FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 16875

FusionGeneSummary for HSPA8_VSTM5

check button Fusion gene summary
Fusion gene informationFusion gene name: HSPA8_VSTM5
Fusion gene ID: 16875
HgeneTgene
Gene symbol

HSPA8

VSTM5

Gene ID

3312

387804

Gene nameheat shock protein family A (Hsp70) member 8V-set and transmembrane domain containing 5
SynonymsHEL-33|HEL-S-72p|HSC54|HSC70|HSC71|HSP71|HSP73|HSPA10|LAP-1|LAP1|NIP71C11orf90
Cytomap

11q24.1

11q21

Type of geneprotein-codingprotein-coding
Descriptionheat shock cognate 71 kDa proteinLPS-associated protein 1N-myristoyltransferase inhibitor protein 71constitutive heat shock protein 70epididymis luminal protein 33epididymis secretory sperm binding protein Li 72pheat shock 70kDa protein 8heat shockV-set and transmembrane domain-containing protein 5
Modification date2018052720180329
UniProtAcc

P11142

A8MXK1

Ensembl transtripts involved in fusion geneENST00000532636, ENST00000533540, 
ENST00000453788, ENST00000534624, 
ENST00000227378, ENST00000534319, 
ENST00000526110, ENST00000526862, 
ENST00000409977, 
Fusion gene scores* DoF score6 X 6 X 2=721 X 1 X 1=1
# samples 91
** MAII scorelog2(9/72*10)=0.321928094887362
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(1/1*10)=3.32192809488736
Context

PubMed: HSPA8 [Title/Abstract] AND VSTM5 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneHSPA8

GO:0042026

protein refolding

21231916|25719862

HgeneHSPA8

GO:0045892

negative regulation of transcription, DNA-templated

10722728

HgeneHSPA8

GO:0046034

ATP metabolic process

23921388

HgeneHSPA8

GO:1902904

negative regulation of supramolecular fiber organization

23921388


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDHNSCTCGA-KU-A6H7-01AHSPA8chr11

122931301

-VSTM5chr11

93554489

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shiftENST00000532636ENST00000409977HSPA8chr11

