FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 1710

FusionGeneSummary for ANKHD1_PAIP2

check button Fusion gene summary
Fusion gene informationFusion gene name: ANKHD1_PAIP2
Fusion gene ID: 1710
HgeneTgene
Gene symbol

ANKHD1

PAIP2

Gene ID

54882

51247

Gene nameankyrin repeat and KH domain containing 1poly(A) binding protein interacting protein 2
SynonymsMASK|MASK1|PP2500|VBARPPAIP-2|PAIP2A
Cytomap

5q31.3

5q31.2

Type of geneprotein-codingprotein-coding
Descriptionankyrin repeat and KH domain-containing protein 1HIV-1 Vpr-binding ankyrin repeat proteinmultiple ankyrin repeats, single KH-domain homologpolyadenylate-binding protein-interacting protein 2PABC1-interacting protein 2PABP-interacting protein 2polyA-binding protein-interacting protein 2
Modification date2018052320180519
UniProtAcc

Q8IWZ3

Q9BPZ3

Ensembl transtripts involved in fusion geneENST00000360839, ENST00000297183, 
ENST00000394723, ENST00000394722, 
ENST00000462121, ENST00000544120, 
ENST00000265192, ENST00000511381, 
ENST00000511706, ENST00000394795, 
ENST00000510080, 
Fusion gene scores* DoF score18 X 11 X 5=9907 X 5 X 5=175
# samples 127
** MAII scorelog2(12/990*10)=-3.04439411935845
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(7/175*10)=-1.32192809488736
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: ANKHD1 [Title/Abstract] AND PAIP2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgenePAIP2

GO:0045947

negative regulation of translational initiation

11172725


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSTADTCGA-BR-4357-01AANKHD1chr5

139865317

+PAIP2chr5

138704422

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000360839ENST00000265192ANKHD1chr5

139865317

+PAIP2chr5

138704422

+
5CDS-3UTRENST00000360839ENST00000511381ANKHD1chr5

139865317

+PAIP2chr5

138704422

+
5CDS-3UTRENST00000360839ENST00000511706ANKHD1chr5

139865317

+PAIP2chr5

138704422

+
5CDS-3UTRENST00000360839ENST00000394795ANKHD1chr5

139865317

+PAIP2chr5

138704422

+
5CDS-3UTRENST00000360839ENST00000510080ANKHD1chr5

139865317

+PAIP2chr5

138704422

+
In-frameENST00000297183ENST00000265192ANKHD1chr5

139865317

+PAIP2chr5

138704422

+
5CDS-3UTRENST00000297183ENST00000511381ANKHD1chr5

139865317

+PAIP2chr5

138704422

+
5CDS-3UTRENST00000297183ENST00000511706ANKHD1chr5

139865317

+PAIP2chr5

138704422

+
5CDS-3UTRENST00000297183ENST00000394795ANKHD1chr5

139865317

+PAIP2chr5

138704422

+
5CDS-3UTRENST00000297183ENST00000510080ANKHD1chr5

139865317

+PAIP2chr5

138704422

+
intron-3CDSENST00000394723ENST00000265192ANKHD1chr5

139865317

+PAIP2chr5

138704422

+
intron-3UTRENST00000394723ENST00000511381ANKHD1chr5

139865317

+PAIP2chr5

138704422

+
intron-3UTRENST00000394723ENST00000511706ANKHD1chr5

139865317

+PAIP2chr5

138704422

+
intron-3UTRENST00000394723ENST00000394795ANKHD1chr5

139865317

+PAIP2chr5

138704422

+
intron-3UTRENST00000394723ENST00000510080ANKHD1chr5

139865317

+PAIP2chr5

138704422

+
intron-3CDSENST00000394722ENST00000265192ANKHD1chr5

139865317

+PAIP2chr5

138704422

+
intron-3UTRENST00000394722ENST00000511381ANKHD1chr5

139865317

+PAIP2chr5

138704422

+
intron-3UTRENST00000394722ENST00000511706ANKHD1chr5

139865317

+PAIP2chr5

138704422

+
intron-3UTRENST00000394722ENST00000394795ANKHD1chr5

139865317

+PAIP2chr5

138704422

+
intron-3UTRENST00000394722ENST00000510080ANKHD1chr5

139865317

+PAIP2chr5

138704422

+
intron-3CDSENST00000462121ENST00000265192ANKHD1chr5

139865317

+PAIP2chr5

138704422

+
intron-3UTRENST00000462121ENST00000511381ANKHD1chr5

139865317

+PAIP2chr5

138704422

+
intron-3UTRENST00000462121ENST00000511706ANKHD1chr5

139865317

+PAIP2chr5

138704422

+
intron-3UTRENST00000462121ENST00000394795ANKHD1chr5

139865317

+PAIP2chr5

138704422

+
intron-3UTRENST00000462121ENST00000510080ANKHD1chr5

139865317

+PAIP2chr5

138704422

+
intron-3CDSENST00000544120ENST00000265192ANKHD1chr5

139865317

+PAIP2chr5

138704422

+
intron-3UTRENST00000544120ENST00000511381ANKHD1chr5

139865317

+PAIP2chr5

138704422

+
intron-3UTRENST00000544120ENST00000511706ANKHD1chr5

139865317

+PAIP2chr5

138704422

+
intron-3UTRENST00000544120ENST00000394795ANKHD1chr5

139865317

+PAIP2chr5

138704422

+
intron-3UTRENST00000544120ENST00000510080ANKHD1chr5

139865317

+PAIP2chr5

138704422

+

Top

FusionProtFeatures for ANKHD1_PAIP2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ANKHD1

