FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 17161

FusionGeneSummary for IGF2BP3_PRKCA

check button Fusion gene summary
Fusion gene informationFusion gene name: IGF2BP3_PRKCA
Fusion gene ID: 17161
HgeneTgene
Gene symbol

IGF2BP3

PRKCA

Gene ID

10643

5578

Gene nameinsulin like growth factor 2 mRNA binding protein 3protein kinase C alpha
SynonymsCT98|IMP-3|IMP3|KOC|KOC1|VICKZ3AAG6|PKC-alpha|PKCA|PRKACA
Cytomap

7p15.3

17q24.2

Type of geneprotein-codingprotein-coding
Descriptioninsulin-like growth factor 2 mRNA-binding protein 3IGF-II mRNA-binding protein 3IGF2 mRNA-binding protein 3KH domain containing protein overexpressed in cancerVICKZ family member 3cancer/testis antigen 98protein kinase C alpha typePKC-Aaging-associated gene 6
Modification date2018051920180523
UniProtAcc

O00425

P17252

Ensembl transtripts involved in fusion geneENST00000258729, ENST00000491719, 
ENST00000413366, ENST00000583361, 
Fusion gene scores* DoF score5 X 5 X 4=10016 X 8 X 6=768
# samples 515
** MAII scorelog2(5/100*10)=-1
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(15/768*10)=-2.35614381022528
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: IGF2BP3 [Title/Abstract] AND PRKCA [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Kinase involved fusion gene, inframe and retained kinase domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgenePRKCA

GO:0006468

protein phosphorylation

10770950

TgenePRKCA

GO:0035408

histone H3-T6 phosphorylation

20228790

TgenePRKCA

GO:0043536

positive regulation of blood vessel endothelial cell migration

20011604

TgenePRKCA

GO:0090330

regulation of platelet aggregation

12724315


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLUSCTCGA-33-4587-01AIGF2BP3chr7

23381683

-PRKCAchr17

64637473

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000258729ENST00000413366IGF2BP3chr7