122931301

-VSTM5chr11

93554489

-
intron-3CDSENST00000533540ENST00000409977HSPA8chr11

122931301

-VSTM5chr11

93554489

-
In-frameENST00000453788ENST00000409977HSPA8chr11

122931301

-VSTM5chr11

93554489

-
In-frameENST00000534624ENST00000409977HSPA8chr11

122931301

-VSTM5chr11

93554489

-
Frame-shiftENST00000227378ENST00000409977HSPA8chr11

122931301

-VSTM5chr11

93554489

-
intron-3CDSENST00000534319ENST00000409977HSPA8chr11

122931301

-VSTM5chr11

93554489

-
Frame-shiftENST00000526110ENST00000409977HSPA8chr11

122931301

-VSTM5chr11

93554489

-
intron-3CDSENST00000526862ENST00000409977HSPA8chr11

122931301

-VSTM5chr11

93554489

-

Top

FusionProtFeatures for HSPA8_VSTM5


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
HSPA8

P11142

VSTM5

A8MXK1

Molecular chaperone implicated in a wide variety ofcellular processes, including protection of the proteome fromstress, folding and transport of newly synthesized polypeptides,activation of proteolysis of misfolded proteins and the formationand dissociation of protein complexes. Plays a pivotal role in theprotein quality control system, ensuring the correct folding ofproteins, the re-folding of misfolded proteins and controlling thetargeting of proteins for subsequent degradation (PubMed:21150129,PubMed:21148293, PubMed:24732912, PubMed:27916661,PubMed:23018488). This is achieved through cycles of ATP binding,ATP hydrolysis and ADP release, mediated by co-chaperones(PubMed:21150129, PubMed:21148293, PubMed:24732912,PubMed:27916661, PubMed:23018488). The co-chaperones have beenshown to not only regulate different steps of the ATPase cycle ofHSP70, but they also have an individual specificity such that oneco-chaperone may promote folding of a substrate while another maypromote degradation (PubMed:21150129, PubMed:21148293,PubMed:24732912, PubMed:27916661, PubMed:23018488). The affinityof HSP70 for polypeptides is regulated by its nucleotide boundstate. In the ATP-bound form, it has a low affinity for substrateproteins. However, upon hydrolysis of the ATP to ADP, it undergoesa conformational change that increases its affinity for substrateproteins. HSP70 goes through repeated cycles of ATP hydrolysis andnucleotide exchange, which permits cycles of substrate binding andrelease. The HSP70-associated co-chaperones are of three types: J-domain co-chaperones HSP40s (stimulate ATPase hydrolysis byHSP70), the nucleotide exchange factors (NEF) such as BAG1/2/3(facilitate conversion of HSP70 from the ADP-bound to the ATP-bound state thereby promoting substrate release), and the TPRdomain chaperones such as HOPX and STUB1 (PubMed:24318877,PubMed:27474739, PubMed:24121476, PubMed:26865365). Acts as arepressor of transcriptional activation. Inhibits thetranscriptional coactivator activity of CITED1 on Smad-mediatedtranscription. Component of the PRP19-CDC5L complex that forms anintegral part of the spliceosome and is required for activatingpre-mRNA splicing. May have a scaffolding role in the spliceosomeassembly as it contacts all other components of the core complex.Binds bacterial lipopolysaccharide (LPS) and mediates LPS-inducedinflammatory response, including TNF secretion by monocytes(PubMed:10722728, PubMed:11276205). Participates in the ER-associated degradation (ERAD) quality control pathway inconjunction with J domain-containing co-chaperones and the E3ligase STUB1 (PubMed:23990462). {ECO:0000269|PubMed:10722728,ECO:0000269|PubMed:11276205, ECO:0000269|PubMed:21148293,ECO:0000269|PubMed:21150129, ECO:0000269|PubMed:23018488,ECO:0000269|PubMed:23990462, ECO:0000269|PubMed:24318877,ECO:0000269|PubMed:24732912, ECO:0000269|PubMed:27474739,ECO:0000269|PubMed:27916661, ECO:0000303|PubMed:24121476,ECO:0000303|PubMed:26865365}. Cell adhesion-like membrane protein of the centralnervous system (CNS) which modulates both the position andcomplexity of central neurons by altering their membranemorphology and dynamics. Involved in the formation of neuronaldendrites and protrusions including dendritic filopodia. Insynaptogenesis, regulates synapse formation by altering dendriticspine morphology and actin distribution. Promotes formation ofunstable neuronal spines such as thin and branched types.Regulates neuronal morphogenesis and migration during corticaldevelopment in the brain. {ECO:0000250|UniProtKB:Q9D806}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for HSPA8_VSTM5


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_HSPA8_ENST00000453788_chr11_122931301_-_VSTM5_ENST00000409977_chr11_93554489_-_307aa
MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHW
PFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKVRVCPYTFLRPPSMPLSKKTSCSQLSTPVMECPPSNGHIHPIG
ERRRSWSGNQGLRPTSLKATRTESAPLTTAPSSSSAWEXGIPATMSSPXRSAWGAASLAPSCCTSLRSSMKTCTLSLSSLLFSLLWPQYX

>In-frame_HSPA8_ENST00000534624_chr11_122931301_-_VSTM5_ENST00000409977_chr11_93554489_-_307aa
MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHW
PFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKVRVCPYTFLRPPSMPLSKKTSCSQLSTPVMECPPSNGHIHPIG
ERRRSWSGNQGLRPTSLKATRTESAPLTTAPSSSSAWEXGIPATMSSPXRSAWGAASLAPSCCTSLRSSMKTCTLSLSSLLFSLLWPQYX


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_HSPA8_ENST00000453788_chr11_122931301_-_VSTM5_ENST00000409977_chr11_93554489_-_923nt
ATGTCCAAGGGACCTGCAGTTGGTATTGATCTTGGCACCACCTACTCTTGTGTGGGTGTTTTCCAGCACGGAAAAGTCGAGATAATTGCC
AATGATCAGGGAAACCGAACCACTCCAAGCTATGTCGCCTTTACGGACACTGAACGGTTGATCGGTGATGCCGCAAAGAATCAAGTTGCA
ATGAACCCCACCAACACAGTTTTTGATGCCAAACGTCTGATTGGACGCAGATTTGATGATGCTGTTGTCCAGTCTGATATGAAACATTGG
CCCTTTATGGTGGTGAATGATGCTGGCAGGCCCAAGGTCCAAGTAGAATACAAGGGAGAGACCAAAAGCTTCTATCCAGAGGAGGTGTCT
TCTATGGTTCTGACAAAGATGAAGGAAATTGCAGAAGCCTACCTTGGGAAGGTCAGGGTGTGTCCCTATACATTCCTCAGGCCACCATCA
ATGCCACTGTCAAAGAAGACATCCTGCTCTCAGTTGAGTACTCCTGTCATGGAGTGCCCACCATCGAATGGACATATTCATCCAATTGGG
GAACGCAGAAGATCGTGGAGTGGAAACCAGGGACTCAGGCCAACATCTCTCAAAGCCACAAGGACAGAGTCTGCACCTTTGACAACGGCT
CCATCCAGCTCTTCAGCGTGGGAGTGAGGGATTCCGGCTACTATGTCATCACCGTGACGGAGCGCCTGGGGAGCAGCCAGTTTGGCACCA
TCGTGCTGCACGTCTCTGAGATCCTCTATGAAGACCTGCACTTTGTCGCTGTCATCCTTGCTTTTCTCGCTGCTGTGGCCGCAGTATTAA
TCAGCCTCATGTGGGTTTGTAATAAGTGTGCATATAAATTTCAGAGGAAGAGAAGACACAAACTCAAAGAAAGCACAACTGAGGAGATTG