Q8IWZ3

PAIP2

Q9BPZ3

Acts as a repressor in the regulation of translationinitiation of poly(A)-containing mRNAs. Its inhibitory activity ontranslation is mediated via its action on PABPC1. Displaces theinteraction of PABPC1 with poly(A) RNA and competes with PAIP1 forbinding to PABPC1. Its association with PABPC1 results indisruption of the cytoplasmic poly(A) RNP structure organization.{ECO:0000269|PubMed:11172725}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneANKHD1chr5:139865317chr5:138704422ENST00000297183+13366_947142618Compositional biasNote=Gly-rich
HgeneANKHD1chr5:139865317chr5:138704422ENST00000360839+13346_947142543Compositional biasNote=Gly-rich
HgeneANKHD1chr5:139865317chr5:138704422ENST00000297183+1336204_2337142618RepeatNote=ANK 1
HgeneANKHD1chr5:139865317chr5:138704422ENST00000297183+1336237_2667142618RepeatNote=ANK 2
HgeneANKHD1chr5:139865317chr5:138704422ENST00000297183+1336271_3007142618RepeatNote=ANK 3
HgeneANKHD1chr5:139865317chr5:138704422ENST00000297183+1336304_3337142618RepeatNote=ANK 4
HgeneANKHD1chr5:139865317chr5:138704422ENST00000297183+1336337_3667142618RepeatNote=ANK 5
HgeneANKHD1chr5:139865317chr5:138704422ENST00000297183+1336371_4007142618RepeatNote=ANK 6
HgeneANKHD1chr5:139865317chr5:138704422ENST00000297183+1336404_4337142618RepeatNote=ANK 7
HgeneANKHD1chr5:139865317chr5:138704422ENST00000297183+1336437_4667142618RepeatNote=ANK 8
HgeneANKHD1chr5:139865317chr5:138704422ENST00000297183+1336470_4997142618RepeatNote=ANK 9
HgeneANKHD1chr5:139865317chr5:138704422ENST00000297183+1336504_5337142618RepeatNote=ANK 10
HgeneANKHD1chr5:139865317chr5:138704422ENST00000297183+1336534_5637142618RepeatNote=ANK 11
HgeneANKHD1chr5:139865317chr5:138704422ENST00000297183+1336567_5967142618RepeatNote=ANK 12
HgeneANKHD1chr5:139865317chr5:138704422ENST00000297183+1336600_6297142618RepeatNote=ANK 13
HgeneANKHD1chr5:139865317chr5:138704422ENST00000297183+1336634_6637142618RepeatNote=ANK 14
HgeneANKHD1chr5:139865317chr5:138704422ENST00000297183+1336667_6967142618RepeatNote=ANK 15
HgeneANKHD1chr5:139865317chr5:138704422ENST00000360839+1334204_2337142543RepeatNote=ANK 1
HgeneANKHD1chr5:139865317chr5:138704422ENST00000360839+1334237_2667142543RepeatNote=ANK 2
HgeneANKHD1chr5:139865317chr5:138704422ENST00000360839+1334271_3007142543RepeatNote=ANK 3
HgeneANKHD1chr5:139865317chr5:138704422ENST00000360839+1334304_3337142543RepeatNote=ANK 4
HgeneANKHD1chr5:139865317chr5:138704422ENST00000360839+1334337_3667142543RepeatNote=ANK 5
HgeneANKHD1chr5:139865317chr5:138704422ENST00000360839+1334371_4007142543RepeatNote=ANK 6
HgeneANKHD1chr5:139865317chr5:138704422ENST00000360839+1334404_4337142543RepeatNote=ANK 7
HgeneANKHD1chr5:139865317chr5:138704422ENST00000360839+1334437_4667142543RepeatNote=ANK 8
HgeneANKHD1chr5:139865317chr5:138704422ENST00000360839+1334470_4997142543RepeatNote=ANK 9
HgeneANKHD1chr5:139865317chr5:138704422ENST00000360839+1334504_5337142543RepeatNote=ANK 10
HgeneANKHD1chr5:139865317chr5:138704422ENST00000360839+1334534_5637142543RepeatNote=ANK 11
HgeneANKHD1chr5:139865317chr5:138704422ENST00000360839+1334567_5967142543RepeatNote=ANK 12
HgeneANKHD1chr5:139865317chr5:138704422ENST00000360839+1334600_6297142543RepeatNote=ANK 13
HgeneANKHD1chr5:139865317chr5:138704422ENST00000360839+1334634_6637142543RepeatNote=ANK 14
HgeneANKHD1chr5:139865317chr5:138704422ENST00000360839+1334667_6967142543RepeatNote=ANK 15
TgenePAIP2chr5:139865317chr5:138704422ENST00000265192+24105_120106128RegionNote=PABPC1-interacting motif-2 (PAM2)
TgenePAIP2chr5:139865317chr5:138704422ENST00000394795+24105_120106128RegionNote=PABPC1-interacting motif-2 (PAM2)
TgenePAIP2chr5:139865317chr5:138704422ENST00000510080+24105_120106128RegionNote=PABPC1-interacting motif-2 (PAM2)