23381683

-PRKCAchr17

64637473

+
5CDS-intronENST00000258729ENST00000583361IGF2BP3chr7

23381683

-PRKCAchr17

64637473

+
intron-3CDSENST00000491719ENST00000413366IGF2BP3chr7

23381683

-PRKCAchr17

64637473

+
intron-intronENST00000491719ENST00000583361IGF2BP3chr7

23381683

-PRKCAchr17

64637473

+

Top

FusionProtFeatures for IGF2BP3_PRKCA


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
IGF2BP3

O00425

PRKCA

P17252

RNA-binding factor that may recruit target transcriptsto cytoplasmic protein-RNA complexes (mRNPs). This transcript'caging' into mRNPs allows mRNA transport and transient storage.It also modulates the rate and location at which targettranscripts encounter the translational apparatus and shields themfrom endonuclease attacks or microRNA-mediated degradation. Bindsto the 3'-UTR of CD44 mRNA and stabilizes it, hence promotes celladhesion and invadopodia formation in cancer cells. Binds to beta-actin/ACTB and MYC transcripts. Binds to the 5'-UTR of theinsulin-like growth factor 2 (IGF2) mRNAs.{ECO:0000269|PubMed:16541107, ECO:0000269|PubMed:23640942}. Calcium-activated, phospholipid- and diacylglycerol(DAG)-dependent serine/threonine-protein kinase that is involvedin positive and negative regulation of cell proliferation,apoptosis, differentiation, migration and adhesion, tumorigenesis,cardiac hypertrophy, angiogenesis, platelet function andinflammation, by directly phosphorylating targets such as RAF1,BCL2, CSPG4, TNNT2/CTNT, or activating signaling cascade involvingMAPK1/3 (ERK1/2) and RAP1GAP. Involved in cell proliferation andcell growth arrest by positive and negative regulation of the cellcycle. Can promote cell growth by phosphorylating and activatingRAF1, which mediates the activation of the MAPK/ERK signalingcascade, and/or by up-regulating CDKN1A, which facilitates activecyclin-dependent kinase (CDK) complex formation in glioma cells.In intestinal cells stimulated by the phorbol ester PMA, cantrigger a cell cycle arrest program which is associated with theaccumulation of the hyper-phosphorylated growth-suppressive formof RB1 and induction of the CDK inhibitors CDKN1A and CDKN1B.Exhibits anti-apoptotic function in glioma cells and protects themfrom apoptosis by suppressing the p53/TP53-mediated activation ofIGFBP3, and in leukemia cells mediates anti-apoptotic action byphosphorylating BCL2. During macrophage differentiation induced bymacrophage colony-stimulating factor (CSF1), is translocated tothe nucleus and is associated with macrophage development. Afterwounding, translocates from focal contacts to lamellipodia andparticipates in the modulation of desmosomal adhesion. Plays arole in cell motility by phosphorylating CSPG4, which inducesassociation of CSPG4 with extensive lamellipodia at the cellperiphery and polarization of the cell accompanied by increases incell motility. During chemokine-induced CD4(+) T cell migration,phosphorylates CDC42-guanine exchange factor DOCK8 resulting inits dissociation from LRCH1 and the activation of GTPase CDC42(PubMed:28028151). Is highly expressed in a number of cancer cellswhere it can act as a tumor promoter and is implicated inmalignant phenotypes of several tumors such as gliomas and breastcancers. Negatively regulates myocardial contractility andpositively regulates angiogenesis, platelet aggregation andthrombus formation in arteries. Mediates hypertrophic growth ofneonatal cardiomyocytes, in part through a MAPK1/3 (ERK1/2)-dependent signaling pathway, and upon PMA treatment, is requiredto induce cardiomyocyte hypertrophy up to heart failure and death,by increasing protein synthesis, protein-DNA ratio and cellsurface area. Regulates cardiomyocyte function by phosphorylatingcardiac troponin T (TNNT2/CTNT), which induces significantreduction in actomyosin ATPase activity, myofilament calciumsensitivity and myocardial contractility. In angiogenesis, isrequired for full endothelial cell migration, adhesion tovitronectin (VTN), and vascular endothelial growth factor A(VEGFA)-dependent regulation of kinase activation and vasculartube formation. Involved in the stabilization of VEGFA mRNA atpost-transcriptional level and mediates VEGFA-induced cellproliferation. In the regulation of calcium-induced plateletaggregation, mediates signals from the CD36/GP4 receptor forgranule release, and activates the integrin heterodimer ITGA2B-ITGB3 through the RAP1GAP pathway for adhesion. During response tolipopolysaccharides (LPS), may regulate selective LPS-inducedmacrophage functions involved in host defense and inflammation.But in some inflammatory responses, may negatively regulate NF-kappa-B-induced genes, through IL1A-dependent induction of NF-kappa-B inhibitor alpha (NFKBIA/IKBA). Upon stimulation with 12-O-tetradecanoylphorbol-13-acetate (TPA), phosphorylates EIF4G1,which modulates EIF4G1 binding to MKNK1 and may be involved in theregulation of EIF4E phosphorylation. Phosphorylates KIT, leadingto inhibition of KIT activity. Phosphorylates ATF2 which promotescooperation between ATF2 and JUN, activating transcription.{ECO:0000269|PubMed:10848585, ECO:0000269|PubMed:11909826,ECO:0000269|PubMed:12724315, ECO:0000269|PubMed:12832403,ECO:0000269|PubMed:15016832, ECO:0000269|PubMed:15504744,ECO:0000269|PubMed:15526160, ECO:0000269|PubMed:18056764,ECO:0000269|PubMed:19176525, ECO:0000269|PubMed:21576361,ECO:0000269|PubMed:23990668, ECO:0000269|PubMed:28028151,ECO:0000269|PubMed:9738012, ECO:0000269|PubMed:9830023,ECO:0000269|PubMed:9873035, ECO:0000269|PubMed:9927633}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneIGF2BP3chr7:23381683chr17:64637473ENST00000258729-1015195_260401580DomainKH 1
HgeneIGF2BP3chr7:23381683chr17:64637473ENST00000258729-1015276_343401580DomainKH 2
HgeneIGF2BP3chr7:23381683chr17:64637473ENST00000258729-10152_75401580DomainRRM 1
HgeneIGF2BP3chr7:23381683chr17:64637473ENST00000258729-101581_156401580DomainRRM 2
TgenePRKCAchr7:23381683chr17:64637473ENST00000413366+217172_26096673DomainC2
TgenePRKCAchr7:23381683chr17:64637473ENST00000413366+217339_59796673DomainProtein kinase
TgenePRKCAchr7:23381683chr17:64637473ENST00000413366+217598_66896673DomainNote=AGC-kinase C-terminal
TgenePRKCAchr7:23381683chr17:64637473ENST00000413366+217345_35396673Nucleotide bindingATP
TgenePRKCAchr7:23381683chr17:64637473ENST00000413366+217101_15196673Zinc fingerPhorbol-ester/DAG-type 2

- In-frame and not-retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneIGF2BP3chr7:23381683chr17:64637473ENST00000258729-1015405_470401580DomainKH 3
HgeneIGF2BP3chr7:23381683chr17:64637473ENST00000258729-1015487_553401580DomainKH 4
TgenePRKCAchr7:23381683chr17:64637473ENST00000413366+21736_8696673Zinc fingerPhorbol-ester/DAG-type 1


Top

FusionGeneSequence for IGF2BP3_PRKCA


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_IGF2BP3_ENST00000258729_chr7_23381683_-_PRKCA_ENST00000413366_chr17_64637473_+_978aa
MNKLTIGNLSENAAPSDLESIFKDAKIPVSGPFLVKTGYAFVDCPDESWALKAIEALSGKIELHGKPIEVEHSVPKRQRIRKLQIRNIPP
HLQWEVLDSLLVQTGVVESCEQVNTDSETAVVNVTTSSKDQARQALDKLNGFQLENFTLKVATIPDEMAAQQNPLQQPRGRRGLGQRGSS
RQGSPGSVSKQKPCDLPLRLLVPTQFVGAIIGKEGATIRNITKQTQSKIDVHRKENAGAAEKSITILSTPEGTSAACKSILEIMHKEAQD
IKFTEEIPLKILAHNNFVGRLIGKEGRNLKKIEQDTDTKITISPLQELTLTNPERTITVKGNVETCAKAEEEIMKKIRESTENDIASMNL
QAHLIPGLNLNALGLFPPTSGMPPPTSGPPSAMTPPYPQFEDPRSKHKFKIHTYGSPTFCDHCGSLLTGLIHQGMKCDTCDMNVHKQCVI
NVPSLCGMDHTEKRGRIYLKAEVADEKLHVTVRDAKNLIPMDPNGLSDPTVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSD
KDRRLSVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEEGNMELRQKFEKAKLGPAGNKVISPSEDRK
QPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKGTEELTAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLYF
VMETVNGGDLMYHIQQVGKFKEPQAVFTAAEISIGLFFLHKRGIITRDLKLDNVMLDSEGHIKIADFGMCKEHMMDGVTTRTFCGTPDTI
APEIIATQPTGKSVDWWATGVLLTEMLAGQPPFDGEDEDELFQSIMEHNVSTPKSLSKEAVSVCKGLMTKHPAKRLGCGPEGERDVREHA