>In-frame_HSPA8_ENST00000534624_chr11_122931301_-_VSTM5_ENST00000409977_chr11_93554489_-_923nt
ATGTCCAAGGGACCTGCAGTTGGTATTGATCTTGGCACCACCTACTCTTGTGTGGGTGTTTTCCAGCACGGAAAAGTCGAGATAATTGCC
AATGATCAGGGAAACCGAACCACTCCAAGCTATGTCGCCTTTACGGACACTGAACGGTTGATCGGTGATGCCGCAAAGAATCAAGTTGCA
ATGAACCCCACCAACACAGTTTTTGATGCCAAACGTCTGATTGGACGCAGATTTGATGATGCTGTTGTCCAGTCTGATATGAAACATTGG
CCCTTTATGGTGGTGAATGATGCTGGCAGGCCCAAGGTCCAAGTAGAATACAAGGGAGAGACCAAAAGCTTCTATCCAGAGGAGGTGTCT
TCTATGGTTCTGACAAAGATGAAGGAAATTGCAGAAGCCTACCTTGGGAAGGTCAGGGTGTGTCCCTATACATTCCTCAGGCCACCATCA
ATGCCACTGTCAAAGAAGACATCCTGCTCTCAGTTGAGTACTCCTGTCATGGAGTGCCCACCATCGAATGGACATATTCATCCAATTGGG
GAACGCAGAAGATCGTGGAGTGGAAACCAGGGACTCAGGCCAACATCTCTCAAAGCCACAAGGACAGAGTCTGCACCTTTGACAACGGCT
CCATCCAGCTCTTCAGCGTGGGAGTGAGGGATTCCGGCTACTATGTCATCACCGTGACGGAGCGCCTGGGGAGCAGCCAGTTTGGCACCA
TCGTGCTGCACGTCTCTGAGATCCTCTATGAAGACCTGCACTTTGTCGCTGTCATCCTTGCTTTTCTCGCTGCTGTGGCCGCAGTATTAA
TCAGCCTCATGTGGGTTTGTAATAAGTGTGCATATAAATTTCAGAGGAAGAGAAGACACAAACTCAAAGAAAGCACAACTGAGGAGATTG