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneANKHD1chr5:139865317chr5:138704422ENST00000297183+13361415_14857142618Coiled coilOntology_term=ECO:0000255
HgeneANKHD1chr5:139865317chr5:138704422ENST00000297183+1336775_8527142618Coiled coilOntology_term=ECO:0000255
HgeneANKHD1chr5:139865317chr5:138704422ENST00000360839+13341415_14857142543Coiled coilOntology_term=ECO:0000255
HgeneANKHD1chr5:139865317chr5:138704422ENST00000360839+1334775_8527142543Coiled coilOntology_term=ECO:0000255
HgeneANKHD1chr5:139865317chr5:138704422ENST00000394722+1111415_1485-16617Coiled coilOntology_term=ECO:0000255
HgeneANKHD1chr5:139865317chr5:138704422ENST00000394722+111775_852-16617Coiled coilOntology_term=ECO:0000255
HgeneANKHD1chr5:139865317chr5:138704422ENST00000394723+1111415_1485-38628Coiled coilOntology_term=ECO:0000255
HgeneANKHD1chr5:139865317chr5:138704422ENST00000394723+111775_852-38628Coiled coilOntology_term=ECO:0000255
HgeneANKHD1chr5:139865317chr5:138704422ENST00000297183+13361977_21007142618Compositional biasNote=Ser-rich
HgeneANKHD1chr5:139865317chr5:138704422ENST00000297183+13362291_22997142618Compositional biasNote=Poly-Ser
HgeneANKHD1chr5:139865317chr5:138704422ENST00000360839+13341977_21007142543Compositional biasNote=Ser-rich
HgeneANKHD1chr5:139865317chr5:138704422ENST00000360839+13342291_22997142543Compositional biasNote=Poly-Ser
HgeneANKHD1chr5:139865317chr5:138704422ENST00000394722+1111977_2100-16617Compositional biasNote=Ser-rich
HgeneANKHD1chr5:139865317chr5:138704422ENST00000394722+1112291_2299-16617Compositional biasNote=Poly-Ser
HgeneANKHD1chr5:139865317chr5:138704422ENST00000394722+1116_94-16617Compositional biasNote=Gly-rich
HgeneANKHD1chr5:139865317chr5:138704422ENST00000394723+1111977_2100-38628Compositional biasNote=Ser-rich
HgeneANKHD1chr5:139865317chr5:138704422ENST00000394723+1112291_2299-38628Compositional biasNote=Poly-Ser
HgeneANKHD1chr5:139865317chr5:138704422ENST00000394723+1116_94-38628Compositional biasNote=Gly-rich
HgeneANKHD1chr5:139865317chr5:138704422ENST00000297183+13361695_17597142618DomainKH
HgeneANKHD1chr5:139865317chr5:138704422ENST00000360839+13341695_17597142543DomainKH
HgeneANKHD1chr5:139865317chr5:138704422ENST00000394722+1111695_1759-16617DomainKH
HgeneANKHD1chr5:139865317chr5:138704422ENST00000394723+1111695_1759-38628DomainKH
HgeneANKHD1chr5:139865317chr5:138704422ENST00000297183+13361054_10837142618RepeatNote=ANK 16
HgeneANKHD1chr5:139865317chr5:138704422ENST00000297183+13361087_11167142618RepeatNote=ANK 17
HgeneANKHD1chr5:139865317chr5:138704422ENST00000297183+13361121_11507142618RepeatNote=ANK 18
HgeneANKHD1chr5:139865317chr5:138704422ENST00000297183+13361154_11837142618RepeatNote=ANK 19
HgeneANKHD1chr5:139865317chr5:138704422ENST00000297183+13361189_12187142618RepeatNote=ANK 20
HgeneANKHD1chr5:139865317chr5:138704422ENST00000297183+13361223_12527142618RepeatNote=ANK 21
HgeneANKHD1chr5:139865317chr5:138704422ENST00000297183+13361256_12857142618RepeatNote=ANK 22
HgeneANKHD1chr5:139865317chr5:138704422ENST00000297183+13361291_13207142618RepeatNote=ANK 23
HgeneANKHD1chr5:139865317chr5:138704422ENST00000297183+13361324_13537142618RepeatNote=ANK 24
HgeneANKHD1chr5:139865317chr5:138704422ENST00000297183+13361357_13867142618RepeatNote=ANK 25
HgeneANKHD1chr5:139865317chr5:138704422ENST00000360839+13341054_10837142543RepeatNote=ANK 16
HgeneANKHD1chr5:139865317chr5:138704422ENST00000360839+13341087_11167142543RepeatNote=ANK 17
HgeneANKHD1chr5:139865317chr5:138704422ENST00000360839+13341121_11507142543RepeatNote=ANK 18
HgeneANKHD1chr5:139865317chr5:138704422ENST00000360839+13341154_11837142543RepeatNote=ANK 19
HgeneANKHD1chr5:139865317chr5:138704422ENST00000360839+13341189_12187142543RepeatNote=ANK 20
HgeneANKHD1chr5:139865317chr5:138704422ENST00000360839+13341223_12527142543RepeatNote=ANK 21
HgeneANKHD1chr5:139865317chr5:138704422ENST00000360839+13341256_12857142543RepeatNote=ANK 22
HgeneANKHD1chr5:139865317chr5:138704422ENST00000360839+13341291_13207142543RepeatNote=ANK 23
HgeneANKHD1chr5:139865317chr5:138704422ENST00000360839+13341324_13537142543RepeatNote=ANK 24
HgeneANKHD1chr5:139865317chr5:138704422ENST00000360839+13341357_13867142543RepeatNote=ANK 25
HgeneANKHD1chr5:139865317chr5:138704422ENST00000394722+1111054_1083-16617RepeatNote=ANK 16
HgeneANKHD1chr5:139865317chr5:138704422ENST00000394722+1111087_1116-16617RepeatNote=ANK 17
HgeneANKHD1chr5:139865317chr5:138704422ENST00000394722+1111121_1150-16617RepeatNote=ANK 18
HgeneANKHD1chr5:139865317chr5:138704422ENST00000394722+1111154_1183-16617RepeatNote=ANK 19
HgeneANKHD1chr5:139865317chr5:138704422ENST00000394722+1111189_1218-16617RepeatNote=ANK 20
HgeneANKHD1chr5:139865317chr5:138704422ENST00000394722+1111223_1252-16617RepeatNote=ANK 21
HgeneANKHD1chr5:139865317chr5:138704422ENST00000394722+1111256_1285-16617RepeatNote=ANK 22
HgeneANKHD1chr5:139865317chr5:138704422ENST00000394722+1111291_1320-16617RepeatNote=ANK 23
HgeneANKHD1chr5:139865317chr5:138704422ENST00000394722+1111324_1353-16617RepeatNote=ANK 24
HgeneANKHD1chr5:139865317chr5:138704422ENST00000394722+1111357_1386-16617RepeatNote=ANK 25
HgeneANKHD1chr5:139865317chr5:138704422ENST00000394722+111204_233-16617RepeatNote=ANK 1
HgeneANKHD1chr5:139865317chr5:138704422ENST00000394722+111237_266-16617RepeatNote=ANK 2
HgeneANKHD1chr5:139865317chr5:138704422ENST00000394722+111271_300-16617RepeatNote=ANK 3
HgeneANKHD1chr5:139865317chr5:138704422ENST00000394722+111304_333-16617RepeatNote=ANK 4
HgeneANKHD1chr5:139865317chr5:138704422ENST00000394722+111337_366-16617RepeatNote=ANK 5
HgeneANKHD1chr5:139865317chr5:138704422ENST00000394722+111371_400-16617RepeatNote=ANK 6
HgeneANKHD1chr5:139865317chr5:138704422ENST00000394722+111404_433-16617RepeatNote=ANK 7
HgeneANKHD1chr5:139865317chr5:138704422ENST00000394722+111437_466-16617RepeatNote=ANK 8
HgeneANKHD1chr5:139865317chr5:138704422ENST00000394722+111470_499-16617RepeatNote=ANK 9
HgeneANKHD1chr5:139865317chr5:138704422ENST00000394722+111504_533-16617RepeatNote=ANK 10
HgeneANKHD1chr5:139865317chr5:138704422ENST00000394722+111534_563-16617RepeatNote=ANK 11
HgeneANKHD1chr5:139865317chr5:138704422ENST00000394722+111567_596-16617RepeatNote=ANK 12
HgeneANKHD1chr5:139865317chr5:138704422ENST00000394722+111600_629-16617RepeatNote=ANK 13
HgeneANKHD1chr5:139865317chr5:138704422ENST00000394722+111634_663-16617RepeatNote=ANK 14
HgeneANKHD1chr5:139865317chr5:138704422ENST00000394722+111667_696-16617RepeatNote=ANK 15
HgeneANKHD1chr5:139865317chr5:138704422ENST00000394723+1111054_1083-38628RepeatNote=ANK 16
HgeneANKHD1chr5:139865317chr5:138704422ENST00000394723+1111087_1116-38628RepeatNote=ANK 17
HgeneANKHD1chr5:139865317chr5:138704422ENST00000394723+1111121_1150-38628RepeatNote=ANK 18
HgeneANKHD1chr5:139865317chr5:138704422ENST00000394723+1111154_1183-38628RepeatNote=ANK 19
HgeneANKHD1chr5:139865317chr5:138704422ENST00000394723+1111189_1218-38628RepeatNote=ANK 20
HgeneANKHD1chr5:139865317chr5:138704422ENST00000394723+1111223_1252-38628RepeatNote=ANK 21
HgeneANKHD1chr5:139865317chr5:138704422ENST00000394723+1111256_1285-38628RepeatNote=ANK 22
HgeneANKHD1chr5:139865317chr5:138704422ENST00000394723+1111291_1320-38628RepeatNote=ANK 23
HgeneANKHD1chr5:139865317chr5:138704422ENST00000394723+1111324_1353-38628RepeatNote=ANK 24
HgeneANKHD1chr5:139865317chr5:138704422ENST00000394723+1111357_1386-38628RepeatNote=ANK 25
HgeneANKHD1chr5:139865317chr5:138704422ENST00000394723+111204_233-38628RepeatNote=ANK 1
HgeneANKHD1chr5:139865317chr5:138704422ENST00000394723+111237_266-38628RepeatNote=ANK 2
HgeneANKHD1chr5:139865317chr5:138704422ENST00000394723+111271_300-38628RepeatNote=ANK 3
HgeneANKHD1chr5:139865317chr5:138704422ENST00000394723+111304_333-38628RepeatNote=ANK 4
HgeneANKHD1chr5:139865317chr5:138704422ENST00000394723+111337_366-38628RepeatNote=ANK 5
HgeneANKHD1chr5:139865317chr5:138704422ENST00000394723+111371_400-38628RepeatNote=ANK 6
HgeneANKHD1chr5:139865317chr5:138704422ENST00000394723+111404_433-38628RepeatNote=ANK 7
HgeneANKHD1chr5:139865317chr5:138704422ENST00000394723+111437_466-38628RepeatNote=ANK 8
HgeneANKHD1chr5:139865317chr5:138704422ENST00000394723+111470_499-38628RepeatNote=ANK 9
HgeneANKHD1chr5:139865317chr5:138704422ENST00000394723+111504_533-38628RepeatNote=ANK 10
HgeneANKHD1chr5:139865317chr5:138704422ENST00000394723+111534_563-38628RepeatNote=ANK 11
HgeneANKHD1chr5:139865317chr5:138704422ENST00000394723+111567_596-38628RepeatNote=ANK 12
HgeneANKHD1chr5:139865317chr5:138704422ENST00000394723+111600_629-38628RepeatNote=ANK 13
HgeneANKHD1chr5:139865317chr5:138704422ENST00000394723+111634_663-38628RepeatNote=ANK 14
HgeneANKHD1chr5:139865317chr5:138704422ENST00000394723+111667_696-38628RepeatNote=ANK 15
TgenePAIP2chr5:139865317chr5:138704422ENST00000265192+2433_72106128Compositional biasNote=Glu-rich
TgenePAIP2chr5:139865317chr5:138704422ENST00000394795+2433_72106128Compositional biasNote=Glu-rich
TgenePAIP2chr5:139865317chr5:138704422ENST00000510080+2433_72106128Compositional biasNote=Glu-rich
TgenePAIP2chr5:139865317chr5:138704422ENST00000265192+2422_75106128RegionNote=PABPC1-interacting motif-1 (PAM1)
TgenePAIP2chr5:139865317chr5:138704422ENST00000394795+2422_75106128RegionNote=PABPC1-interacting motif-1 (PAM1)
TgenePAIP2chr5:139865317chr5:138704422ENST00000510080+2422_75106128RegionNote=PABPC1-interacting motif-1 (PAM1)