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_IGF2BP3_ENST00000258729_chr7_23381683_-_PRKCA_ENST00000413366_chr17_64637473_+_2934nt
ATGAACAAACTGTATATCGGAAACCTCAGCGAGAACGCCGCCCCCTCGGACCTAGAAAGTATCTTCAAGGACGCCAAGATCCCGGTGTCG
GGACCCTTCCTGGTGAAGACTGGCTACGCGTTCGTGGACTGCCCGGACGAGAGCTGGGCCCTCAAGGCCATCGAGGCGCTTTCAGGTAAA
ATAGAACTGCACGGGAAACCCATAGAAGTTGAGCACTCGGTCCCAAAAAGGCAAAGGATTCGGAAACTTCAGATACGAAATATCCCGCCT
CATTTACAGTGGGAGGTGCTGGATAGTTTACTAGTCCAGTATGGAGTGGTGGAGAGCTGTGAGCAAGTGAACACTGACTCGGAAACTGCA
GTTGTAAATGTAACCTATTCCAGTAAGGACCAAGCTAGACAAGCACTAGACAAACTGAATGGATTTCAGTTAGAGAATTTCACCTTGAAA
GTAGCCTATATCCCTGATGAAATGGCCGCCCAGCAAAACCCCTTGCAGCAGCCCCGAGGTCGCCGGGGGCTTGGGCAGAGGGGCTCCTCA
AGGCAGGGGTCTCCAGGATCCGTATCCAAGCAGAAACCATGTGATTTGCCTCTGCGCCTGCTGGTTCCCACCCAATTTGTTGGAGCCATC
ATAGGAAAAGAAGGTGCCACCATTCGGAACATCACCAAACAGACCCAGTCTAAAATCGATGTCCACCGTAAAGAAAATGCGGGGGCTGCT
GAGAAGTCGATTACTATCCTCTCTACTCCTGAAGGCACCTCTGCGGCTTGTAAGTCTATTCTGGAGATTATGCATAAGGAAGCTCAAGAT
ATAAAATTCACAGAAGAGATCCCCTTGAAGATTTTAGCTCATAATAACTTTGTTGGACGTCTTATTGGTAAAGAAGGAAGAAATCTTAAA
AAAATTGAGCAAGACACAGACACTAAAATCACGATATCTCCATTGCAGGAATTGACGCTGTATAATCCAGAACGCACTATTACAGTTAAA
GGCAATGTTGAGACATGTGCCAAAGCTGAGGAGGAGATCATGAAGAAAATCAGGGAGTCTTATGAAAATGATATTGCTTCTATGAATCTT
CAAGCACATTTAATTCCTGGATTAAATCTGAACGCCTTGGGTCTGTTCCCACCCACTTCAGGGATGCCACCTCCCACCTCAGGGCCCCCT
TCAGCCATGACTCCTCCCTACCCGCAGTTTGAGGACCCCAGGAGCAAGCACAAGTTCAAAATCCACACTTACGGAAGCCCCACCTTCTGC
GATCACTGTGGGTCACTGCTCTATGGACTTATCCATCAAGGGATGAAATGTGACACCTGCGATATGAACGTTCACAAGCAATGCGTCATC
AATGTCCCCAGCCTCTGCGGAATGGATCACACTGAGAAGAGGGGGCGGATTTACCTAAAGGCTGAGGTTGCTGATGAAAAGCTCCATGTC
ACAGTACGAGATGCAAAAAATCTAATCCCTATGGATCCAAACGGGCTTTCAGATCCTTATGTGAAGCTGAAACTTATTCCTGATCCCAAG
AATGAAAGCAAGCAAAAAACCAAAACCATCCGCTCCACACTAAATCCGCAGTGGAATGAGTCCTTTACATTCAAATTGAAACCTTCAGAC
AAAGACCGACGACTGTCTGTAGAAATCTGGGACTGGGATCGAACAACAAGGAATGACTTCATGGGATCCCTTTCCTTTGGAGTTTCGGAG
CTGATGAAGATGCCGGCCAGTGGATGGTACAAGTTGCTTAACCAAGAAGAAGGTGAGTACTACAACGTACCCATTCCGGAAGGGGACGAG
GAAGGAAACATGGAACTCAGGCAGAAATTCGAGAAAGCCAAACTTGGCCCTGCTGGCAACAAAGTCATCAGTCCCTCTGAAGACAGGAAA
CAACCTTCCAACAACCTTGACCGAGTGAAACTCACGGACTTCAATTTCCTCATGGTGTTGGGAAAGGGGAGTTTTGGAAAGGTGATGCTT
GCCGACAGGAAGGGCACAGAAGAACTGTATGCAATCAAAATCCTGAAGAAGGATGTGGTGATTCAGGATGATGACGTGGAGTGCACCATG
GTAGAAAAGCGAGTCTTGGCCCTGCTTGACAAACCCCCGTTCTTGACGCAGCTGCACTCCTGCTTCCAGACAGTGGATCGGCTGTACTTC
GTCATGGAATATGTCAACGGTGGGGACCTCATGTACCACATTCAGCAAGTAGGAAAATTTAAGGAACCACAAGCAGTATTCTATGCGGCA
GAGATTTCCATCGGATTGTTCTTTCTTCATAAAAGAGGAATCATTTATAGGGATCTGAAGTTAGATAACGTCATGTTGGATTCAGAAGGA
CATATCAAAATTGCTGACTTTGGGATGTGCAAGGAACACATGATGGATGGAGTCACGACCAGGACCTTCTGTGGGACTCCAGATTATATC
GCCCCAGAGATAATCGCTTATCAGCCGTATGGAAAATCTGTGGACTGGTGGGCCTATGGCGTCCTGTTGTATGAAATGCTTGCCGGGCAG
CCTCCATTTGATGGTGAAGATGAAGACGAGCTATTTCAGTCTATCATGGAGCACAACGTTTCCTATCCAAAATCCTTGTCCAAGGAGGCT
GTTTCTGTCTGCAAAGGACTGATGACCAAACACCCAGCCAAGCGGCTGGGCTGTGGGCCTGAGGGGGAGAGGGACGTGAGAGAGCATGCC
TTCTTCCGGAGGATCGACTGGGAAAAACTGGAGAACAGGGAGATCCAGCCACCATTCAAGCCCAAAGTGTGTGGCAAAGGAGCAGAGAAC
TTTGACAAGTTCTTCACACGAGGACAGCCCGTCTTAACACCACCTGATCAGCTGGTTATTGCTAACATAGACCAGTCTGATTTTGAAGGG