* Fusion transcript sequences (Full-length transcript).
>In-frame_HSPA8_ENST00000453788_chr11_122931301_-_VSTM5_ENST00000409977_chr11_93554489_-_3537nt
ATCGTGAGGCGGAGCGCGGTGGGGTGGGTGCGGAAGGGGGCGAGGCCCGAGGAGTGGAGCCGGGCTTGTGATTGGGTCTTGTAAGGGCAG
CCGGGCGTCTATTGGCCGGGGAAGCCGTAATGGCAGGCAGCAGGGGCGGGCCCCTTCTGGAAGGTTCTAAGATAGGGTATAAGAGGCAGG
GTGGCGGGCGGAAACCGGTCTCATTGAACTCGCCTGCAGCTCTTGGGTTTTTTGTGGCTTCCTTCGTTATTGGAGCCAGGCCTACACCCC
AGCAACCATGTCCAAGGGACCTGCAGTTGGTATTGATCTTGGCACCACCTACTCTTGTGTGGGTGTTTTCCAGCACGGAAAAGTCGAGAT
AATTGCCAATGATCAGGGAAACCGAACCACTCCAAGCTATGTCGCCTTTACGGACACTGAACGGTTGATCGGTGATGCCGCAAAGAATCA
AGTTGCAATGAACCCCACCAACACAGTTTTTGATGCCAAACGTCTGATTGGACGCAGATTTGATGATGCTGTTGTCCAGTCTGATATGAA
ACATTGGCCCTTTATGGTGGTGAATGATGCTGGCAGGCCCAAGGTCCAAGTAGAATACAAGGGAGAGACCAAAAGCTTCTATCCAGAGGA
GGTGTCTTCTATGGTTCTGACAAAGATGAAGGAAATTGCAGAAGCCTACCTTGGGAAGGTCAGGGTGTGTCCCTATACATTCCTCAGGCC
ACCATCAATGCCACTGTCAAAGAAGACATCCTGCTCTCAGTTGAGTACTCCTGTCATGGAGTGCCCACCATCGAATGGACATATTCATCC
AATTGGGGAACGCAGAAGATCGTGGAGTGGAAACCAGGGACTCAGGCCAACATCTCTCAAAGCCACAAGGACAGAGTCTGCACCTTTGAC
AACGGCTCCATCCAGCTCTTCAGCGTGGGAGTGAGGGATTCCGGCTACTATGTCATCACCGTGACGGAGCGCCTGGGGAGCAGCCAGTTT
GGCACCATCGTGCTGCACGTCTCTGAGATCCTCTATGAAGACCTGCACTTTGTCGCTGTCATCCTTGCTTTTCTCGCTGCTGTGGCCGCA
GTATTAATCAGCCTCATGTGGGTTTGTAATAAGTGTGCATATAAATTTCAGAGGAAGAGAAGACACAAACTCAAAGAAAGCACAACTGAG
GAGATTGAGCTGGAAGATGTTGAGTGTTAGCCAAGGCTGGGCCTGACTGCATTCCTACCTCAAGAGGAAACCATTCTCCAACAAAAAGAG
CAAGCACAGCTATTATACCCATTGTGTGTGGTCCTGTTGCAGCCCGCTCCTAACAGGACAGTGGGAGATTAACAACATTGACTGCATGGA
GTTGAGGACTGTGGATGGGACAAAGCTAGTATTAGGACTCGCGCTAAGTTCAAGGAGAAGAGTGATTGAGGCTTTGAACCAGGAGCTTCG
CTTGGCTGCAGCATCAGGGCCGTGCTGACACATAACCAATGGGTGAGTGCAGGCGTTGGCTGCTTGCTCACGACACTTGCTCTGGTGTGC
AGGATGGCCTGTTGTCAGAGTCCCTGTATCAGAGGCCAGAGGATTTCCAGATGGATGTGCAGCCAGCATTAGAACATGCTTTCTGTGCTC
CTGTCTGCTCTGCAACTGCTGTGCCAACCAGCCCCCCATCTGGTATCCCACAAGCAAGCACTGCTGTGGGAGCTATTGTGAGAAAACCTG