Top

FusionGeneSequence for ANKHD1_PAIP2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ANKHD1_ENST00000360839_chr5_139865317_+_PAIP2_ENST00000265192_chr5_138704422_+_736aa
MLTDSGGGGTSFEEDLDSVAPRSAPAGASEPPPPGGVGLGIRTVRLFGEAGPASGVGSSGGGGSGSGTGGGDAALDFKLAAAVLRTGGGG
GASGSDEDEVSEVESFILDQEDLDNPVLKTTSEIFLSSTAEGADLRTVDPETQARLEALLEAAGIGKLSTADGKAFADPEVLRRLTSSVS
CALDEAAAALTRMKAENSHNAGQVDTRSLAEACSDGDVNAVRKLLDEGRSVNEHTEEGESLLCLACSAGTTELAQVLLAMHANVEDRGNK
GDITPLMAASSGGYLDIVKLLLLHDADVNSQSATGNTALTTACAGGFVDIVKVLLNEGANIEDHNENGHTPLMEAASAGHVEVARVLLDH
GAGINTHSNEFKESALTLACYKGHLDMVRFLLEAGADQEHKTDEMHTALMEACMDGHVEVARLLLDSGAQVNMPADSFESPLTLAACGGH
VELAALLIERGANLEEVNDEGYTPLMEAAREGHEEMVALLLAQGANINAQTEETQETALTLACCGGFSEVADFLIKAGADIELGCSTPLM
EASQEGHLELVKTLLASGANVHATTATGDTALTTACENGHTDVADVLLQAGADLEHESEGGRTPLMKAARAGHLCTVQFLISKGANVNRA
TANNDHTVVSLACAGGHLAVVELLLAHGADPTHRLKDGSTMLIEAAKGGHTNVVSTLLDTPNNVLSVPTTDVSQLPPPSQDQSQVKSNLN

>In-frame_ANKHD1_ENST00000297183_chr5_139865317_+_PAIP2_ENST00000265192_chr5_138704422_+_736aa
MLTDSGGGGTSFEEDLDSVAPRSAPAGASEPPPPGGVGLGIRTVRLFGEAGPASGVGSSGGGGSGSGTGGGDAALDFKLAAAVLRTGGGG
GASGSDEDEVSEVESFILDQEDLDNPVLKTTSEIFLSSTAEGADLRTVDPETQARLEALLEAAGIGKLSTADGKAFADPEVLRRLTSSVS
CALDEAAAALTRMKAENSHNAGQVDTRSLAEACSDGDVNAVRKLLDEGRSVNEHTEEGESLLCLACSAGTTELAQVLLAMHANVEDRGNK
GDITPLMAASSGGYLDIVKLLLLHDADVNSQSATGNTALTTACAGGFVDIVKVLLNEGANIEDHNENGHTPLMEAASAGHVEVARVLLDH
GAGINTHSNEFKESALTLACYKGHLDMVRFLLEAGADQEHKTDEMHTALMEACMDGHVEVARLLLDSGAQVNMPADSFESPLTLAACGGH
VELAALLIERGANLEEVNDEGYTPLMEAAREGHEEMVALLLAQGANINAQTEETQETALTLACCGGFSEVADFLIKAGADIELGCSTPLM
EASQEGHLELVKTLLASGANVHATTATGDTALTTACENGHTDVADVLLQAGADLEHESEGGRTPLMKAARAGHLCTVQFLISKGANVNRA
TANNDHTVVSLACAGGHLAVVELLLAHGADPTHRLKDGSTMLIEAAKGGHTNVVSTLLDTPNNVLSVPTTDVSQLPPPSQDQSQVKSNLN