* Fusion transcript sequences (Full-length transcript).
>In-frame_IGF2BP3_ENST00000258729_chr7_23381683_-_PRKCA_ENST00000413366_chr17_64637473_+_9997nt
GGCCGAAGCCAAAGGGGTTGGGAAGGAAGAGACAAAAAGTAGTTTTTTCCCCTCCTCCTCCTCCTTTCTCTTGCTAATCCCGCCTCCTCC
TAAGACTTAGGAAGACTGGTGGATGCGTTTGGGTTGTAGCTAGGCTTTTTCTTTTCTTTCTCTTTTAAAACACATCTAGACAAGGAAAAA
ACAAGCCTCGGATCTGATTTTTCACTCCTCGTTCTTGTGCTTGGTTCTTACTGTGTTTGTGTATTTTAAAGGCGAGAAGACGAGGGGAAC
AAAACCAGCTGGATCCATCCATCACCGTGGGTGGTTTTAATTTTTCGTTTTTTCTCGTTATTTTTTTTTAAACAACCACTCTTCACAATG
AACAAACTGTATATCGGAAACCTCAGCGAGAACGCCGCCCCCTCGGACCTAGAAAGTATCTTCAAGGACGCCAAGATCCCGGTGTCGGGA
CCCTTCCTGGTGAAGACTGGCTACGCGTTCGTGGACTGCCCGGACGAGAGCTGGGCCCTCAAGGCCATCGAGGCGCTTTCAGGTAAAATA
GAACTGCACGGGAAACCCATAGAAGTTGAGCACTCGGTCCCAAAAAGGCAAAGGATTCGGAAACTTCAGATACGAAATATCCCGCCTCAT
TTACAGTGGGAGGTGCTGGATAGTTTACTAGTCCAGTATGGAGTGGTGGAGAGCTGTGAGCAAGTGAACACTGACTCGGAAACTGCAGTT
GTAAATGTAACCTATTCCAGTAAGGACCAAGCTAGACAAGCACTAGACAAACTGAATGGATTTCAGTTAGAGAATTTCACCTTGAAAGTA
GCCTATATCCCTGATGAAATGGCCGCCCAGCAAAACCCCTTGCAGCAGCCCCGAGGTCGCCGGGGGCTTGGGCAGAGGGGCTCCTCAAGG
CAGGGGTCTCCAGGATCCGTATCCAAGCAGAAACCATGTGATTTGCCTCTGCGCCTGCTGGTTCCCACCCAATTTGTTGGAGCCATCATA
GGAAAAGAAGGTGCCACCATTCGGAACATCACCAAACAGACCCAGTCTAAAATCGATGTCCACCGTAAAGAAAATGCGGGGGCTGCTGAG
AAGTCGATTACTATCCTCTCTACTCCTGAAGGCACCTCTGCGGCTTGTAAGTCTATTCTGGAGATTATGCATAAGGAAGCTCAAGATATA
AAATTCACAGAAGAGATCCCCTTGAAGATTTTAGCTCATAATAACTTTGTTGGACGTCTTATTGGTAAAGAAGGAAGAAATCTTAAAAAA
ATTGAGCAAGACACAGACACTAAAATCACGATATCTCCATTGCAGGAATTGACGCTGTATAATCCAGAACGCACTATTACAGTTAAAGGC
AATGTTGAGACATGTGCCAAAGCTGAGGAGGAGATCATGAAGAAAATCAGGGAGTCTTATGAAAATGATATTGCTTCTATGAATCTTCAA
GCACATTTAATTCCTGGATTAAATCTGAACGCCTTGGGTCTGTTCCCACCCACTTCAGGGATGCCACCTCCCACCTCAGGGCCCCCTTCA
GCCATGACTCCTCCCTACCCGCAGTTTGAGGACCCCAGGAGCAAGCACAAGTTCAAAATCCACACTTACGGAAGCCCCACCTTCTGCGAT
CACTGTGGGTCACTGCTCTATGGACTTATCCATCAAGGGATGAAATGTGACACCTGCGATATGAACGTTCACAAGCAATGCGTCATCAAT
GTCCCCAGCCTCTGCGGAATGGATCACACTGAGAAGAGGGGGCGGATTTACCTAAAGGCTGAGGTTGCTGATGAAAAGCTCCATGTCACA
GTACGAGATGCAAAAAATCTAATCCCTATGGATCCAAACGGGCTTTCAGATCCTTATGTGAAGCTGAAACTTATTCCTGATCCCAAGAAT
GAAAGCAAGCAAAAAACCAAAACCATCCGCTCCACACTAAATCCGCAGTGGAATGAGTCCTTTACATTCAAATTGAAACCTTCAGACAAA
GACCGACGACTGTCTGTAGAAATCTGGGACTGGGATCGAACAACAAGGAATGACTTCATGGGATCCCTTTCCTTTGGAGTTTCGGAGCTG
ATGAAGATGCCGGCCAGTGGATGGTACAAGTTGCTTAACCAAGAAGAAGGTGAGTACTACAACGTACCCATTCCGGAAGGGGACGAGGAA
GGAAACATGGAACTCAGGCAGAAATTCGAGAAAGCCAAACTTGGCCCTGCTGGCAACAAAGTCATCAGTCCCTCTGAAGACAGGAAACAA
CCTTCCAACAACCTTGACCGAGTGAAACTCACGGACTTCAATTTCCTCATGGTGTTGGGAAAGGGGAGTTTTGGAAAGGTGATGCTTGCC
GACAGGAAGGGCACAGAAGAACTGTATGCAATCAAAATCCTGAAGAAGGATGTGGTGATTCAGGATGATGACGTGGAGTGCACCATGGTA