AGGCTTTTAGACAATCTGCTGCCTCAGAGCAGAGGTGGAAAGAGACTGGGGGTGGGGGTTGGTGCTGTTGTGCTGCAGAGTTTTTCATTG
GTGAGGCCCGGTGGCTGGGAGTTTTATGGGAGAGGAGCTCAATGGACTCCTGAGAGGCCAGCTTTGGATACAAGGAATAGAGAAAATTAT
CTTTCTCTTCCTCCCTCATTCCAACGTTAATTGGATTTTCCCTCCCATGGCTCAAACTTAGGCCATTGTAAGTAAAACAACAGCTCATCT
CCATTATGGGCAGCACCTGGCCTCCTGACGAGCTGGATGCCACCTGTGTGAAAGCTGAGCTTGCATAGTGGGTGATGCAGCTGGAAAATC
AGTCATCTCGGGCTTTGCATCTGTCCCCCTCAGTCACTAACACTTCACGTCTCAAGTCAGGCCCTTGCCCTCTCCTACCTGGGCTGAGGA
ACGCTTGGCCCTTGCCTACCTCACAGTCAGAGTATCAAGAGAAGCCCACAGTATGCACAGAGTTCTCTGAGCAACTTACGAAATGCATGA
GGCTTCTTCAAGGATCTGGAAAGCTATACTGGAAAACGCTATTCTGAGTATTAGAAATTGATAAAATCCTCTGAGGTCTTGGGGCTCCAG
GTGAGATTGGGGACTGGACCACAGCTGGCCTTGGCCATTATTCCCTCAGGTTGTTGGTCACCATGTTCACCTGTAAGTTTCTCCATCCCA
ACTTCCATTTGACAAGCTCTAAAAGCAGGCATGGATTTATTTTCCATTCTCTTATCTCTCCAATATTCATAGCTACAGACCAAAGGTACC
ATCCGATGATGATGTGTTCCTAGTCCTCAGTTGCAAATTCACCCATGCAAAGGTTAAGAAGTCTTAGAACATTCCTTTCTCTTCTTCCTC
CTTTCAGGCCTCCAATGTCCATATCTTCTCTATTTCCTATGTGGCAGAGGAGTTGCTTGGATAAGTTACAGCCCTTTCCCTCAATATTGA
ATCCAGAGTTTTGGGAAGGGATCTCTCAGAATATTCAGACAGGAACTCTCAGTATCCAGAGCAGGACTCCCAAGGCACTGCTTGATTCAA
AAGGCGACAGCAGTTGGTCTACACAACGGATGTGTAGCTCTAGCACCTGACAGGTAGAAGATACCCTCAAGGCGCCTCCTGTAGACACAC
GGGTAAACTCACACACTATGTCCTATCCCCACGCAGCAGTCGGAGGAACCAGGCTCTGGGCCAGGACAGTTTCCAGTGCTGTGAAGAAAC
GAGGTGAGCAGTATCCAAGGGGCTCAAGGATAATCTGCTGATTTCTTTCTTGTCTTTCACACAGAGAGGCCACCAGCAGGAAAGCAGTGG
GAGTTGGGTAGCTGCTGGGGCCAGCATGTCCTCTTCCACACTACCTGCCTTTCAGAACTCTGCTCTTCCGCTTGTCCCGAAGTCAGGGCT
GGCAATCTTCATAATCAAAGGGGAGTTGGAAAAGAACACCCACTAAGAGGCCTCCATGGCAGATGTCAATTAAATTGCCCCCCCGCCCAA
ATCTCATGACAGTTTATTCACATCAGTAGTGTGGGAAGTTACAATGTTTTTTTTAAAAAAAGCTTCTTTCCTTGGCTTTCCATTTCTTTG
AAAAAAGGGTTTCTTTTGAATTTTTAAAGCTCTGCCATACTGAACATTCCTGTGGAAAGGTTTAAAATGCAGAGCCTGAGGTTTTTGCTT
TTCAGAAAAATAAAAATCTTAGAGATTAGCTAGTGTAAATGTTAAGCTATAAATTATATTTCAAACTGTGAAAAAAAAAAGTTTTAAAGA