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ANKHD1_ENST00000360839_chr5_139865317_+_PAIP2_ENST00000265192_chr5_138704422_+_2208nt
ATGCTGACTGATAGCGGAGGCGGCGGCACCTCCTTTGAGGAGGACCTGGACTCTGTGGCTCCGCGATCCGCCCCAGCTGGGGCCTCGGAG
CCGCCTCCGCCGGGAGGGGTCGGTCTGGGGATCCGCACCGTGAGGCTCTTTGGGGAGGCCGGGCCAGCGTCGGGAGTCGGCAGCAGCGGC
GGCGGCGGCAGCGGCAGCGGTACGGGCGGAGGGGACGCGGCGCTGGATTTCAAGTTGGCGGCTGCCGTGCTGAGGACCGGGGGTGGAGGT
GGTGCCTCTGGCAGTGACGAGGACGAAGTGTCCGAGGTTGAATCATTTATTTTGGACCAAGAAGATCTGGATAACCCAGTGCTTAAAACA
ACATCAGAGATATTCTTATCAAGTACTGCAGAAGGAGCAGACTTACGCACTGTGGATCCAGAGACACAGGCACGACTAGAAGCATTGCTA
GAAGCAGCAGGAATTGGCAAATTGTCAACTGCTGATGGTAAAGCTTTTGCAGATCCTGAGGTACTCCGGAGACTGACATCCTCAGTTAGT
TGTGCACTGGATGAAGCTGCTGCTGCACTGACACGGATGAAAGCAGAAAACAGCCACAATGCAGGACAAGTGGACACTCGCAGTCTAGCA
GAAGCTTGTTCAGATGGGGATGTTAATGCTGTTCGTAAATTGCTAGATGAAGGCAGAAGTGTAAATGAACATACAGAAGAAGGAGAAAGC
CTGCTGTGTTTGGCTTGTTCAGCAGGGTATTATGAATTAGCACAAGTATTGCTTGCTATGCATGCTAATGTTGAAGATCGAGGGAATAAA
GGAGACATAACTCCCCTGATGGCAGCTTCCAGTGGAGGTTACTTAGATATTGTGAAATTATTACTTCTTCATGATGCTGATGTCAACTCC
CAGTCTGCAACAGGAAACACTGCGCTAACTTATGCATGTGCTGGAGGATTTGTTGACATTGTTAAAGTGCTCCTTAATGAAGGTGCAAAT
ATAGAAGATCATAATGAAAATGGACATACTCCCTTAATGGAAGCAGCCAGTGCAGGTCATGTGGAAGTTGCAAGAGTTCTTTTAGATCAT
GGTGCAGGCATCAACACTCATTCTAATGAATTCAAAGAAAGTGCTCTAACACTTGCTTGCTACAAAGGCCATTTGGATATGGTTCGCTTT
CTACTTGAAGCTGGTGCAGATCAAGAGCACAAAACAGATGAGATGCACACTGCCTTAATGGAGGCCTGCATGGATGGACATGTAGAGGTG
GCACGTTTGCTTTTGGATAGTGGTGCTCAAGTGAACATGCCTGCAGATTCATTTGAATCTCCATTGACGCTAGCTGCCTGTGGAGGACAT
GTTGAATTGGCAGCTCTACTTATTGAAAGGGGAGCAAATCTTGAAGAAGTTAATGATGAAGGATACACTCCCTTGATGGAAGCTGCCCGG
GAAGGACATGAAGAAATGGTGGCACTACTCTTAGCACAAGGAGCAAATATAAATGCCCAGACAGAAGAAACTCAAGAAACTGCTCTTACT
TTGGCTTGCTGTGGAGGATTTTCTGAAGTTGCAGACTTTCTTATTAAGGCAGGGGCTGATATAGAACTTGGCTGCTCCACACCTCTGATG
GAGGCATCTCAGGAGGGACACCTGGAATTGGTTAAATATTTGCTGGCTTCTGGCGCTAATGTGCATGCTACAACAGCAACAGGAGACACA
GCCTTAACCTATGCTTGTGAAAATGGACATACGGATGTTGCAGATGTTTTACTTCAAGCAGGGGCTGATTTAGAACATGAATCTGAAGGT
GGAAGAACACCTTTGATGAAAGCTGCAAGAGCTGGTCATTTGTGCACTGTGCAGTTTCTTATTAGCAAAGGTGCCAATGTTAACAGGGCT
ACAGCCAATAATGATCATACAGTAGTGTCGCTGGCATGTGCAGGAGGCCACCTGGCAGTTGTTGAGCTTCTCTTGGCTCATGGGGCTGAC
CCTACTCATCGACTCAAGGATGGTTCAACAATGCTCATTGAAGCTGCAAAGGGTGGCCATACTAATGTAGTTTCTTATCTGTTGGATTAT
CCAAATAATGTTCTGTCAGTTCCCACCACAGATGTGTCTCAGCTCCCTCCACCTTCTCAAGATCAGTCTCAGGTCAAGAGCAATCTGAAT