GAAAAGCGAGTCTTGGCCCTGCTTGACAAACCCCCGTTCTTGACGCAGCTGCACTCCTGCTTCCAGACAGTGGATCGGCTGTACTTCGTC
ATGGAATATGTCAACGGTGGGGACCTCATGTACCACATTCAGCAAGTAGGAAAATTTAAGGAACCACAAGCAGTATTCTATGCGGCAGAG
ATTTCCATCGGATTGTTCTTTCTTCATAAAAGAGGAATCATTTATAGGGATCTGAAGTTAGATAACGTCATGTTGGATTCAGAAGGACAT
ATCAAAATTGCTGACTTTGGGATGTGCAAGGAACACATGATGGATGGAGTCACGACCAGGACCTTCTGTGGGACTCCAGATTATATCGCC
CCAGAGATAATCGCTTATCAGCCGTATGGAAAATCTGTGGACTGGTGGGCCTATGGCGTCCTGTTGTATGAAATGCTTGCCGGGCAGCCT
CCATTTGATGGTGAAGATGAAGACGAGCTATTTCAGTCTATCATGGAGCACAACGTTTCCTATCCAAAATCCTTGTCCAAGGAGGCTGTT
TCTGTCTGCAAAGGACTGATGACCAAACACCCAGCCAAGCGGCTGGGCTGTGGGCCTGAGGGGGAGAGGGACGTGAGAGAGCATGCCTTC
TTCCGGAGGATCGACTGGGAAAAACTGGAGAACAGGGAGATCCAGCCACCATTCAAGCCCAAAGTGTGTGGCAAAGGAGCAGAGAACTTT
GACAAGTTCTTCACACGAGGACAGCCCGTCTTAACACCACCTGATCAGCTGGTTATTGCTAACATAGACCAGTCTGATTTTGAAGGGTTC
TCGTATGTCAACCCCCAGTTTGTGCACCCCATCTTACAGAGTGCAGTATGAAACTCACCAGCGAGAACAAACACCTCCCCAGCCCCCAGC
CCTCCCCGCAGTGGGAAGTGAATCCTTAACCCTAAAATTTTAAGGCCACGGCCTTGTGTCTGATTCCATATGGAGGCCTGAAAATTGTAG
GGTTATTAGTCCAAATGTGATCAACTGTTCAGGGTCTCTCTCTTACAACCAAGAACATTATCTTAGTGGAAGATGGTACGTCATGCTCAG
TGTCCAGTTTAATTCTGTAGAAGTTACGTCTGGCTCTAGGTTAACCCTTCCTAGAAAGCAAGCAGACTGTTGCCCCATTTTGGGTACAAT
TTGATATACTTTCCATACCCTCCATCTGTGGATTTTTCAGCATTGGAATCCCCCAACCAGAGATGTTAAAGTGAGCCTGTCCCAGGAAAC
ATCTCCACCCAAGACGTCTTTGGAATCCAAGAACAGGAAGCCAAGAGAGTGAGCAGGGAGGGATTGGGGGTGGGGGAGGCCTCAAAATAC
CGACTGCGTCCATTCTCTGCCTCCATGGAAACAGCCCCTAGAATCTGAAAGGCCGGGATAAACCTAATCACTGTTCCCAAACATTGACAA
ATCCTAACCCAACCATGGTCCAGCAGTTACCAGTTTAAACAAAAAAACCTCAGATGAGTGTTGGGTGAATCTGTCATCTGGTACCCTCCT
TGGTTGATAACTGTCTTGATACTTTTCATTCTTTGTAAGAGGCCAAATCGTCTAAGGACGTTGCTGAACAAGCGTGTGAAATCATTTCAG
ATCAAGGATAAGCCAGTGTGTACATATGTTCATTTTAATCTCTGGGAGATTATTTTTCCATCCAGGGTGCCATCAGTAATCATGCCACTA
CTCACCAGTGTTGTTCACCAACACCCACCCCCACACACACCAACATTTTGCTGCCTACCTTGTTATCCTTCTCAAGAAGCTGAAGTGTAC
GCCCTCTCCCCTTTTGTGCTTATTTATTTAATAGGCTGCAGTGTCGCTTATGAAAGTACGATGTACAGTAACTTAATGGAAGTGCTGACT
CTAGCATCAGCCTCTACCGATTGATTTTCCTCCCTTCTCTAGCCCTGGATGTCCACTTAGGGATAAAAAGAATATGGTTTTGGTTCCCAT
TTCTAGTTCACGTTGAATGACAGGCCTGGAGCTGTAGAATCAGGAAACCCGGATGCCTAACAGCTCAAAGATGTTTTGTTAATAGAAGGA
TTTTAATACGTTTTGCAAATGCATCATGCAATGAATTTTGCATGTTTATAATAAACCTTAATAACAAGTGAATCTATATTATTGATATAA
TCGTATCAAGTATAAAGAGAGTATTATAATAATTTTATAAGACACAATTGTGCTCTATTTGTGCAGGTTCTTGTTTCTAATCCTCTTTTC
TAATTAAGTTTTAGCTGAATCCCTTGCTTCTGTGCTTTCCCTCCCTGCACATGGGCACTGTATCAGATAGATTACTTTTTAAATGTAGAT
AAAATTTCAAAAATGAATGGCTAGTTTACGTGATAGATTAGGCTCTTACTACATATGTGTGTGTATATATATGTATTTGATTCTACCTGC
AAACAAATTTTTATTGGTGAGGACTATTTTTGAGCTGACACTCCCTCTTAGTTTCTTCATGTCACCTTTCGTCCTGGTTCCTCCGCCACT
