAGCCCCGGCTCCGAGGTTGCTCTTCGCACCCGAGGATCAGTCTTGGCCCCAAAGCGC
GACGCACAAATCCACATAACCTGAGGACCATGGATGCTGATGAGGGTCAAGACATGTCCCAAGTTTCAGGGAAGGAAAGCCCCCCTGTAA
GCGATACTCCAGATGAGGGCGATGAGCCCATGCCGATCCCCGAGGACCTCTCCACCACCTCGGGAGGACAGCAAAGCTCCAAGAGTGACA
GAGTCGTGGGTGAGACTGCTGCTCCTCGGGCCATTTTGACCGGCCATGACTATGAGGTCACATGTGCTGCGGTGTGTGCGGAGCTAGGCC
TGGTGTTGAGTGGTTCACAAGAAGGACCATGTCTCATACATTCCATGAATGGAGACTTGTTGAGGACCTTGGAGGGTCCTGAAAACTGCC
TGAAACCAAAACTCATTCAGGCTTCAAGAGAGGGTCATTGTGTCATATTCTATGAAAACGGCCTCTTCTGTACATTCAGTGTGAATGGAA
AACTCCAGGCCACGATGGAAACAGATGATAACATAAGAGCCATCCAGCTGAGCCGAGATGGGCAGTACCTGCTCACAGGAGGAGACAGAG
GAGTGGTCGTGGTCCGGCAGGTGTCGGACCTCAAGCAGCTCTTTGCCTATCCAGGATGTGACGCTGGAATCCGGGCCATGGCGCTGTCTT
ACGACCAGAGGTGCATCATTTCTGGCATGGCTTCAGGAAGCATTGTGCTATTTTACAACGACTTTAACCGGTGGCATCATGAATACCAAA
CCCGCTACTGATGGTGACAGCTGTACATCAACTCTGCCCCTAGGATGAGCAGAAGTACCTGGAGCATCATTCTCTTCTACCACATCTGAA
TGTAACTTAAATTTGCTCAAAGAAGCAAAATATTTTTTAAAGTTATTAATAATTGCTATTTTTGTAGTCTTTGCTTGACTTTTTTGGGGG
GGATTAGCAAAGCAGAAAACTGGCTGCTGGGTTCTGTAGTTTTAAAAAATCTATATTTTTAGTCATAATGAGAAGTCTATTTTCACCAAT
TATGGAAACATACAGTGGAGCAAGTAAACCACTTATTCCAGCTATAATATTATGAAGAACATTTCCCATGCATCTACAAGCTTGAGAAAT
AGGATTTTCACAGTGGGGAAGTGGGTTACAATATTGGAATAGGAAAATTTGATGCTGTAATTTGGGTCCTGTATTTTTCCAAACAACTGT
GCTTCTTCAGCACTAATATTTCTGGGATTTAAATAGTAATGTTTAAATTATGGTAAATGTAATTTAAAACATCTCAATTAAGTCTGTCTA
TCAATATTGTTCTTCAAGCATGTTTTAGACCTAGAAAAGTATGGTTTGGGGGAGGCTATTTTATTGTGTGGTTAGCACAAGGAATCTAAT
TTATAGCAAGTGTGAAATAGTTACCATTTTTTCCTGATCTGTCATCTTCATAGCACAACAAAACGAAATGATGGAAATGCTCTTGAGCTC
ACAACATTTGTTTTTCTTTTAAAGTAAATGCAAGTACCAAAGCTCACTACTGCGGTTTGCCTGTGCCTGGACAATGAGGCGGAGCCACTG
TTGTTTTGTTGGGGCACCCCCTTCCCTCCCCGGGTTTGCAAATAGAGGCTACCGGGTGCTGTATTCAGCAACACCTGTTTTACTATTTGT
TATTAAACTATCATCTCCACCTTCCTTTTGATTAGCAATTTGTACTAAGAAACGAAACAATGTTATTTGGTGGTGTATAATTCTACTTTT
CTAGTAGATTACTGTGTGGAATTCTGTGAAAAATATTTGAGAAAAGGCCTGTATTGCATAAATAAATTCTTTGTATGTTGTGAACTTTGA
TCTCTATTTCTCTTGCAACAGACTTCAAGTGGTCCCTCTTTTTTTCCTACACACTCAGCTCTTCTCTAAAAGCAAGGATTTGGAATGAAC


Top

FusionGenePPI for IKZF1_LRBA


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
IKZF1UBE2I, AP2M1, CTBP1, RBBP8, SIN3A, NCOR2, TBP, GTF2B, SIN3B, HDAC1, CHD4, HDAC2, HDAC4, HDAC5, HDAC7, HDAC3, IKZF4, IKZF5, IKZF2, GATA1, SMARCE1, NUDT21, CSNK1G1, CDK2AP2, IKZF3, RBBP4, CHD3, SMARCA4, NOTCH1, HDAC11, TDG, CRBN, ANKRD11, PRKAB2, BYSL, CKS1B, CTBP2, DCX, DDX6, FGF12, PIN1, PSMA1, PSMA4, RAD51D, SDCBP, SNRPF, DYRK2, AP1M1, MTA1, WTAP, MORF4L2, RWDD2B, IKZF1, MCRS1, MAD2L2, GLRX3, NEK6, MORF4L1, PNKP, SNW1, ISCU, LSM4, FAM50B, ZNF581, SYT17, C1orf109, C19orf66, LMO3, CBX8, SH2D4A, KIF9, GMCL1P1, AEN, C8orf33, SCNM1, NOC4L, ARMC7, FAM214B, FAM161A, SPATC1L, FRMD6, ZNF417, ZMAT2, ALKBH3, CEP57L1, C1orf174, FAM74A4, SH3BP2, MPPED2, NFATC2, NFATC1, MIB2, KLHDC10, POC1A, FOXK2, FOXK1, WDR76, APPBP2, ANKRD27, ZMYND19, KLHDC3, NFS1, MTA3, CUL2, BTBD1, HSD17B4, WDR26, GATAD2A, MKLN1, GATAD2B, RMND5A, RANBP10, MTA2, ARMC8, GALC, POTEILRBATUSC2, NOTCH1, FN1, BAG3, CAST, KIF15, DCAF11, INPPL1, MLF2, VCP, MOV10, RIC3, CT55, PARP16, RD3, TMEM52B, MED4, TMEM17, TMEM216, NCR3LG1, PVR, FAM196A, EPHA1, GYPB, DLK2, TRIM25


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for IKZF1_LRBA


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for IKZF1_LRBA


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneIKZF1C0009324Ulcerative Colitis1CTD_human
HgeneIKZF1C0023485Precursor B-Cell Lymphoblastic Leukemia-Lymphoma1CTD_human
HgeneIKZF1C0024141Lupus Erythematosus, Systemic1CTD_human
HgeneIKZF1C0024299Lymphoma1CTD_human
HgeneIKZF1C1961102Precursor Cell Lymphoblastic Leukemia Lymphoma1CTD_human
HgeneIKZF1C4225173IMMUNODEFICIENCY, COMMON VARIABLE, 131ORPHANET;UNIPROT
TgeneLRBAC3553512IMMUNODEFICIENCY, COMMON VARIABLE, 8, WITH AUTOIMMUNITY1ORPHANET;UNIPROT