>In-frame_HSPA8_ENST00000534624_chr11_122931301_-_VSTM5_ENST00000409977_chr11_93554489_-_3537nt
ATCGTGAGGCGGAGCGCGGTGGGGTGGGTGCGGAAGGGGGCGAGGCCCGAGGAGTGGAGCCGGGCTTGTGATTGGGTCTTGTAAGGGCAG
CCGGGCGTCTATTGGCCGGGGAAGCCGTAATGGCAGGCAGCAGGGGCGGGCCCCTTCTGGAAGGTTCTAAGATAGGGTATAAGAGGCAGG
GTGGCGGGCGGAAACCGGTCTCATTGAACTCGCCTGCAGCTCTTGGGTTTTTTGTGGCTTCCTTCGTTATTGGAGCCAGGCCTACACCCC
AGCAACCATGTCCAAGGGACCTGCAGTTGGTATTGATCTTGGCACCACCTACTCTTGTGTGGGTGTTTTCCAGCACGGAAAAGTCGAGAT
AATTGCCAATGATCAGGGAAACCGAACCACTCCAAGCTATGTCGCCTTTACGGACACTGAACGGTTGATCGGTGATGCCGCAAAGAATCA
AGTTGCAATGAACCCCACCAACACAGTTTTTGATGCCAAACGTCTGATTGGACGCAGATTTGATGATGCTGTTGTCCAGTCTGATATGAA
ACATTGGCCCTTTATGGTGGTGAATGATGCTGGCAGGCCCAAGGTCCAAGTAGAATACAAGGGAGAGACCAAAAGCTTCTATCCAGAGGA
GGTGTCTTCTATGGTTCTGACAAAGATGAAGGAAATTGCAGAAGCCTACCTTGGGAAGGTCAGGGTGTGTCCCTATACATTCCTCAGGCC
ACCATCAATGCCACTGTCAAAGAAGACATCCTGCTCTCAGTTGAGTACTCCTGTCATGGAGTGCCCACCATCGAATGGACATATTCATCC
AATTGGGGAACGCAGAAGATCGTGGAGTGGAAACCAGGGACTCAGGCCAACATCTCTCAAAGCCACAAGGACAGAGTCTGCACCTTTGAC
AACGGCTCCATCCAGCTCTTCAGCGTGGGAGTGAGGGATTCCGGCTACTATGTCATCACCGTGACGGAGCGCCTGGGGAGCAGCCAGTTT
GGCACCATCGTGCTGCACGTCTCTGAGATCCTCTATGAAGACCTGCACTTTGTCGCTGTCATCCTTGCTTTTCTCGCTGCTGTGGCCGCA
GTATTAATCAGCCTCATGTGGGTTTGTAATAAGTGTGCATATAAATTTCAGAGGAAGAGAAGACACAAACTCAAAGAAAGCACAACTGAG
GAGATTGAGCTGGAAGATGTTGAGTGTTAGCCAAGGCTGGGCCTGACTGCATTCCTACCTCAAGAGGAAACCATTCTCCAACAAAAAGAG
CAAGCACAGCTATTATACCCATTGTGTGTGGTCCTGTTGCAGCCCGCTCCTAACAGGACAGTGGGAGATTAACAACATTGACTGCATGGA
GTTGAGGACTGTGGATGGGACAAAGCTAGTATTAGGACTCGCGCTAAGTTCAAGGAGAAGAGTGATTGAGGCTTTGAACCAGGAGCTTCG
CTTGGCTGCAGCATCAGGGCCGTGCTGACACATAACCAATGGGTGAGTGCAGGCGTTGGCTGCTTGCTCACGACACTTGCTCTGGTGTGC
AGGATGGCCTGTTGTCAGAGTCCCTGTATCAGAGGCCAGAGGATTTCCAGATGGATGTGCAGCCAGCATTAGAACATGCTTTCTGTGCTC
CTGTCTGCTCTGCAACTGCTGTGCCAACCAGCCCCCCATCTGGTATCCCACAAGCAAGCACTGCTGTGGGAGCTATTGTGAGAAAACCTG
AGGCTTTTAGACAATCTGCTGCCTCAGAGCAGAGGTGGAAAGAGACTGGGGGTGGGGGTTGGTGCTGTTGTGCTGCAGAGTTTTTCATTG
GTGAGGCCCGGTGGCTGGGAGTTTTATGGGAGAGGAGCTCAATGGACTCCTGAGAGGCCAGCTTTGGATACAAGGAATAGAGAAAATTAT
CTTTCTCTTCCTCCCTCATTCCAACGTTAATTGGATTTTCCCTCCCATGGCTCAAACTTAGGCCATTGTAAGTAAAACAACAGCTCATCT
CCATTATGGGCAGCACCTGGCCTCCTGACGAGCTGGATGCCACCTGTGTGAAAGCTGAGCTTGCATAGTGGGTGATGCAGCTGGAAAATC
AGTCATCTCGGGCTTTGCATCTGTCCCCCTCAGTCACTAACACTTCACGTCTCAAGTCAGGCCCTTGCCCTCTCCTACCTGGGCTGAGGA
ACGCTTGGCCCTTGCCTACCTCACAGTCAGAGTATCAAGAGAAGCCCACAGTATGCACAGAGTTCTCTGAGCAACTTACGAAATGCATGA
GGCTTCTTCAAGGATCTGGAAAGCTATACTGGAAAACGCTATTCTGAGTATTAGAAATTGATAAAATCCTCTGAGGTCTTGGGGCTCCAG
GTGAGATTGGGGACTGGACCACAGCTGGCCTTGGCCATTATTCCCTCAGGTTGTTGGTCACCATGTTCACCTGTAAGTTTCTCCATCCCA
ACTTCCATTTGACAAGCTCTAAAAGCAGGCATGGATTTATTTTCCATTCTCTTATCTCTCCAATATTCATAGCTACAGACCAAAGGTACC
ATCCGATGATGATGTGTTCCTAGTCCTCAGTTGCAAATTCACCCATGCAAAGGTTAAGAAGTCTTAGAACATTCCTTTCTCTTCTTCCTC
CTTTCAGGCCTCCAATGTCCATATCTTCTCTATTTCCTATGTGGCAGAGGAGTTGCTTGGATAAGTTACAGCCCTTTCCCTCAATATTGA
ATCCAGAGTTTTGGGAAGGGATCTCTCAGAATATTCAGACAGGAACTCTCAGTATCCAGAGCAGGACTCCCAAGGCACTGCTTGATTCAA
AAGGCGACAGCAGTTGGTCTACACAACGGATGTGTAGCTCTAGCACCTGACAGGTAGAAGATACCCTCAAGGCGCCTCCTGTAGACACAC
GGGTAAACTCACACACTATGTCCTATCCCCACGCAGCAGTCGGAGGAACCAGGCTCTGGGCCAGGACAGTTTCCAGTGCTGTGAAGAAAC
GAGGTGAGCAGTATCCAAGGGGCTCAAGGATAATCTGCTGATTTCTTTCTTGTCTTTCACACAGAGAGGCCACCAGCAGGAAAGCAGTGG
GAGTTGGGTAGCTGCTGGGGCCAGCATGTCCTCTTCCACACTACCTGCCTTTCAGAACTCTGCTCTTCCGCTTGTCCCGAAGTCAGGGCT
GGCAATCTTCATAATCAAAGGGGAGTTGGAAAAGAACACCCACTAAGAGGCCTCCATGGCAGATGTCAATTAAATTGCCCCCCCGCCCAA
ATCTCATGACAGTTTATTCACATCAGTAGTGTGGGAAGTTACAATGTTTTTTTTAAAAAAAGCTTCTTTCCTTGGCTTTCCATTTCTTTG
AAAAAAGGGTTTCTTTTGAATTTTTAAAGCTCTGCCATACTGAACATTCCTGTGGAAAGGTTTAAAATGCAGAGCCTGAGGTTTTTGCTT
TTCAGAAAAATAAAAATCTTAGAGATTAGCTAGTGTAAATGTTAAGCTATAAATTATATTTCAAACTGTGAAAAAAAAAAGTTTTAAAGA


Top

FusionGenePPI for HSPA8_VSTM5


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
HSPA8BAG1, HSPBP1, PPID, TCERG1, BRCA1, FANCC, PPP1R15A, HCFC1, HDAC3, CITED1, NOA1, TM4SF1, TADA3, ERH, FBP1, UBC, RGS2, DNAJA3, JAK2, DNAJB1, DNAJA1, CFTR, HSP90AA1, PPP1CA, PPP1R12B, RBX1, BAG2, BAG3, DNAJC3, CYCS, POLR3D, TP53, BAG4, TNFRSF1A, STMN1, GOT2, STUB1, HSF1, PARK2, GPR37, CDC5L, HGS, HNRNPD, MAPT, RUVBL1, GPN1, RPAP1, PACSIN1, PACSIN2, PACSIN3, HDAC10, EGFR, MST1R, VCP, RFWD2, ESR1, SOD1, CDK11B, CCND1, CDK4, TSSK6, HIST3H3, MEN1, IL16, CENPA, WDR82, RAF1, CDK5RAP3, FGFR3, ERG, USP50, LALBA, CLTA, HTT, AGO4, CD4, DGCR8, MME, TLR4, TLR9, MDM2, DYRK2, UBE3A, YWHAQ, INSIG2, HMGB1, BCR, ABL1, HLA-DRA, HLA-DRB1, HLA-DRB3, HLA-DRB4, HLA-DRB5, PSMA3, MAPK8, VHL, SF3A2, ARRB1, ARRB2, MKKS, ATXN1, PARD3, ISG15, FBXO25, DNAJB2, UCHL1, PPP1CC, PSMA2, CUL3, CUL4A, SNCA, CUL4B, CUL5, CUL2, CDK2, CUL1, COPS5, COPS6, DCUN1D1, CAND1, NEDD8, MCL1, PPP2R1A, EEF1A1, HERC5, SGTA, FAF1, KCND3, BCAS2, CWC15, AIPL1, HSPA4, APP, LRRK2, RBSN, AKT1, SPRTN, CAPZB, CAPZA1, DNAJB14, INPPL1, CBL, UBASH3B, GRB2, PIK3R2, SHC1, CRK, EPS15, AP2M1, ATP13A2, LMAN1, RAD23A, IRAK1, GCH1, HSPA5, HSPD1, VAMP2, HSPA2, PRKDC, RNPS1, PDIA3, HNRNPA3, RPS4X, SAMM50, EEF2, SEC24C, DNAJB12, STIP1, SSBP1, RPS15A, RPL18A, NECAP2, SON, RPL8, SEC31A, POU2F1, HSPA1A, KCNH2, NLRP12, EIF4A3, MAGOH, SMURF1, CTNNB1, TRAF3IP1, KCNQ4, SUGT1, ESR2, FN1, VCAM1, SRRT, CCAR2, CDH1, C1QBP, BRAF, MAP2K1, YWHAE, IQCB1, PPP5C, SYNPO2, CAMKMT, METTL20, METTL21A, METTL21B, METTL21C, METTL22, UBL4A, ITGA4, SLC12A3, PAN2, ST13, RAD52, HDAC6, DNAJC7, TTC1, LAMP2, HIF1A, TGM2, HLTF, JUN, FBXO6, TARDBP, TOPBP1, RELA, CDKN2A, ASNA1, ATXN10, HSPA6, NAPRT, RPS6KA3, TUBA4B, YARS, SHFM1, RPA3, RPA2, RPA1, WWOX, ZBTB1, ERRFI1, HSPH1, DNAJB6, EDRF1, DNAJC9, GABRB1, HSPA4L, HYOU1, TUBA1A, AMT, DNAJA2, FLYWCH2, IVNS1ABP, STAU1, AIRE, AURKA, HAUS1, CDC20, CDKN1A, CEP250, HAUS2, LGALS3BP, TUBG1, TUBGCP2, TUBGCP3, TUBGCP4, IL32, FUS, NMI, TRIM38, C17orf49, EED, MCF2, SUMO2, SIRT6, CCNI2, DRG2, LPGAT1, LRRC28, POC1A, VASH1, EBNA1BP2, FAM189B, KIAA1191, NXF5, RIC3, TSSK1B, USP46, VSX1, ZSCAN32, WDR37, APBB2, NDRG2, KCNJ10, CCDC117, DENND2D, CYP3A4, KNSTRN, RPS6KB2, HNRNPA1, AMBRA1, APOA1BP, DNAJA4, DNAJB4, DNAJC1, DNAJC13, DNAJC2, DUT, FDPS, GAPDH, C12orf10, CAD, CPS1, DNAJB11, GRPEL1, HSP90AB1, HSPA9, HSPB1, PABPC1, RPLP0, TECR, IPO7, LMNB1, NACA, RPL13A, RPL7, TUBB, NTRK1, PTEN, ATM, NPHP4, AHSA1, PPME1, AKAP5, LRPPRC, KIF1C, KIAA1107, SDHAF2, CDCA5, ID2, RNF207, GAN, HEMGN, SKI, CRY2, ALKBH3, MCM2, MCM5, HTN3, CDKN1B, SNW1, KCNA5, OTUB1, ERBB3, ESRRB, CDC37, NANOG, POU5F1, ZNF618, U2AF2, NFATC2, CDC73, PHF8, HYPK, RFX1, DERL1, HSF2, CD207, ARMC1, ABL2, PDPK1, GAK, TBC1D23, ARFIP1, GMNN, HMCES, HIST2H3PS2, RPRD2, TBCE, C6orf106, EP300, SRP54, CYP8B1, TACC3, MAPRE2, SNX20, SERPINA1, ABHD15, KLHL34, ZNF703, KCTD15, SF3A1, HBB, KCND2, VILL, HBA2, SF3A3, SLC27A3, TCAP, ALOXE3, DGCR14, HDLBP, GNA15, ILK, C21orf59, NUS1, CSNK1E, NOX5, FAM73B, FUZ, HIST1H1B, DCDC2B, VWA2, PRODH, NFS1, CDK10, TRIM16L, ARNT, MAP2K2, QRICH1, TAB1, CNN2, WNK1, ENDOG, CKAP5, GANAB, RNF34, GFAP, PPP1R8, C19orf45, HCFC2, SPATA5L1, MAVS, TRMT12, CAPG, LRRC56, NMNAT3, VSIG8, TYSND1, SSMEM1, THSD4, TTC30B, KCNV2, DSCR4, FOXRED1, KLHL10, SETMAR, ZNF488, VANGL2, EPB42, LEPREL2, HAO2, BPNT1, FRMD8P1, RNF25, DET1, KLHL36, PRKACG, MAD1L1, CHD1L, AGPAT3, NPAS1, DHX57, CPLX4, GPR6, PNPLA5, KCNC4, PANK2, NLRX1, FOXC1, ATF1, CSTF3, IER2, CFAP52, HTR1E, THAP4, BBS1, CSNK1D, ALB, POLE, PPEF1, C9orf116, PTGIR, EXOC3L2, C1orf94, SSH3, CYB5R3, KBTBD4, F12, GK2, TAF6L, PTRF, DOCK5, FCRL3, C20orf96, FAM187B, CDK3, TSPYL6, MVP, IL17RC, ARHGEF16, CHI3L1, CSDE1, CDKL3, MPZL1, RCCD1, GLIPR1, SP1, MYB, FANCA, CYLD, DDX59, CREBBP, EDEM3, TRIM25, UBE2S, HEY1, MTF1, DCAF4L2, TXNIP, SLC6A4, UBQLN2VSTM5


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for HSPA8_VSTM5


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
HgeneHSPA8P11142DB01254DasatinibHeat shock cognate 71 kDa proteinsmall moleculeapproved|investigational
HgeneHSPA8P11142DB11638ArtenimolHeat shock cognate 71 kDa proteinsmall moleculeapproved|investigational

Top

RelatedDiseases for HSPA8_VSTM5


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneHSPA8C0001418Adenocarcinoma1CTD_human
HgeneHSPA8C0007137Squamous cell carcinoma1CTD_human
HgeneHSPA8C0026640Mouth Neoplasms1CTD_human
HgeneHSPA8C0035126Reperfusion Injury1CTD_human
HgeneHSPA8C0038356Stomach Neoplasms1CTD_human
HgeneHSPA8C0948089Acute Coronary Syndrome1CTD_human
HgeneHSPA8C1846707SPINOCEREBELLAR ATAXIA 171CTD_human