CTTCCTCTTGGGGACAACAGGAAGTGTCTGATTCCAGTCTGCCTAGTACGTTGGTACACACGTGGCATTGCCGCAGCACCTGGGCTGACC
TTTGTGTGTGCGTGTGTGTGTGTTTCCTTCTTCCCTTCAGCCTGTGACTGTTGCTGACTCCAGGGGTGGGAGGGATGGGGAGACTCCCCT
CTTGCTGTGTGTACTGGACACGCAGGAAGCATGCTGTCTTGCTGCCTCTGCAACGACCTGTCGTTTGCTCCAGCATGCACAAACTTCGTG
AGACCAACACAGCCGTGCCCTGCAGGCACCAGCACGTGCTTTTCAGAGGCTGCGGACTTTCTTCCAGCCATTGTGGCATTGGCCTTTCCA
GTCTTGGGAGGAGCGCGCTGCTTTGGTGAGACACCCCCATGCAAGGTCCTCAGAGTAGCCGGGTTCTACCACAAACAGAAACAGAATGAA
AGTAGCTGTCAGTCCTTGTAGAGAGCCGCTCTGTTTCCTCCCAGAAGCATCTCCCAGCTAAGCTCGCATTATTTTTCTCCTCTGGCTGTT
TGCCTGAAGTTCACAGAACACACAACCATGAAAGGCTTTTTGAGGTGAGAGGCCCAGGTGGTCCTGGCAACCCTGAGTAGAAGGAGAGAC
GGGGTAGGGAACGGGCCCGGCCAGAAAAGAACCATTTCTTCTGCCATCTTTTATGCACCATAGACATCGAGACTCCAGGGGGTCCTGGCT
CCCCTGTCCCTGCAGCCCTGCAGGTCAGTGCATGATCTGGGTTCGTGTCCTGACCAGGTGCTCCTCCTTTGATCCGAGGGGAAAGGGACT
GGTTTATAGAAAGAGCCTAGGAGACAAAAGGGCCAGTCCCCCTGCCCAGAATGGAGCAGCAGCAGGACAGACCCCCACGAGGCCCCCCAG
AGAGGAGGAAGATCCCACGGAGGAACACATGAGGTTAGGGACCCTTGTTCAGCACCCCAAACAGCCTGCCTGTTTAAAGCAGGCAGCAGG
CTTAGGCCTTCCCTGCAACCCCAACACCCACAAGTTTGTTTCTCTAGGAAACACATTCACTGTCTCAGCTGGCTGTTACTCTCTCAGACC
ATATGGCAAAGTTTTCCAAGAAAATGCCCCGACAGGGGTGCCCAGCACACTGCCTGAGGGACAACAGACATCAGAACAAACCCCCAGAGA
GAAACAGTCAAAATCAGGGCCCGGTGCAGTGTTGTCATGTGGAACCTGCTTTATCCATTGCTGAGTGTTGAATGTGGGTAATGGTTAGGG
CTTTCCAGATCTCAGCAGCCAAAGACAGTTATTGTTGGAAGACTGTCATGTAGATAACCATGAGCAATGGCTCGCCTCAGAATCAGTTCA
TAAAATTCTATGGTACTGGCCCCTTCGTGGGTATTGTGTGAAATGAGATGGTGGCGAGGGGTGCGCTGTGGAACTGCCGCAGCCACGCAG
GAGGTCCCTGGGGGATGCTTTGGGAAGTCCTTGCCCCTGAGCACTGCCTGATTGCCAGGGCCTGTGGAGGTCTAGGCCGCCTGGCAGAAT
CTAGCACCGTCCGAATCCCCGCAGGACCCATGGAGCTATGACCACACCAGGCCATTCAAATGGCTCTGCATTATCTTCCCTTGGAAGGTG
GCCACTCCTCGGTGGCAGGGCCTTTCCCTGAGGCTGCAGGCCGTGGGCTGGCAGCCCGTCTCTTGGCATTTCAATTGAAGGTCACCAGGT
GCTGGGTTTGAAAGGAAGTCACTGGAGTGCTGCCAGGGGCCGCCCTCCAAGGTTAATGAGAGGCCCACATCCAGGCAAGAACTAATTCAA
AAGGCAGATCAGAAACCACAGGAGTCAAAATTATTGCTCCGGCAGTGCTTCCCTTCCTTTCATCCACTGGCCTCGTGTGGTCCATGCAGG
GCCACTGTCTGCCCTTTCTGATGCCACGTATTAGGCTTTCTTACTCAGAATTTTGATAGAAAACCATGGGGCCAAGAGCTCTGGAAGCCT
GGCCGGAAAGACCAAGGTTCATGCAGCCCAACAAATGATTGTTGAGCACCTCTCGGAGCCAAAGTCCTTAGGCGAGTGTGGTGACTTCCT
GGAAGGAGGATGCAGACTTCCAGAGAGCCCCCCCAACGGACGTGCTGAGAAGGGAGAGGGAGGCGGGGGCTGTAGTCAGGAAGGAGCCAG
AGAAGAACAGGGTTTGGGTGCATCCAGAAATATGCCTGCAGTAGGAGGGAGAGGAAGGGGTGCCACCGTCAACGGCTTCCCATCGGAGGT
GGTTGGTGCAGATGGAAGTTTCTGTCTGCTGGCCCTCAAGAGAGTGTTTTGCCAGGGACACAGTCTGTTCCTCCTCAGAAAACACCCCCC
AAATGCTAACAACATCCCCACCAGCTGCTAGAAGCCCCTTTCCCCTCCCCACCTTGAAGTAGCTCATAGTTCTCTGGGCAGAGCCAGACC
ATCCAGTGTACCCCAGAGGCCAGTAGGTTCCTGCCCATTTTCCTCTCTGGCTTCCTGCCAAGAATTATGGCAGCTGAGGATGAATGGAGA