>In-frame_ANKHD1_ENST00000297183_chr5_139865317_+_PAIP2_ENST00000265192_chr5_138704422_+_2208nt
ATGCTGACTGATAGCGGAGGCGGCGGCACCTCCTTTGAGGAGGACCTGGACTCTGTGGCTCCGCGATCCGCCCCAGCTGGGGCCTCGGAG
CCGCCTCCGCCGGGAGGGGTCGGTCTGGGGATCCGCACCGTGAGGCTCTTTGGGGAGGCCGGGCCAGCGTCGGGAGTCGGCAGCAGCGGC
GGCGGCGGCAGCGGCAGCGGTACGGGCGGAGGGGACGCGGCGCTGGATTTCAAGTTGGCGGCTGCCGTGCTGAGGACCGGGGGTGGAGGT
GGTGCCTCTGGCAGTGACGAGGACGAAGTGTCCGAGGTTGAATCATTTATTTTGGACCAAGAAGATCTGGATAACCCAGTGCTTAAAACA
ACATCAGAGATATTCTTATCAAGTACTGCAGAAGGAGCAGACTTACGCACTGTGGATCCAGAGACACAGGCACGACTAGAAGCATTGCTA
GAAGCAGCAGGAATTGGCAAATTGTCAACTGCTGATGGTAAAGCTTTTGCAGATCCTGAGGTACTCCGGAGACTGACATCCTCAGTTAGT
TGTGCACTGGATGAAGCTGCTGCTGCACTGACACGGATGAAAGCAGAAAACAGCCACAATGCAGGACAAGTGGACACTCGCAGTCTAGCA
GAAGCTTGTTCAGATGGGGATGTTAATGCTGTTCGTAAATTGCTAGATGAAGGCAGAAGTGTAAATGAACATACAGAAGAAGGAGAAAGC
CTGCTGTGTTTGGCTTGTTCAGCAGGGTATTATGAATTAGCACAAGTATTGCTTGCTATGCATGCTAATGTTGAAGATCGAGGGAATAAA
GGAGACATAACTCCCCTGATGGCAGCTTCCAGTGGAGGTTACTTAGATATTGTGAAATTATTACTTCTTCATGATGCTGATGTCAACTCC
CAGTCTGCAACAGGAAACACTGCGCTAACTTATGCATGTGCTGGAGGATTTGTTGACATTGTTAAAGTGCTCCTTAATGAAGGTGCAAAT
ATAGAAGATCATAATGAAAATGGACATACTCCCTTAATGGAAGCAGCCAGTGCAGGTCATGTGGAAGTTGCAAGAGTTCTTTTAGATCAT
GGTGCAGGCATCAACACTCATTCTAATGAATTCAAAGAAAGTGCTCTAACACTTGCTTGCTACAAAGGCCATTTGGATATGGTTCGCTTT
CTACTTGAAGCTGGTGCAGATCAAGAGCACAAAACAGATGAGATGCACACTGCCTTAATGGAGGCCTGCATGGATGGACATGTAGAGGTG
GCACGTTTGCTTTTGGATAGTGGTGCTCAAGTGAACATGCCTGCAGATTCATTTGAATCTCCATTGACGCTAGCTGCCTGTGGAGGACAT
GTTGAATTGGCAGCTCTACTTATTGAAAGGGGAGCAAATCTTGAAGAAGTTAATGATGAAGGATACACTCCCTTGATGGAAGCTGCCCGG
GAAGGACATGAAGAAATGGTGGCACTACTCTTAGCACAAGGAGCAAATATAAATGCCCAGACAGAAGAAACTCAAGAAACTGCTCTTACT
TTGGCTTGCTGTGGAGGATTTTCTGAAGTTGCAGACTTTCTTATTAAGGCAGGGGCTGATATAGAACTTGGCTGCTCCACACCTCTGATG
GAGGCATCTCAGGAGGGACACCTGGAATTGGTTAAATATTTGCTGGCTTCTGGCGCTAATGTGCATGCTACAACAGCAACAGGAGACACA
GCCTTAACCTATGCTTGTGAAAATGGACATACGGATGTTGCAGATGTTTTACTTCAAGCAGGGGCTGATTTAGAACATGAATCTGAAGGT
GGAAGAACACCTTTGATGAAAGCTGCAAGAGCTGGTCATTTGTGCACTGTGCAGTTTCTTATTAGCAAAGGTGCCAATGTTAACAGGGCT
ACAGCCAATAATGATCATACAGTAGTGTCGCTGGCATGTGCAGGAGGCCACCTGGCAGTTGTTGAGCTTCTCTTGGCTCATGGGGCTGAC
CCTACTCATCGACTCAAGGATGGTTCAACAATGCTCATTGAAGCTGCAAAGGGTGGCCATACTAATGTAGTTTCTTATCTGTTGGATTAT
CCAAATAATGTTCTGTCAGTTCCCACCACAGATGTGTCTCAGCTCCCTCCACCTTCTCAAGATCAGTCTCAGGTCAAGAGCAATCTGAAT


* Fusion transcript sequences (Full-length transcript).
>In-frame_ANKHD1_ENST00000360839_chr5_139865317_+_PAIP2_ENST00000265192_chr5_138704422_+_3262nt
GGGAGGCAGCAGGTTAGGCAGTGAGAAGTTAGTGGCGCTGCTGGGACGGGGGAAAGGAGACGCTTCTTCCTCTTGCTGCTCTTCTCGTTC
CCGAGATCAGCGGCGGCGGTGACCGCGAGTGGGTCGGCACCGTCTCCGGCTCCGGGTGCGAACAATGCTGACTGATAGCGGAGGCGGCGG
CACCTCCTTTGAGGAGGACCTGGACTCTGTGGCTCCGCGATCCGCCCCAGCTGGGGCCTCGGAGCCGCCTCCGCCGGGAGGGGTCGGTCT
GGGGATCCGCACCGTGAGGCTCTTTGGGGAGGCCGGGCCAGCGTCGGGAGTCGGCAGCAGCGGCGGCGGCGGCAGCGGCAGCGGTACGGG
CGGAGGGGACGCGGCGCTGGATTTCAAGTTGGCGGCTGCCGTGCTGAGGACCGGGGGTGGAGGTGGTGCCTCTGGCAGTGACGAGGACGA
AGTGTCCGAGGTTGAATCATTTATTTTGGACCAAGAAGATCTGGATAACCCAGTGCTTAAAACAACATCAGAGATATTCTTATCAAGTAC
TGCAGAAGGAGCAGACTTACGCACTGTGGATCCAGAGACACAGGCACGACTAGAAGCATTGCTAGAAGCAGCAGGAATTGGCAAATTGTC
AACTGCTGATGGTAAAGCTTTTGCAGATCCTGAGGTACTCCGGAGACTGACATCCTCAGTTAGTTGTGCACTGGATGAAGCTGCTGCTGC
ACTGACACGGATGAAAGCAGAAAACAGCCACAATGCAGGACAAGTGGACACTCGCAGTCTAGCAGAAGCTTGTTCAGATGGGGATGTTAA
TGCTGTTCGTAAATTGCTAGATGAAGGCAGAAGTGTAAATGAACATACAGAAGAAGGAGAAAGCCTGCTGTGTTTGGCTTGTTCAGCAGG
GTATTATGAATTAGCACAAGTATTGCTTGCTATGCATGCTAATGTTGAAGATCGAGGGAATAAAGGAGACATAACTCCCCTGATGGCAGC
TTCCAGTGGAGGTTACTTAGATATTGTGAAATTATTACTTCTTCATGATGCTGATGTCAACTCCCAGTCTGCAACAGGAAACACTGCGCT
AACTTATGCATGTGCTGGAGGATTTGTTGACATTGTTAAAGTGCTCCTTAATGAAGGTGCAAATATAGAAGATCATAATGAAAATGGACA
TACTCCCTTAATGGAAGCAGCCAGTGCAGGTCATGTGGAAGTTGCAAGAGTTCTTTTAGATCATGGTGCAGGCATCAACACTCATTCTAA
TGAATTCAAAGAAAGTGCTCTAACACTTGCTTGCTACAAAGGCCATTTGGATATGGTTCGCTTTCTACTTGAAGCTGGTGCAGATCAAGA
GCACAAAACAGATGAGATGCACACTGCCTTAATGGAGGCCTGCATGGATGGACATGTAGAGGTGGCACGTTTGCTTTTGGATAGTGGTGC
TCAAGTGAACATGCCTGCAGATTCATTTGAATCTCCATTGACGCTAGCTGCCTGTGGAGGACATGTTGAATTGGCAGCTCTACTTATTGA
AAGGGGAGCAAATCTTGAAGAAGTTAATGATGAAGGATACACTCCCTTGATGGAAGCTGCCCGGGAAGGACATGAAGAAATGGTGGCACT
ACTCTTAGCACAAGGAGCAAATATAAATGCCCAGACAGAAGAAACTCAAGAAACTGCTCTTACTTTGGCTTGCTGTGGAGGATTTTCTGA
AGTTGCAGACTTTCTTATTAAGGCAGGGGCTGATATAGAACTTGGCTGCTCCACACCTCTGATGGAGGCATCTCAGGAGGGACACCTGGA
ATTGGTTAAATATTTGCTGGCTTCTGGCGCTAATGTGCATGCTACAACAGCAACAGGAGACACAGCCTTAACCTATGCTTGTGAAAATGG
ACATACGGATGTTGCAGATGTTTTACTTCAAGCAGGGGCTGATTTAGAACATGAATCTGAAGGTGGAAGAACACCTTTGATGAAAGCTGC
AAGAGCTGGTCATTTGTGCACTGTGCAGTTTCTTATTAGCAAAGGTGCCAATGTTAACAGGGCTACAGCCAATAATGATCATACAGTAGT
GTCGCTGGCATGTGCAGGAGGCCACCTGGCAGTTGTTGAGCTTCTCTTGGCTCATGGGGCTGACCCTACTCATCGACTCAAGGATGGTTC
AACAATGCTCATTGAAGCTGCAAAGGGTGGCCATACTAATGTAGTTTCTTATCTGTTGGATTATCCAAATAATGTTCTGTCAGTTCCCAC
CACAGATGTGTCTCAGCTCCCTCCACCTTCTCAAGATCAGTCTCAGGTCAAGAGCAATCTGAATCCAAATGCAAAGGAGTTTGTTCCTGG
GGTGAAGTACGGAAATATTTGAGTAGACGGGGCCCTCTTTTGGTGGATGTAGCACAATTTCCACACTGTGAAGGCAGTATTAGAAGACTT
AATTGTAAAAGCTCTCTTGTCACTGTGTTACACTTATGCATTGCCAAAGTTTTTGTTAGTCTTGCATGCTTAATAAAAGTGCTGAGACTG
TTACTAAGTAAAAAGCTGTCAAACATTTACTGAAAATAGAATTGGCCCCATGGCTTGATGTGAAGACAGCAAGGAAAGAAGCACCAGTCA
AGTTGTGAACAAGCACCAAATTAAAAGACCTAAACCTTACCAAATTGTCTTTTTTTGAGGCTAATCTATCACTTGTTAATGTCTAAACTT
TAAAATCAGTACATTTAATTTGAGTTCCAACTGTTAAGCATATTTCTCAGACTTAAATTTGATTATGTCCCCATCAAAAAGAATCTCCAT
TTTCTGAAGGTCTGTTAGTTAATTTGAGATAATTTGTTAAAGGCAAGTATGTCATATTACTGAGGCTACAAGTTAGTCAGCAGATGAGTG
CCAGTCCAGCCTTTTCTGGTATGTTATTGTTAGAAATATTGAGTTCTAATGTTACATCTGAGGAAGTATGTAATTTGAGAATTGTAACTT
CTAAGGGATTCACTGCATCATAGCTATGCCTGTATGGAGTCTAACATATGACCAATACCAACCCATAATCCAGCTGAACAAAGATACTGT
AACATGATTTGAGTGGTGCTTTTCCTTGCTTTGTTAACCATCACGAGAGTCTGCAGCACAACTTTTAACAAAGCTAGAACAGTTTTGGCT
TCTTAAACTTCATATTTGGGTAGGTTAAGCTGCCATACGTGTTCAGTGTGAATAGTGTTTAAGTTGAAAATATTGTAAAAAAATTATATT