AGTAAAAACAACTAACACCGCACAACTAACAACTAACACCGCAGTTCCCACCTGGGTTCCACTTAGCAGGAGACATTTCGGAGGGTTTTT
TTTGTTTTTGTTCCTGTTTTTTTTTTTTTTGCTGGAATTTGTTTTCTCAGTACTGAAAAGAGAAAAAGTGACAATCTTGTATTTTTAAAA
GCCTCGGAAAGGTGATACCATCTGACAGTCATTTTCTCACGTTGGTCTTCTAAAGTCACCTATTTCTTGTGTGTGCACATCACACCATTT
CCTGTTTCTTTATAACCCGACAAGGGTAGGAGTGCCTGTTTCCCCTGCTGGGCACACCAGACAATCGTAATCACAAAACAGACACTGAGC
CAGGGGCCCAAAGGGTGTGATCATGAGAGTTACCGGGACAGCAGTAGGCATGACAGTCACCAGGAAGGACAAGGGTGCTCTGTTGTTAGT
GGCCACACACCAATTTGACAAGGAGTGTTGCGAAATTTTTATTTATTTATTTATTTATTTTGAGATGGAGTTTCACTCTTGTTGCCCAGG
CTGGAGTGCGGTGGTACAATCTCGGCTCACTGCAACCTCCACCTCCCAGGTTCAAGCGATTCTCCTGCCTCAGCCTCCCAAGTACCTGGG
ACTACAGGTGCGTGCCACCACACCCAGCTAAATTTTGTGTTTTTAGTAGAGATGGGGTTTCACCATGTTGGCCAGGATGGTCTTGAACCC
CTGACCTCATGATCTGCCTGCCTCGGCCTCCCAAAGTGCTGGGATTACAGGCATGAGCCACCACGCCCAGCCAAAATATTTTTTTAAAGT
CATTTTCCTTAAGCTGCTTGGGCTACATGTGAAATACACTGGACGGTCAACATTCCTGTCTCCTCCCATTTGGGCTGATGCAGCAGATCC
AGGGAATGTTACCTGTTTCTGCTGCTAGAAGATCCAGGAAATTGGGAAGGTTACCTGACGCACACATGGATGAAGGCCATCATCTAGAAA
TGGGGTCAACCACAATTGTGTTAATTCCGTAGTGTCAGGGATTCTTCGGGAAGGTCAACAGTATGAAGGATTCTGACCCCTGTGCCTCCC
ATTTATGTGATCAGGTGACAGTTAATAACCGTGGAGGTCACACTCAGCCATCCAACAGCCTTACAGTGACCCTACACAAAAGCCCCCAAA
TTCCAAAGACTTTTTCTTAACCTAAAGGAAGAAATTATTTGTTAATTCCAGTAGAGCAACTGAATATACTGGGCTATTTGTACTTTTTTA
TAGAGAACTTTAATAATAATTCTTTAAAAATGAGTTTTTAGAACAAAGCAACTGACGATTTCCTAAGATTCCAATGCCCTGGAGCTTGTA
GGAGGACTTAGCCTGGGTCAGCTGGAGCACCCCCGACCTGATCTCCCACTGCCAGATTTTCCCATGCTCCTAGGGTATGGAGTCCACGTG
GGAATGACTGCAAGTTCAGGTGGAACTTGGCCGACTGATGCTCTGCGAGTTTTTAATAGACACTGGGGACAACTGCTTAAGGTTTAGAAA
CTTCCAAACCACAGGAAAGACATTTTTAGTGTCCCCCATCCAGAGGCAGCCCTGGAATAGGATTCCCAGGGGTTTCTGGGACCCCTTTCC
TTGCTCCGTGAGGCTCTGTGGCCATCTTTTGGCAGGAGGAGGATGCTTCCTTGGCTCTGTGCCCAGACCCGCCTGGTCCCCAGGTCTCTC
ACCTTGGGTGAAGATTCAGAGATGCCCTGTAAGGATTTTGCCCACTGGGCAACTCAGAAATACTTCGATCTCCCAAGATATAAGAGGCAG
CAGCAAACGTGCCTATTGACGTCTGTTTCATAGTTACCACTTACGCGAGTAGACAGAACTCGGCTTTTCAGAAAATAGGTGTCAAGTCCA
CTTTATAAGAACCTTTTTTTCTAAAATAAGATAAAAGGTGGCTTTGCATTTTCTGATTAAACGACTGTGTCTTTGTCACCTCTGCTTAAC
TTTAGGAGTATCCATTCCTGTGATTGTAGACTTTTGTTGATATTCTTCCTGGAAGAATATCATTCTTTTCTTGAAGGGTTGGTTTACTAG
AATATTCAAAATCAATCATGAAGGCAGTTACTATTTTGAGTCTAAAGGTTTTCTAAAAATTAACCTCACATCCCTTCTGTTAGGGTCTTT
CAGAATATCTTTTATAAACAGAAGCATTTGAAGTCATTGCTTTTGCTACATGATTTGTGTGTGTGAAGGACATACCACGTTTAAATCATT
AATTGAAAAACATCATATAAGCCCCAACTTTGTTTGGAGGAAGAGACGGAGGTTGAGGTTTTTCCTTCTGTATAAGCACCTACTGACAAA
ATGTAGAGGCCATTCAACCGTCAAACACCATTTGGTTATATCGCAGAGGAGACGGATGTGTAAATTACTGCATTGCTTTTTTTTTCAGTT
TGTATAACCTCTAATCTCCGTTTGCATGATACGCTTTGTTAGAAACATTAATTGTAGTTTGGAAGCAAGTGTGTATGAATAAAGATAATG


Top

FusionGenePPI for IGF2BP3_PRKCA


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
IGF2BP3PUF60, CNBP, HNRNPA1, MEPCE, KHDRBS2, UBC, ELAVL1, SIRT7, CUL3, CDK2, COPS5, CAND1, RAE1, DDX5, LAPTM4A, LGMN, HNRNPUL2, USP16, NDUFAF4, MYC, FN1, CBX6, CBX8, HDAC11, FBXO6, CRYZ, HNRNPA2B1, HNRNPM, HNRNPU, IARS, ABCF1, C14orf166, RTCB, NELFB, YBX3, DDX1, DHX9, DIMT1, EDC4, EIF2B2, EIF2B3, EPRS, FKBP3, FLII, ILF2, MAP2, NMT1, QARS, RFC4, RPL26L1, RPL38, KRT17, MRE11A, PA2G4, RPL23A, WWOX, EIF2AK2, LIN28A, STAU1, MDM2, AURKA, TP53, TUBGCP3, MEOX2, PIH1D2, MOV10, CUL7, OBSL1, CCDC8, NTRK1, G3BP2, IGF2BP1, PDCD6, RPL6, RAB2A, RPL37A, MED20, NPM1, ZNF746, SH3BGR, ELAVL2, GSPT2, MRPS34, HIST1H1E, APOBEC3D, PPAN, RBM3, TRIM25, G3BP1, BRCA1PRKCAATP1A1, HABP4, HAND1, HAND2, FSCN1, EGFR, SLC1A1, PLD1, KLF5, GABRB3, MGMT, PLD2, PICK1, GRM7, AKAP12, GJA1, YWHAG, C1QBP, AVPR1A, AVPR1B, GSK3B, RGS2, OGG1, YWHAZ, TIAM1, GNB2L1, ITGB1, AFAP1, EZR, DLG4, LMNB1, LMNA, CD53, CD9, TRIM41, HMGA1, HMGA2, TNP1, TNP2, HIST1H3A, CHUK, IKBKB, NFE2L2, PRKCA, MTOR, TRPV6, AKAP5, DDX58, HIST1H1A, HIST1H1B, HIST1H1C, HIST1H1D, HIST1H1E, HIST1H1T, EIF4EBP1, MBP, HDAC6, CTNNB1, NR1H2, ELAVL1, HIST3H3, ANXA6, LNX1, LNX2, GLI3, IBTK, SCRIB, CBL, TOP2A, RICTOR, MAPKAP1, SELL, PFKFB1, NCF1, ACIN1, DSP, RALBP1, PPP1R14A, PLCG2, VTN, SDC2, ITGB2, HSP90AA1, GSK3A, GRIN1, GRIN2B, CASR, RRAD, NFKBIA, HMGN1, HMGN2, NPM1, NUMB, FBXO25, CDKN2A, PSMB4, SACM1L, PTGIR, TBXA2R, CYP3A4, RBCK1, RNF31, MOV10, NXF1, EP300, PPARG, CCDC8, EIF2S1, SLC25A41, SLC25A11, TAS2R7, TMEM185A, JSRP1, CCNL2, VPS4B, UQCRB, WWC2, WWC3, WWC1, MAPK7, NTRK1, NOXA1, GRM5, AKAP13, STXBP1, SPAG1, BTG2, CACYBP, SLC9A3R1, SLC9A3R2, KIF2A, KIF11, FAS, NF2, PLA2G4A, SMURF1, PRKCB, PRKCG, PRKCH, PIP5K1A, SHCBP1, GCLM, STARD7, CYP2S1, FGD4, DUSP11, FBXO21, HR, PPM1A, ATM, TES


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for IGF2BP3_PRKCA


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
TgenePRKCAP17252DB00675TamoxifenProtein kinase C alpha typesmall moleculeapproved
TgenePRKCAP17252DB05013Ingenol MebutateProtein kinase C alpha typesmall moleculeapproved

Top

RelatedDiseases for IGF2BP3_PRKCA


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneIGF2BP3C0023893Liver Cirrhosis, Experimental1CTD_human
HgeneIGF2BP3C0031149Peritoneal Neoplasms1CTD_human
HgeneIGF2BP3C0345967Malignant mesothelioma1CTD_human
TgenePRKCAC0036341Schizophrenia2PSYGENET
TgenePRKCAC0011853Diabetes Mellitus, Experimental1CTD_human
TgenePRKCAC0018800Cardiomegaly1CTD_human
TgenePRKCAC0021841Intestinal Neoplasms1CTD_human
TgenePRKCAC0032617Polyuria1CTD_human
TgenePRKCAC0033975Psychotic Disorders1PSYGENET
TgenePRKCAC0036337Schizoaffective Disorder1PSYGENET
TgenePRKCAC0162283Nephrogenic Diabetes Insipidus1CTD_human
TgenePRKCAC0349204Nonorganic psychosis1PSYGENET