>In-frame_ANKHD1_ENST00000297183_chr5_139865317_+_PAIP2_ENST00000265192_chr5_138704422_+_3232nt
AGTGGCGCTGCTGGGACGGGGGAAAGGAGACGCTTCTTCCTCTTGCTGCTCTTCTCGTTCCCGAGATCAGCGGCGGCGGTGACCGCGAGT
GGGTCGGCACCGTCTCCGGCTCCGGGTGCGAACAATGCTGACTGATAGCGGAGGCGGCGGCACCTCCTTTGAGGAGGACCTGGACTCTGT
GGCTCCGCGATCCGCCCCAGCTGGGGCCTCGGAGCCGCCTCCGCCGGGAGGGGTCGGTCTGGGGATCCGCACCGTGAGGCTCTTTGGGGA
GGCCGGGCCAGCGTCGGGAGTCGGCAGCAGCGGCGGCGGCGGCAGCGGCAGCGGTACGGGCGGAGGGGACGCGGCGCTGGATTTCAAGTT
GGCGGCTGCCGTGCTGAGGACCGGGGGTGGAGGTGGTGCCTCTGGCAGTGACGAGGACGAAGTGTCCGAGGTTGAATCATTTATTTTGGA
CCAAGAAGATCTGGATAACCCAGTGCTTAAAACAACATCAGAGATATTCTTATCAAGTACTGCAGAAGGAGCAGACTTACGCACTGTGGA
TCCAGAGACACAGGCACGACTAGAAGCATTGCTAGAAGCAGCAGGAATTGGCAAATTGTCAACTGCTGATGGTAAAGCTTTTGCAGATCC
TGAGGTACTCCGGAGACTGACATCCTCAGTTAGTTGTGCACTGGATGAAGCTGCTGCTGCACTGACACGGATGAAAGCAGAAAACAGCCA
CAATGCAGGACAAGTGGACACTCGCAGTCTAGCAGAAGCTTGTTCAGATGGGGATGTTAATGCTGTTCGTAAATTGCTAGATGAAGGCAG
AAGTGTAAATGAACATACAGAAGAAGGAGAAAGCCTGCTGTGTTTGGCTTGTTCAGCAGGGTATTATGAATTAGCACAAGTATTGCTTGC
TATGCATGCTAATGTTGAAGATCGAGGGAATAAAGGAGACATAACTCCCCTGATGGCAGCTTCCAGTGGAGGTTACTTAGATATTGTGAA
ATTATTACTTCTTCATGATGCTGATGTCAACTCCCAGTCTGCAACAGGAAACACTGCGCTAACTTATGCATGTGCTGGAGGATTTGTTGA
CATTGTTAAAGTGCTCCTTAATGAAGGTGCAAATATAGAAGATCATAATGAAAATGGACATACTCCCTTAATGGAAGCAGCCAGTGCAGG
TCATGTGGAAGTTGCAAGAGTTCTTTTAGATCATGGTGCAGGCATCAACACTCATTCTAATGAATTCAAAGAAAGTGCTCTAACACTTGC
TTGCTACAAAGGCCATTTGGATATGGTTCGCTTTCTACTTGAAGCTGGTGCAGATCAAGAGCACAAAACAGATGAGATGCACACTGCCTT
AATGGAGGCCTGCATGGATGGACATGTAGAGGTGGCACGTTTGCTTTTGGATAGTGGTGCTCAAGTGAACATGCCTGCAGATTCATTTGA
ATCTCCATTGACGCTAGCTGCCTGTGGAGGACATGTTGAATTGGCAGCTCTACTTATTGAAAGGGGAGCAAATCTTGAAGAAGTTAATGA
TGAAGGATACACTCCCTTGATGGAAGCTGCCCGGGAAGGACATGAAGAAATGGTGGCACTACTCTTAGCACAAGGAGCAAATATAAATGC
CCAGACAGAAGAAACTCAAGAAACTGCTCTTACTTTGGCTTGCTGTGGAGGATTTTCTGAAGTTGCAGACTTTCTTATTAAGGCAGGGGC
TGATATAGAACTTGGCTGCTCCACACCTCTGATGGAGGCATCTCAGGAGGGACACCTGGAATTGGTTAAATATTTGCTGGCTTCTGGCGC
TAATGTGCATGCTACAACAGCAACAGGAGACACAGCCTTAACCTATGCTTGTGAAAATGGACATACGGATGTTGCAGATGTTTTACTTCA
AGCAGGGGCTGATTTAGAACATGAATCTGAAGGTGGAAGAACACCTTTGATGAAAGCTGCAAGAGCTGGTCATTTGTGCACTGTGCAGTT
TCTTATTAGCAAAGGTGCCAATGTTAACAGGGCTACAGCCAATAATGATCATACAGTAGTGTCGCTGGCATGTGCAGGAGGCCACCTGGC
AGTTGTTGAGCTTCTCTTGGCTCATGGGGCTGACCCTACTCATCGACTCAAGGATGGTTCAACAATGCTCATTGAAGCTGCAAAGGGTGG
CCATACTAATGTAGTTTCTTATCTGTTGGATTATCCAAATAATGTTCTGTCAGTTCCCACCACAGATGTGTCTCAGCTCCCTCCACCTTC
TCAAGATCAGTCTCAGGTCAAGAGCAATCTGAATCCAAATGCAAAGGAGTTTGTTCCTGGGGTGAAGTACGGAAATATTTGAGTAGACGG
GGCCCTCTTTTGGTGGATGTAGCACAATTTCCACACTGTGAAGGCAGTATTAGAAGACTTAATTGTAAAAGCTCTCTTGTCACTGTGTTA
CACTTATGCATTGCCAAAGTTTTTGTTAGTCTTGCATGCTTAATAAAAGTGCTGAGACTGTTACTAAGTAAAAAGCTGTCAAACATTTAC
TGAAAATAGAATTGGCCCCATGGCTTGATGTGAAGACAGCAAGGAAAGAAGCACCAGTCAAGTTGTGAACAAGCACCAAATTAAAAGACC
TAAACCTTACCAAATTGTCTTTTTTTGAGGCTAATCTATCACTTGTTAATGTCTAAACTTTAAAATCAGTACATTTAATTTGAGTTCCAA
CTGTTAAGCATATTTCTCAGACTTAAATTTGATTATGTCCCCATCAAAAAGAATCTCCATTTTCTGAAGGTCTGTTAGTTAATTTGAGAT
AATTTGTTAAAGGCAAGTATGTCATATTACTGAGGCTACAAGTTAGTCAGCAGATGAGTGCCAGTCCAGCCTTTTCTGGTATGTTATTGT
TAGAAATATTGAGTTCTAATGTTACATCTGAGGAAGTATGTAATTTGAGAATTGTAACTTCTAAGGGATTCACTGCATCATAGCTATGCC
TGTATGGAGTCTAACATATGACCAATACCAACCCATAATCCAGCTGAACAAAGATACTGTAACATGATTTGAGTGGTGCTTTTCCTTGCT
TTGTTAACCATCACGAGAGTCTGCAGCACAACTTTTAACAAAGCTAGAACAGTTTTGGCTTCTTAAACTTCATATTTGGGTAGGTTAAGC


Top

FusionGenePPI for ANKHD1_PAIP2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ANKHD1POLR2M, UNC93B1, SIRT7, CAND1, ATXN1, ATXN1L, VCP, NFKBIE, ZNF346, ADARB2, MOV10, NXF1, HOXC4, MAGEA1, ZC3H3, FOSL2, SFRP4, RBM23, SEC16A, CDT1, SKA3, FOS, FOXQ1, STX11, FGF8, TRIM41, FGF3, SIX2, HOXD4, IRF9, AKAP17A, ZNF263, ZNF433, IL17RA, H2AFX, NOB1, C6orf141, TULP3, CERKL, CDX1, TRIM25PAIP2PABPC1, UBR5, APP, IGBP1, BAG3, RPL11, NXF1, HNRNPA1, PAIP1, SCCPDH, XPO1, TRIM25


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ANKHD1_PAIP2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for ANKHD1_PAIP2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource