FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 1670

FusionGeneSummary for ANK2_ALPK1

check button Fusion gene summary
Fusion gene informationFusion gene name: ANK2_ALPK1
Fusion gene ID: 1670
HgeneTgene
Gene symbol

ANK2

ALPK1

Gene ID

287

80216

Gene nameankyrin 2alpha kinase 1
SynonymsANK-2|LQT4|brank-28430410J10Rik|LAK
Cytomap

4q25-q26

4q25

Type of geneprotein-codingprotein-coding
Descriptionankyrin-2ankyrin 2, neuronalankyrin Bankyrin, brainankyrin-2, nonerythrocyticnon-erythroid ankyrinalpha-protein kinase 1chromosome 4 kinaselymphocyte alpha-kinaselymphocyte alpha-protein kinase
Modification date2018052320180519
UniProtAcc

Q01484

Q96QP1

Ensembl transtripts involved in fusion geneENST00000506722, ENST00000394537, 
ENST00000357077, ENST00000264366, 
ENST00000509550, ENST00000510275, 
ENST00000504887, 
ENST00000458497, 
ENST00000177648, ENST00000504176, 
ENST00000505912, 
Fusion gene scores* DoF score8 X 9 X 4=2882 X 3 X 3=18
# samples 113
** MAII scorelog2(11/288*10)=-1.38856528791765
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(3/18*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: ANK2 [Title/Abstract] AND ALPK1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationKinase involved fusion gene, inframe and retained kinase domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLGGTCGA-HT-8104-01AANK2chr4

113825670

+ALPK1chr4

113350305

+
TCGARVLUADTCGA-50-6592-01AANK2chr4

113825670

+ALPK1chr4

113359640

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000506722ENST00000458497ANK2chr4

113825670

+ALPK1chr4

113350305

+
In-frameENST00000506722ENST00000177648ANK2chr4

113825670

+ALPK1chr4

113350305

+
In-frameENST00000506722ENST00000504176ANK2chr4

113825670

+ALPK1chr4

113350305

+
5CDS-intronENST00000506722ENST00000505912ANK2chr4

113825670

+ALPK1chr4

113350305

+
intron-3CDSENST00000394537ENST00000458497ANK2chr4

113825670

+ALPK1chr4

113350305

+
intron-3CDSENST00000394537ENST00000177648ANK2chr4

113825670

+ALPK1chr4

113350305

+
intron-3CDSENST00000394537ENST00000504176ANK2chr4

113825670

+ALPK1chr4

113350305

+
intron-intronENST00000394537ENST00000505912ANK2chr4

113825670

+ALPK1chr4

113350305

+
intron-3CDSENST00000357077ENST00000458497ANK2chr4

113825670

+ALPK1chr4

113350305

+
intron-3CDSENST00000357077ENST00000177648ANK2chr4

113825670

+ALPK1chr4

113350305

+
intron-3CDSENST00000357077ENST00000504176ANK2chr4

113825670

+ALPK1chr4

113350305

+
intron-intronENST00000357077ENST00000505912ANK2chr4

113825670

+ALPK1chr4

113350305

+
intron-3CDSENST00000264366ENST00000458497ANK2chr4

113825670

+ALPK1chr4

113350305

+
intron-3CDSENST00000264366ENST00000177648ANK2chr4

113825670

+ALPK1chr4

113350305

+
intron-3CDSENST00000264366ENST00000504176ANK2chr4

113825670

+ALPK1chr4

113350305

+
intron-intronENST00000264366ENST00000505912ANK2chr4

113825670

+ALPK1chr4

113350305

+
intron-3CDSENST00000509550ENST00000458497ANK2chr4

113825670

+ALPK1chr4

113350305

+
intron-3CDSENST00000509550ENST00000177648ANK2chr4

113825670

+ALPK1chr4

113350305

+
intron-3CDSENST00000509550ENST00000504176ANK2chr4

113825670

+ALPK1chr4

113350305

+
intron-intronENST00000509550ENST00000505912ANK2chr4

113825670

+ALPK1chr4

113350305

+
intron-3CDSENST00000510275ENST00000458497ANK2chr4

113825670

+ALPK1chr4

113350305

+
intron-3CDSENST00000510275ENST00000177648ANK2chr4

113825670

+ALPK1chr4

113350305

+
intron-3CDSENST00000510275ENST00000504176ANK2chr4

113825670

+ALPK1chr4

113350305

+
intron-intronENST00000510275ENST00000505912ANK2chr4

113825670

+ALPK1chr4

113350305

+
intron-3CDSENST00000504887ENST00000458497ANK2chr4

113825670

+ALPK1chr4

113350305

+
intron-3CDSENST00000504887ENST00000177648ANK2chr4

113825670

+ALPK1chr4

113350305

+
intron-3CDSENST00000504887ENST00000504176ANK2chr4

113825670

+ALPK1chr4

113350305

+
intron-intronENST00000504887ENST00000505912ANK2chr4

113825670

+ALPK1chr4

113350305

+
Frame-shiftENST00000506722ENST00000458497ANK2chr4

113825670

+ALPK1chr4

113359640

+
Frame-shiftENST00000506722ENST00000177648ANK2chr4

113825670

+ALPK1chr4

113359640

+
Frame-shiftENST00000506722ENST00000504176ANK2chr4

113825670

+ALPK1chr4

113359640

+
5CDS-intronENST00000506722ENST00000505912ANK2chr4

113825670

+ALPK1chr4

113359640

+
intron-3CDSENST00000394537ENST00000458497ANK2chr4

113825670

+ALPK1chr4

113359640

+
intron-3CDSENST00000394537ENST00000177648ANK2chr4

113825670

+ALPK1chr4

113359640

+
intron-3CDSENST00000394537ENST00000504176ANK2chr4

113825670

+ALPK1chr4

113359640

+
intron-intronENST00000394537ENST00000505912ANK2chr4

113825670

+ALPK1chr4

113359640

+
intron-3CDSENST00000357077ENST00000458497ANK2chr4

113825670

+ALPK1chr4

113359640

+
intron-3CDSENST00000357077ENST00000177648ANK2chr4

113825670

+ALPK1chr4

113359640

+
intron-3CDSENST00000357077ENST00000504176ANK2chr4

113825670

+ALPK1chr4

113359640

+
intron-intronENST00000357077ENST00000505912ANK2chr4

113825670

+ALPK1chr4

113359640

+
intron-3CDSENST00000264366ENST00000458497ANK2chr4

113825670

+ALPK1chr4

113359640

+
intron-3CDSENST00000264366ENST00000177648ANK2chr4

113825670

+ALPK1chr4

113359640

+
intron-3CDSENST00000264366ENST00000504176ANK2chr4

113825670

+ALPK1chr4

113359640

+
intron-intronENST00000264366ENST00000505912ANK2chr4

113825670

+ALPK1chr4

113359640

+
intron-3CDSENST00000509550ENST00000458497ANK2chr4

113825670

+ALPK1chr4

113359640

+
intron-3CDSENST00000509550ENST00000177648ANK2chr4

113825670

+ALPK1chr4

113359640

+
intron-3CDSENST00000509550ENST00000504176ANK2chr4

113825670

+ALPK1chr4

113359640

+
intron-intronENST00000509550ENST00000505912ANK2chr4

113825670

+ALPK1chr4

113359640

+
intron-3CDSENST00000510275ENST00000458497ANK2chr4

113825670

+ALPK1chr4

113359640

+
intron-3CDSENST00000510275ENST00000177648ANK2chr4

113825670

+ALPK1chr4

113359640

+
intron-3CDSENST00000510275ENST00000504176ANK2chr4

113825670

+ALPK1chr4

113359640

+
intron-intronENST00000510275ENST00000505912ANK2chr4

113825670

+ALPK1chr4

113359640

+
intron-3CDSENST00000504887ENST00000458497ANK2chr4

113825670

+ALPK1chr4

113359640

+
intron-3CDSENST00000504887ENST00000177648ANK2chr4

113825670

+ALPK1chr4

113359640

+
intron-3CDSENST00000504887ENST00000504176ANK2chr4

113825670

+ALPK1chr4

113359640

+
intron-intronENST00000504887ENST00000505912ANK2chr4

113825670

+ALPK1chr4

113359640

+

Top

FusionProtFeatures for ANK2_ALPK1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ANK2

Q01484

ALPK1

Q96QP1

In skeletal muscle, required for proper localization ofDMD and DCTN4 and for the formation and/or stability of a specialsubset of microtubules associated with costameres andneuromuscular junctions. Attaches integral membrane proteins tocytoskeletal elements. Also binds to cytoskeletal proteins.Required for coordinate assembly of Na/Ca exchanger, Na/K ATPaseand InsP3 receptor at sarcoplasmic reticulum sites incardiomyocytes. Required for the coordinated expression of theNa/K ATPase, Na/Ca exchanger and beta-2-spectrin (SPTBN1) in theinner segment of rod photoreceptors (By similarity). Required forexpression and targeting of SPTBN1 in neonatal cardiomyocytes andfor the regulation of neonatal cardiomyocyte contraction rate(PubMed:12571597). Plays a role in endocytosis and intracellularprotein transport. Associates with phosphatidylinositol 3-phosphate (PI3P)-positive organelles and binds dynactin to promotelong-range motility of cells. Recruits RABGAP1L to (PI3P)-positiveearly endosomes, where RABGAP1L inactivates RAB22A, and promotespolarized trafficking to the leading edge of the migrating cells.Part of the ANK2/RABGAP1L complex which is required for thepolarized recycling of fibronectin receptor ITGA5 ITGB1 to theplasma membrane that enables continuous directional cell migration(By similarity). {ECO:0000250|UniProtKB:Q8C8R3,ECO:0000269|PubMed:12571597}. Kinase that recognizes phosphorylation sites in whichthe surrounding peptides have an alpha-helical conformation.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneALPK1chr4:113825670chr4:113350305ENST00000177648+816921_9602651245Compositional biasNote=Ser-rich
TgeneALPK1chr4:113825670chr4:113350305ENST00000458497+816921_9602651245Compositional biasNote=Ser-rich
TgeneALPK1chr4:113825670chr4:113350305ENST00000504176+715921_9601871167Compositional biasNote=Ser-rich
TgeneALPK1chr4:113825670chr4:113350305ENST00000177648+8161017_12372651245DomainAlpha-type protein kinase
TgeneALPK1chr4:113825670chr4:113350305ENST00000458497+8161017_12372651245DomainAlpha-type protein kinase
TgeneALPK1chr4:113825670chr4:113350305ENST00000504176+7151017_12371871167DomainAlpha-type protein kinase

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneANK2chr4:113825670chr4:113350305ENST00000357077+1461158_1304-183958DomainZU5 2
HgeneANK2chr4:113825670chr4:113350305ENST00000357077+1461450_1535-183958DomainDeath 1
HgeneANK2chr4:113825670chr4:113350305ENST00000357077+1463569_3653-183958DomainDeath 2
HgeneANK2chr4:113825670chr4:113350305ENST00000357077+146968_1156-183958DomainZU5 1
HgeneANK2chr4:113825670chr4:113350305ENST00000394537+1451158_1304-181873DomainZU5 2
HgeneANK2chr4:113825670chr4:113350305ENST00000394537+1451450_1535-181873DomainDeath 1
HgeneANK2chr4:113825670chr4:113350305ENST00000394537+1453569_3653-181873DomainDeath 2
HgeneANK2chr4:113825670chr4:113350305ENST00000394537+145968_1156-181873DomainZU5 1
HgeneANK2chr4:113825670chr4:113350305ENST00000506722+2471158_130471864DomainZU5 2
HgeneANK2chr4:113825670chr4:113350305ENST00000506722+2471450_153571864DomainDeath 1
HgeneANK2chr4:113825670chr4:113350305ENST00000506722+2473569_365371864DomainDeath 2
HgeneANK2chr4:113825670chr4:113350305ENST00000506722+247968_115671864DomainZU5 1
HgeneANK2chr4:113825670chr4:113350305ENST00000510275+1141158_1304-2556DomainZU5 2
HgeneANK2chr4:113825670chr4:113350305ENST00000510275+1141450_1535-2556DomainDeath 1
HgeneANK2chr4:113825670chr4:113350305ENST00000510275+1143569_3653-2556DomainDeath 2
HgeneANK2chr4:113825670chr4:113350305ENST00000510275+114968_1156-2556DomainZU5 1
HgeneANK2chr4:113825670chr4:113350305ENST00000357077+1461289_1423-183958RegionNote=UPA domain
HgeneANK2chr4:113825670chr4:113350305ENST00000357077+1461806_1983-183958RegionNote=Repeat-rich region
HgeneANK2chr4:113825670chr4:113350305ENST00000394537+1451289_1423-181873RegionNote=UPA domain
HgeneANK2chr4:113825670chr4:113350305ENST00000394537+1451806_1983-181873RegionNote=Repeat-rich region
HgeneANK2chr4:113825670chr4:113350305ENST00000506722+2471289_142371864RegionNote=UPA domain
HgeneANK2chr4:113825670chr4:113350305ENST00000506722+2471806_198371864RegionNote=Repeat-rich region
HgeneANK2chr4:113825670chr4:113350305ENST00000510275+1141289_1423-2556RegionNote=UPA domain
HgeneANK2chr4:113825670chr4:113350305ENST00000510275+1141806_1983-2556RegionNote=Repeat-rich region
HgeneANK2chr4:113825670chr4:113350305ENST00000357077+146129_158-183958RepeatNote=ANK 4
HgeneANK2chr4:113825670chr4:113350305ENST00000357077+146162_191-183958RepeatNote=ANK 5
HgeneANK2chr4:113825670chr4:113350305ENST00000357077+1461806_1817-183958RepeatNote=Repeat A
HgeneANK2chr4:113825670chr4:113350305ENST00000357077+1461818_1829-183958RepeatNote=Repeat A
HgeneANK2chr4:113825670chr4:113350305ENST00000357077+1461830_1841-183958RepeatNote=Repeat A
HgeneANK2chr4:113825670chr4:113350305ENST00000357077+1461842_1853-183958RepeatNote=Repeat A
HgeneANK2chr4:113825670chr4:113350305ENST00000357077+1461854_1865-183958RepeatNote=Repeat A
HgeneANK2chr4:113825670chr4:113350305ENST00000357077+1461866_1877-183958RepeatNote=Repeat A
HgeneANK2chr4:113825670chr4:113350305ENST00000357077+1461878_1889-183958RepeatNote=Repeat A
HgeneANK2chr4:113825670chr4:113350305ENST00000357077+1461890_1900-183958RepeatNote=Repeat A%3B approximate
HgeneANK2chr4:113825670chr4:113350305ENST00000357077+1461901_1912-183958RepeatNote=Repeat A
HgeneANK2chr4:113825670chr4:113350305ENST00000357077+1461913_1924-183958RepeatNote=Repeat A
HgeneANK2chr4:113825670chr4:113350305ENST00000357077+1461925_1935-183958RepeatNote=Repeat A%3B approximate
HgeneANK2chr4:113825670chr4:113350305ENST00000357077+1461936_1947-183958RepeatNote=Repeat A
HgeneANK2chr4:113825670chr4:113350305ENST00000357077+146193_220-183958RepeatNote=ANK 6
HgeneANK2chr4:113825670chr4:113350305ENST00000357077+1461948_1959-183958RepeatNote=Repeat A
HgeneANK2chr4:113825670chr4:113350305ENST00000357077+1461960_1971-183958RepeatNote=Repeat A
HgeneANK2chr4:113825670chr4:113350305ENST00000357077+1461972_1983-183958RepeatNote=Repeat A
HgeneANK2chr4:113825670chr4:113350305ENST00000357077+146232_261-183958RepeatNote=ANK 7
HgeneANK2chr4:113825670chr4:113350305ENST00000357077+146265_294-183958RepeatNote=ANK 8
HgeneANK2chr4:113825670chr4:113350305ENST00000357077+146298_327-183958RepeatNote=ANK 9
HgeneANK2chr4:113825670chr4:113350305ENST00000357077+14630_62-183958RepeatNote=ANK 1
HgeneANK2chr4:113825670chr4:113350305ENST00000357077+146331_360-183958RepeatNote=ANK 10
HgeneANK2chr4:113825670chr4:113350305ENST00000357077+146364_393-183958RepeatNote=ANK 11
HgeneANK2chr4:113825670chr4:113350305ENST00000357077+146397_426-183958RepeatNote=ANK 12
HgeneANK2chr4:113825670chr4:113350305ENST00000357077+146430_459-183958RepeatNote=ANK 13
HgeneANK2chr4:113825670chr4:113350305ENST00000357077+146463_492-183958RepeatNote=ANK 14
HgeneANK2chr4:113825670chr4:113350305ENST00000357077+146496_525-183958RepeatNote=ANK 15
HgeneANK2chr4:113825670chr4:113350305ENST00000357077+146529_558-183958RepeatNote=ANK 16
HgeneANK2chr4:113825670chr4:113350305ENST00000357077+146562_591-183958RepeatNote=ANK 17
HgeneANK2chr4:113825670chr4:113350305ENST00000357077+146595_624-183958RepeatNote=ANK 18
HgeneANK2chr4:113825670chr4:113350305ENST00000357077+146628_657-183958RepeatNote=ANK 19
HgeneANK2chr4:113825670chr4:113350305ENST00000357077+14663_92-183958RepeatNote=ANK 2
HgeneANK2chr4:113825670chr4:113350305ENST00000357077+146661_690-183958RepeatNote=ANK 20
HgeneANK2chr4:113825670chr4:113350305ENST00000357077+146694_723-183958RepeatNote=ANK 21
HgeneANK2chr4:113825670chr4:113350305ENST00000357077+146727_756-183958RepeatNote=ANK 22
HgeneANK2chr4:113825670chr4:113350305ENST00000357077+146760_789-183958RepeatNote=ANK 23
HgeneANK2chr4:113825670chr4:113350305ENST00000357077+146793_822-183958RepeatNote=ANK 24
HgeneANK2chr4:113825670chr4:113350305ENST00000357077+14696_125-183958RepeatNote=ANK 3
HgeneANK2chr4:113825670chr4:113350305ENST00000394537+145129_158-181873RepeatNote=ANK 4
HgeneANK2chr4:113825670chr4:113350305ENST00000394537+145162_191-181873RepeatNote=ANK 5
HgeneANK2chr4:113825670chr4:113350305ENST00000394537+1451806_1817-181873RepeatNote=Repeat A
HgeneANK2chr4:113825670chr4:113350305ENST00000394537+1451818_1829-181873RepeatNote=Repeat A
HgeneANK2chr4:113825670chr4:113350305ENST00000394537+1451830_1841-181873RepeatNote=Repeat A
HgeneANK2chr4:113825670chr4:113350305ENST00000394537+1451842_1853-181873RepeatNote=Repeat A
HgeneANK2chr4:113825670chr4:113350305ENST00000394537+1451854_1865-181873RepeatNote=Repeat A
HgeneANK2chr4:113825670chr4:113350305ENST00000394537+1451866_1877-181873RepeatNote=Repeat A
HgeneANK2chr4:113825670chr4:113350305ENST00000394537+1451878_1889-181873RepeatNote=Repeat A
HgeneANK2chr4:113825670chr4:113350305ENST00000394537+1451890_1900-181873RepeatNote=Repeat A%3B approximate
HgeneANK2chr4:113825670chr4:113350305ENST00000394537+1451901_1912-181873RepeatNote=Repeat A
HgeneANK2chr4:113825670chr4:113350305ENST00000394537+1451913_1924-181873RepeatNote=Repeat A
HgeneANK2chr4:113825670chr4:113350305ENST00000394537+1451925_1935-181873RepeatNote=Repeat A%3B approximate
HgeneANK2chr4:113825670chr4:113350305ENST00000394537+1451936_1947-181873RepeatNote=Repeat A
HgeneANK2chr4:113825670chr4:113350305ENST00000394537+145193_220-181873RepeatNote=ANK 6
HgeneANK2chr4:113825670chr4:113350305ENST00000394537+1451948_1959-181873RepeatNote=Repeat A
HgeneANK2chr4:113825670chr4:113350305ENST00000394537+1451960_1971-181873RepeatNote=Repeat A
HgeneANK2chr4:113825670chr4:113350305ENST00000394537+1451972_1983-181873RepeatNote=Repeat A
HgeneANK2chr4:113825670chr4:113350305ENST00000394537+145232_261-181873RepeatNote=ANK 7
HgeneANK2chr4:113825670chr4:113350305ENST00000394537+145265_294-181873RepeatNote=ANK 8
HgeneANK2chr4:113825670chr4:113350305ENST00000394537+145298_327-181873RepeatNote=ANK 9
HgeneANK2chr4:113825670chr4:113350305ENST00000394537+14530_62-181873RepeatNote=ANK 1
HgeneANK2chr4:113825670chr4:113350305ENST00000394537+145331_360-181873RepeatNote=ANK 10
HgeneANK2chr4:113825670chr4:113350305ENST00000394537+145364_393-181873RepeatNote=ANK 11
HgeneANK2chr4:113825670chr4:113350305ENST00000394537+145397_426-181873RepeatNote=ANK 12
HgeneANK2chr4:113825670chr4:113350305ENST00000394537+145430_459-181873RepeatNote=ANK 13
HgeneANK2chr4:113825670chr4:113350305ENST00000394537+145463_492-181873RepeatNote=ANK 14
HgeneANK2chr4:113825670chr4:113350305ENST00000394537+145496_525-181873RepeatNote=ANK 15
HgeneANK2chr4:113825670chr4:113350305ENST00000394537+145529_558-181873RepeatNote=ANK 16
HgeneANK2chr4:113825670chr4:113350305ENST00000394537+145562_591-181873RepeatNote=ANK 17
HgeneANK2chr4:113825670chr4:113350305ENST00000394537+145595_624-181873RepeatNote=ANK 18
HgeneANK2chr4:113825670chr4:113350305ENST00000394537+145628_657-181873RepeatNote=ANK 19
HgeneANK2chr4:113825670chr4:113350305ENST00000394537+14563_92-181873RepeatNote=ANK 2
HgeneANK2chr4:113825670chr4:113350305ENST00000394537+145661_690-181873RepeatNote=ANK 20
HgeneANK2chr4:113825670chr4:113350305ENST00000394537+145694_723-181873RepeatNote=ANK 21
HgeneANK2chr4:113825670chr4:113350305ENST00000394537+145727_756-181873RepeatNote=ANK 22
HgeneANK2chr4:113825670chr4:113350305ENST00000394537+145760_789-181873RepeatNote=ANK 23
HgeneANK2chr4:113825670chr4:113350305ENST00000394537+145793_822-181873RepeatNote=ANK 24
HgeneANK2chr4:113825670chr4:113350305ENST00000394537+14596_125-181873RepeatNote=ANK 3
HgeneANK2chr4:113825670chr4:113350305ENST00000506722+247129_15871864RepeatNote=ANK 4
HgeneANK2chr4:113825670chr4:113350305ENST00000506722+247162_19171864RepeatNote=ANK 5
HgeneANK2chr4:113825670chr4:113350305ENST00000506722+2471806_181771864RepeatNote=Repeat A
HgeneANK2chr4:113825670chr4:113350305ENST00000506722+2471818_182971864RepeatNote=Repeat A
HgeneANK2chr4:113825670chr4:113350305ENST00000506722+2471830_184171864RepeatNote=Repeat A
HgeneANK2chr4:113825670chr4:113350305ENST00000506722+2471842_185371864RepeatNote=Repeat A
HgeneANK2chr4:113825670chr4:113350305ENST00000506722+2471854_186571864RepeatNote=Repeat A
HgeneANK2chr4:113825670chr4:113350305ENST00000506722+2471866_187771864RepeatNote=Repeat A
HgeneANK2chr4:113825670chr4:113350305ENST00000506722+2471878_188971864RepeatNote=Repeat A
HgeneANK2chr4:113825670chr4:113350305ENST00000506722+2471890_190071864RepeatNote=Repeat A%3B approximate
HgeneANK2chr4:113825670chr4:113350305ENST00000506722+2471901_191271864RepeatNote=Repeat A
HgeneANK2chr4:113825670chr4:113350305ENST00000506722+2471913_192471864RepeatNote=Repeat A
HgeneANK2chr4:113825670chr4:113350305ENST00000506722+2471925_193571864RepeatNote=Repeat A%3B approximate
HgeneANK2chr4:113825670chr4:113350305ENST00000506722+2471936_194771864RepeatNote=Repeat A
HgeneANK2chr4:113825670chr4:113350305ENST00000506722+247193_22071864RepeatNote=ANK 6
HgeneANK2chr4:113825670chr4:113350305ENST00000506722+2471948_195971864RepeatNote=Repeat A
HgeneANK2chr4:113825670chr4:113350305ENST00000506722+2471960_197171864RepeatNote=Repeat A
HgeneANK2chr4:113825670chr4:113350305ENST00000506722+2471972_198371864RepeatNote=Repeat A
HgeneANK2chr4:113825670chr4:113350305ENST00000506722+247232_26171864RepeatNote=ANK 7
HgeneANK2chr4:113825670chr4:113350305ENST00000506722+247265_29471864RepeatNote=ANK 8
HgeneANK2chr4:113825670chr4:113350305ENST00000506722+247298_32771864RepeatNote=ANK 9
HgeneANK2chr4:113825670chr4:113350305ENST00000506722+24730_6271864RepeatNote=ANK 1
HgeneANK2chr4:113825670chr4:113350305ENST00000506722+247331_36071864RepeatNote=ANK 10
HgeneANK2chr4:113825670chr4:113350305ENST00000506722+247364_39371864RepeatNote=ANK 11
HgeneANK2chr4:113825670chr4:113350305ENST00000506722+247397_42671864RepeatNote=ANK 12
HgeneANK2chr4:113825670chr4:113350305ENST00000506722+247430_45971864RepeatNote=ANK 13
HgeneANK2chr4:113825670chr4:113350305ENST00000506722+247463_49271864RepeatNote=ANK 14
HgeneANK2chr4:113825670chr4:113350305ENST00000506722+247496_52571864RepeatNote=ANK 15
HgeneANK2chr4:113825670chr4:113350305ENST00000506722+247529_55871864RepeatNote=ANK 16
HgeneANK2chr4:113825670chr4:113350305ENST00000506722+247562_59171864RepeatNote=ANK 17
HgeneANK2chr4:113825670chr4:113350305ENST00000506722+247595_62471864RepeatNote=ANK 18
HgeneANK2chr4:113825670chr4:113350305ENST00000506722+247628_65771864RepeatNote=ANK 19
HgeneANK2chr4:113825670chr4:113350305ENST00000506722+24763_9271864RepeatNote=ANK 2
HgeneANK2chr4:113825670chr4:113350305ENST00000506722+247661_69071864RepeatNote=ANK 20
HgeneANK2chr4:113825670chr4:113350305ENST00000506722+247694_72371864RepeatNote=ANK 21
HgeneANK2chr4:113825670chr4:113350305ENST00000506722+247727_75671864RepeatNote=ANK 22
HgeneANK2chr4:113825670chr4:113350305ENST00000506722+247760_78971864RepeatNote=ANK 23
HgeneANK2chr4:113825670chr4:113350305ENST00000506722+247793_82271864RepeatNote=ANK 24
HgeneANK2chr4:113825670chr4:113350305ENST00000506722+24796_12571864RepeatNote=ANK 3
HgeneANK2chr4:113825670chr4:113350305ENST00000510275+114129_158-2556RepeatNote=ANK 4
HgeneANK2chr4:113825670chr4:113350305ENST00000510275+114162_191-2556RepeatNote=ANK 5
HgeneANK2chr4:113825670chr4:113350305ENST00000510275+1141806_1817-2556RepeatNote=Repeat A
HgeneANK2chr4:113825670chr4:113350305ENST00000510275+1141818_1829-2556RepeatNote=Repeat A
HgeneANK2chr4:113825670chr4:113350305ENST00000510275+1141830_1841-2556RepeatNote=Repeat A
HgeneANK2chr4:113825670chr4:113350305ENST00000510275+1141842_1853-2556RepeatNote=Repeat A
HgeneANK2chr4:113825670chr4:113350305ENST00000510275+1141854_1865-2556RepeatNote=Repeat A
HgeneANK2chr4:113825670chr4:113350305ENST00000510275+1141866_1877-2556RepeatNote=Repeat A
HgeneANK2chr4:113825670chr4:113350305ENST00000510275+1141878_1889-2556RepeatNote=Repeat A
HgeneANK2chr4:113825670chr4:113350305ENST00000510275+1141890_1900-2556RepeatNote=Repeat A%3B approximate
HgeneANK2chr4:113825670chr4:113350305ENST00000510275+1141901_1912-2556RepeatNote=Repeat A
HgeneANK2chr4:113825670chr4:113350305ENST00000510275+1141913_1924-2556RepeatNote=Repeat A
HgeneANK2chr4:113825670chr4:113350305ENST00000510275+1141925_1935-2556RepeatNote=Repeat A%3B approximate
HgeneANK2chr4:113825670chr4:113350305ENST00000510275+1141936_1947-2556RepeatNote=Repeat A
HgeneANK2chr4:113825670chr4:113350305ENST00000510275+114193_220-2556RepeatNote=ANK 6
HgeneANK2chr4:113825670chr4:113350305ENST00000510275+1141948_1959-2556RepeatNote=Repeat A
HgeneANK2chr4:113825670chr4:113350305ENST00000510275+1141960_1971-2556RepeatNote=Repeat A
HgeneANK2chr4:113825670chr4:113350305ENST00000510275+1141972_1983-2556RepeatNote=Repeat A
HgeneANK2chr4:113825670chr4:113350305ENST00000510275+114232_261-2556RepeatNote=ANK 7
HgeneANK2chr4:113825670chr4:113350305ENST00000510275+114265_294-2556RepeatNote=ANK 8
HgeneANK2chr4:113825670chr4:113350305ENST00000510275+114298_327-2556RepeatNote=ANK 9
HgeneANK2chr4:113825670chr4:113350305ENST00000510275+11430_62-2556RepeatNote=ANK 1
HgeneANK2chr4:113825670chr4:113350305ENST00000510275+114331_360-2556RepeatNote=ANK 10
HgeneANK2chr4:113825670chr4:113350305ENST00000510275+114364_393-2556RepeatNote=ANK 11
HgeneANK2chr4:113825670chr4:113350305ENST00000510275+114397_426-2556RepeatNote=ANK 12
HgeneANK2chr4:113825670chr4:113350305ENST00000510275+114430_459-2556RepeatNote=ANK 13
HgeneANK2chr4:113825670chr4:113350305ENST00000510275+114463_492-2556RepeatNote=ANK 14
HgeneANK2chr4:113825670chr4:113350305ENST00000510275+114496_525-2556RepeatNote=ANK 15
HgeneANK2chr4:113825670chr4:113350305ENST00000510275+114529_558-2556RepeatNote=ANK 16
HgeneANK2chr4:113825670chr4:113350305ENST00000510275+114562_591-2556RepeatNote=ANK 17
HgeneANK2chr4:113825670chr4:113350305ENST00000510275+114595_624-2556RepeatNote=ANK 18
HgeneANK2chr4:113825670chr4:113350305ENST00000510275+114628_657-2556RepeatNote=ANK 19
HgeneANK2chr4:113825670chr4:113350305ENST00000510275+11463_92-2556RepeatNote=ANK 2
HgeneANK2chr4:113825670chr4:113350305ENST00000510275+114661_690-2556RepeatNote=ANK 20
HgeneANK2chr4:113825670chr4:113350305ENST00000510275+114694_723-2556RepeatNote=ANK 21
HgeneANK2chr4:113825670chr4:113350305ENST00000510275+114727_756-2556RepeatNote=ANK 22
HgeneANK2chr4:113825670chr4:113350305ENST00000510275+114760_789-2556RepeatNote=ANK 23
HgeneANK2chr4:113825670chr4:113350305ENST00000510275+114793_822-2556RepeatNote=ANK 24
HgeneANK2chr4:113825670chr4:113350305ENST00000510275+11496_125-2556RepeatNote=ANK 3
TgeneALPK1chr4:113825670chr4:113350305ENST00000177648+816105_1092651245Compositional biasNote=Poly-Ala
TgeneALPK1chr4:113825670chr4:113350305ENST00000458497+816105_1092651245Compositional biasNote=Poly-Ala
TgeneALPK1chr4:113825670chr4:113350305ENST00000504176+715105_1091871167Compositional biasNote=Poly-Ala


Top

FusionGeneSequence for ANK2_ALPK1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ANK2_ENST00000506722_chr4_113825670_+_ALPK1_ENST00000458497_chr4_113350305_+_987aa
MTTMLQKSLLKEFDHHLLSAAEACKLAAAFSAYTPLFVLTAVNIRGTCLLSYSSSNDCPPELKNLHLCEAKEAFEIGLLTKRDDEPVTGK
QELHSFVKAAFGLTTVHRRLHGETGTVHAASQLCKEAMGKLYNFSTSSRSQDREALSQEVMSVIAQVKEHLQVQSFSNVDDRSYVPESFE
CRLDKLILHGQGDFQKILDTYSQHHTSVCEVFESDCGNNKNEQKDAKTGVCITALKTEIKNIDTVSTTQEKPHCQRDTGISSSLMGKNVQ
RELRRGGRRNWTHSDAFRVSLDQDVETETEPSDYSNGEGAVFNKSLSGSQTSSAWSNLSGFSSSASWEEVNYHVDDRSARKEPGKEHLVD
TQCSTALSEELENDREGRAMHSLHSQLHDLSLQEPNNDNLEPSQNQPQQQMPLTPFSPHNTPGIFLAPGAGLLEGAPEGIQEVRNMGPRN
TSAHSRPSYRSASWSSDSGRPKNMGTHPSVQKEEAFEIIVEFPETNCDVKDRQGKEQGEEISERGAGPTFKASPSWVDPEGETAESTEDA
PLDFHRVLHNSLGNISMLPCSSFTPNWPVQNPDSRKSGGPVAEQGIDPDASTVDEEGQLLDSMDVPCTNGHGSHRLCILRQPPGQRAETP
NSSVSGNILFPVLSEDCTTTEEGNQPGNMLNCSQNSSSSSVWWLKSPAFSSGSSEGDSPWSYLNSSGSSWVSLPGKMRKEILEARTLQPD
DFEKLLAGVRHDWLFQRLENTGVFKPSQLHRAHSALLLKYSKKSELWTAQETIVYLGDYLTVKKKGRQRNAFWVHHLHQEEILGRYVGKD
YKEQKGLWHHFTDVERQMTAQHYVTEFNKRLYEQNIPTQIFYIPSTILLILEDKTIKGCISVEPYILGEFVKLSNNTKVVKTEYKATEYG

>In-frame_ANK2_ENST00000506722_chr4_113825670_+_ALPK1_ENST00000177648_chr4_113350305_+_987aa
MTTMLQKSLLKEFDHHLLSAAEACKLAAAFSAYTPLFVLTAVNIRGTCLLSYSSSNDCPPELKNLHLCEAKEAFEIGLLTKRDDEPVTGK
QELHSFVKAAFGLTTVHRRLHGETGTVHAASQLCKEAMGKLYNFSTSSRSQDREALSQEVMSVIAQVKEHLQVQSFSNVDDRSYVPESFE
CRLDKLILHGQGDFQKILDTYSQHHTSVCEVFESDCGNNKNEQKDAKTGVCITALKTEIKNIDTVSTTQEKPHCQRDTGISSSLMGKNVQ
RELRRGGRRNWTHSDAFRVSLDQDVETETEPSDYSNGEGAVFNKSLSGSQTSSAWSNLSGFSSSASWEEVNYHVDDRSARKEPGKEHLVD
TQCSTALSEELENDREGRAMHSLHSQLHDLSLQEPNNDNLEPSQNQPQQQMPLTPFSPHNTPGIFLAPGAGLLEGAPEGIQEVRNMGPRN
TSAHSRPSYRSASWSSDSGRPKNMGTHPSVQKEEAFEIIVEFPETNCDVKDRQGKEQGEEISERGAGPTFKASPSWVDPEGETAESTEDA
PLDFHRVLHNSLGNISMLPCSSFTPNWPVQNPDSRKSGGPVAEQGIDPDASTVDEEGQLLDSMDVPCTNGHGSHRLCILRQPPGQRAETP
NSSVSGNILFPVLSEDCTTTEEGNQPGNMLNCSQNSSSSSVWWLKSPAFSSGSSEGDSPWSYLNSSGSSWVSLPGKMRKEILEARTLQPD
DFEKLLAGVRHDWLFQRLENTGVFKPSQLHRAHSALLLKYSKKSELWTAQETIVYLGDYLTVKKKGRQRNAFWVHHLHQEEILGRYVGKD
YKEQKGLWHHFTDVERQMTAQHYVTEFNKRLYEQNIPTQIFYIPSTILLILEDKTIKGCISVEPYILGEFVKLSNNTKVVKTEYKATEYG

>In-frame_ANK2_ENST00000506722_chr4_113825670_+_ALPK1_ENST00000504176_chr4_113350305_+_987aa
MTTMLQKSLLKEFDHHLLSAAEACKLAAAFSAYTPLFVLTAVNIRGTCLLSYSSSNDCPPELKNLHLCEAKEAFEIGLLTKRDDEPVTGK
QELHSFVKAAFGLTTVHRRLHGETGTVHAASQLCKEAMGKLYNFSTSSRSQDREALSQEVMSVIAQVKEHLQVQSFSNVDDRSYVPESFE
CRLDKLILHGQGDFQKILDTYSQHHTSVCEVFESDCGNNKNEQKDAKTGVCITALKTEIKNIDTVSTTQEKPHCQRDTGISSSLMGKNVQ
RELRRGGRRNWTHSDAFRVSLDQDVETETEPSDYSNGEGAVFNKSLSGSQTSSAWSNLSGFSSSASWEEVNYHVDDRSARKEPGKEHLVD
TQCSTALSEELENDREGRAMHSLHSQLHDLSLQEPNNDNLEPSQNQPQQQMPLTPFSPHNTPGIFLAPGAGLLEGAPEGIQEVRNMGPRN
TSAHSRPSYRSASWSSDSGRPKNMGTHPSVQKEEAFEIIVEFPETNCDVKDRQGKEQGEEISERGAGPTFKASPSWVDPEGETAESTEDA
PLDFHRVLHNSLGNISMLPCSSFTPNWPVQNPDSRKSGGPVAEQGIDPDASTVDEEGQLLDSMDVPCTNGHGSHRLCILRQPPGQRAETP
NSSVSGNILFPVLSEDCTTTEEGNQPGNMLNCSQNSSSSSVWWLKSPAFSSGSSEGDSPWSYLNSSGSSWVSLPGKMRKEILEARTLQPD
DFEKLLAGVRHDWLFQRLENTGVFKPSQLHRAHSALLLKYSKKSELWTAQETIVYLGDYLTVKKKGRQRNAFWVHHLHQEEILGRYVGKD
YKEQKGLWHHFTDVERQMTAQHYVTEFNKRLYEQNIPTQIFYIPSTILLILEDKTIKGCISVEPYILGEFVKLSNNTKVVKTEYKATEYG


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ANK2_ENST00000506722_chr4_113825670_+_ALPK1_ENST00000458497_chr4_113350305_+_2961nt
ATGACCACCATGTTGCAAAAGAGCCTGCTGAAGGAGTTTGACCACCATTTGCTGTCCGCTGCAGAAGCCTGCAAGCTGGCAGCTGCCTTC
AGTGCCTATACGCCGCTCTTCGTGCTCACAGCTGTGAATATCCGTGGCACGTGTTTATTGTCCTACAGTAGTTCAAATGACTGTCCTCCA
GAATTGAAAAACTTACATCTGTGTGAAGCCAAAGAGGCCTTTGAGATTGGCCTCCTCACCAAGAGAGATGATGAGCCTGTTACTGGAAAA
CAGGAGCTTCACAGCTTTGTCAAAGCTGCTTTCGGTCTCACCACAGTGCACAGAAGGCTCCATGGGGAGACAGGGACGGTCCATGCAGCA
AGTCAGCTCTGTAAGGAAGCAATGGGGAAGCTGTACAATTTCAGCACTTCCTCCAGAAGTCAGGACAGAGAAGCTCTGTCTCAAGAAGTT
ATGTCTGTGATTGCCCAGGTGAAGGAACATTTACAAGTTCAAAGCTTCTCAAATGTAGATGACAGATCTTATGTTCCCGAGAGTTTCGAG
TGCAGGTTGGATAAACTTATCTTGCATGGGCAAGGGGATTTCCAAAAAATCCTTGACACCTATTCACAGCACCATACTTCGGTGTGTGAA
GTATTTGAAAGTGATTGTGGAAACAACAAAAATGAACAGAAAGATGCAAAAACAGGAGTCTGCATCACTGCTCTAAAAACAGAAATAAAA
AACATAGATACTGTGAGTACTACTCAAGAAAAGCCACATTGTCAAAGAGACACAGGAATATCTTCCTCCCTAATGGGTAAGAATGTTCAG
AGGGAACTCAGAAGGGGAGGAAGGAGAAACTGGACCCATTCTGATGCATTTCGAGTCTCCTTGGATCAAGATGTGGAGACTGAGACTGAG
CCATCGGACTACAGCAATGGTGAGGGAGCTGTTTTCAACAAGTCTCTGAGTGGCAGCCAGACTTCCAGTGCTTGGAGCAACTTATCAGGG
TTTAGTTCCTCTGCAAGCTGGGAGGAAGTGAATTATCACGTTGACGACAGGTCAGCCAGAAAAGAGCCTGGCAAAGAACATCTGGTGGAC
ACTCAGTGTTCCACTGCCTTGTCTGAGGAGCTAGAGAATGACAGGGAAGGCAGAGCTATGCATTCATTGCATTCACAGCTTCATGATCTC
TCTCTTCAGGAACCCAACAATGACAATTTGGAGCCTTCTCAAAATCAGCCACAGCAACAGATGCCCTTGACACCCTTCTCGCCTCATAAT
ACCCCAGGCATTTTCTTGGCCCCTGGTGCAGGGCTTCTAGAAGGAGCTCCAGAAGGTATCCAGGAAGTCAGAAATATGGGACCCAGAAAT
ACTTCTGCTCACTCCAGACCCTCATATCGTTCTGCTTCTTGGTCTTCTGATTCTGGTAGGCCCAAGAATATGGGCACACATCCTTCAGTC
CAAAAAGAAGAAGCCTTTGAAATAATTGTTGAGTTTCCAGAAACCAACTGCGATGTCAAAGACAGGCAGGGGAAAGAGCAGGGAGAAGAA
ATTAGTGAAAGAGGCGCAGGCCCTACATTTAAAGCTAGTCCCTCCTGGGTTGACCCAGAAGGAGAAACAGCAGAAAGCACTGAAGATGCA
CCCTTAGACTTTCACAGGGTCCTGCACAATTCTCTGGGAAACATTTCCATGCTGCCATGTAGCTCCTTCACCCCTAATTGGCCTGTTCAA
AATCCTGACTCCAGAAAAAGTGGTGGCCCAGTCGCAGAGCAGGGCATCGACCCTGATGCCTCCACAGTGGATGAGGAGGGGCAACTGCTC
GACAGCATGGATGTTCCCTGCACAAATGGGCACGGCTCTCATAGACTGTGCATTCTGAGACAGCCGCCTGGTCAGAGGGCGGAGACCCCC
AATTCCTCTGTAAGCGGTAACATCCTCTTCCCTGTCCTCAGCGAGGACTGCACTACCACAGAGGAAGGAAATCAGCCTGGAAACATGCTA
AACTGCAGCCAGAACTCCAGCTCATCCTCAGTGTGGTGGCTGAAATCACCTGCATTTTCCAGTGGTTCTTCTGAGGGGGACAGCCCTTGG
TCCTATCTGAATTCCAGTGGGAGTTCTTGGGTTTCATTGCCGGGAAAGATGAGGAAAGAGATCCTTGAGGCTCGCACCTTGCAACCTGAT
GACTTTGAAAAGCTGTTGGCAGGAGTGAGGCATGATTGGCTGTTTCAGAGACTAGAGAATACGGGGGTTTTTAAGCCCAGTCAACTCCAC
CGAGCACATAGTGCTCTTTTGTTAAAATATTCAAAAAAATCTGAACTGTGGACGGCCCAGGAAACTATTGTCTATTTGGGGGACTACTTG
ACTGTGAAGAAAAAAGGCAGACAAAGAAATGCTTTTTGGGTTCATCATCTTCATCAAGAAGAAATTCTGGGGAGGTATGTTGGGAAAGAC
TATAAGGAGCAGAAGGGGCTCTGGCACCACTTCACTGATGTGGAGCGACAGATGACCGCACAGCACTATGTGACAGAATTTAACAAGAGA
CTCTATGAACAAAACATTCCCACCCAGATATTCTACATCCCATCCACAATACTACTGATTTTAGAGGACAAGACAATAAAGGGATGTATC
AGTGTGGAGCCTTACATACTGGGAGAATTTGTAAAATTGTCAAATAACACGAAAGTGGTGAAAACAGAATACAAAGCCACAGAATATGGC
TTGGCCTATGGCCATTTTTCTTATGAGTTTTCTAATCATAGAGATGTTGTGGTCGATTTACAAGGTTGGGTAACCGGTAATGGAAAAGGA
CTCATCTACCTCACAGATCCCCAGATTCACTCCGTTGATCAGAAAGTTTTCACTACCAATTTTGGAAAGAGAGGAATTTTTTACTTCTTT

>In-frame_ANK2_ENST00000506722_chr4_113825670_+_ALPK1_ENST00000177648_chr4_113350305_+_2961nt
ATGACCACCATGTTGCAAAAGAGCCTGCTGAAGGAGTTTGACCACCATTTGCTGTCCGCTGCAGAAGCCTGCAAGCTGGCAGCTGCCTTC
AGTGCCTATACGCCGCTCTTCGTGCTCACAGCTGTGAATATCCGTGGCACGTGTTTATTGTCCTACAGTAGTTCAAATGACTGTCCTCCA
GAATTGAAAAACTTACATCTGTGTGAAGCCAAAGAGGCCTTTGAGATTGGCCTCCTCACCAAGAGAGATGATGAGCCTGTTACTGGAAAA
CAGGAGCTTCACAGCTTTGTCAAAGCTGCTTTCGGTCTCACCACAGTGCACAGAAGGCTCCATGGGGAGACAGGGACGGTCCATGCAGCA
AGTCAGCTCTGTAAGGAAGCAATGGGGAAGCTGTACAATTTCAGCACTTCCTCCAGAAGTCAGGACAGAGAAGCTCTGTCTCAAGAAGTT
ATGTCTGTGATTGCCCAGGTGAAGGAACATTTACAAGTTCAAAGCTTCTCAAATGTAGATGACAGATCTTATGTTCCCGAGAGTTTCGAG
TGCAGGTTGGATAAACTTATCTTGCATGGGCAAGGGGATTTCCAAAAAATCCTTGACACCTATTCACAGCACCATACTTCGGTGTGTGAA
GTATTTGAAAGTGATTGTGGAAACAACAAAAATGAACAGAAAGATGCAAAAACAGGAGTCTGCATCACTGCTCTAAAAACAGAAATAAAA
AACATAGATACTGTGAGTACTACTCAAGAAAAGCCACATTGTCAAAGAGACACAGGAATATCTTCCTCCCTAATGGGTAAGAATGTTCAG
AGGGAACTCAGAAGGGGAGGAAGGAGAAACTGGACCCATTCTGATGCATTTCGAGTCTCCTTGGATCAAGATGTGGAGACTGAGACTGAG
CCATCGGACTACAGCAATGGTGAGGGAGCTGTTTTCAACAAGTCTCTGAGTGGCAGCCAGACTTCCAGTGCTTGGAGCAACTTATCAGGG
TTTAGTTCCTCTGCAAGCTGGGAGGAAGTGAATTATCACGTTGACGACAGGTCAGCCAGAAAAGAGCCTGGCAAAGAACATCTGGTGGAC
ACTCAGTGTTCCACTGCCTTGTCTGAGGAGCTAGAGAATGACAGGGAAGGCAGAGCTATGCATTCATTGCATTCACAGCTTCATGATCTC
TCTCTTCAGGAACCCAACAATGACAATTTGGAGCCTTCTCAAAATCAGCCACAGCAACAGATGCCCTTGACACCCTTCTCGCCTCATAAT
ACCCCAGGCATTTTCTTGGCCCCTGGTGCAGGGCTTCTAGAAGGAGCTCCAGAAGGTATCCAGGAAGTCAGAAATATGGGACCCAGAAAT
ACTTCTGCTCACTCCAGACCCTCATATCGTTCTGCTTCTTGGTCTTCTGATTCTGGTAGGCCCAAGAATATGGGCACACATCCTTCAGTC
CAAAAAGAAGAAGCCTTTGAAATAATTGTTGAGTTTCCAGAAACCAACTGCGATGTCAAAGACAGGCAGGGGAAAGAGCAGGGAGAAGAA
ATTAGTGAAAGAGGCGCAGGCCCTACATTTAAAGCTAGTCCCTCCTGGGTTGACCCAGAAGGAGAAACAGCAGAAAGCACTGAAGATGCA
CCCTTAGACTTTCACAGGGTCCTGCACAATTCTCTGGGAAACATTTCCATGCTGCCATGTAGCTCCTTCACCCCTAATTGGCCTGTTCAA
AATCCTGACTCCAGAAAAAGTGGTGGCCCAGTCGCAGAGCAGGGCATCGACCCTGATGCCTCCACAGTGGATGAGGAGGGGCAACTGCTC
GACAGCATGGATGTTCCCTGCACAAATGGGCACGGCTCTCATAGACTGTGCATTCTGAGACAGCCGCCTGGTCAGAGGGCGGAGACCCCC
AATTCCTCTGTAAGCGGTAACATCCTCTTCCCTGTCCTCAGCGAGGACTGCACTACCACAGAGGAAGGAAATCAGCCTGGAAACATGCTA
AACTGCAGCCAGAACTCCAGCTCATCCTCAGTGTGGTGGCTGAAATCACCTGCATTTTCCAGTGGTTCTTCTGAGGGGGACAGCCCTTGG
TCCTATCTGAATTCCAGTGGGAGTTCTTGGGTTTCATTGCCGGGAAAGATGAGGAAAGAGATCCTTGAGGCTCGCACCTTGCAACCTGAT
GACTTTGAAAAGCTGTTGGCAGGAGTGAGGCATGATTGGCTGTTTCAGAGACTAGAGAATACGGGGGTTTTTAAGCCCAGTCAACTCCAC
CGAGCACATAGTGCTCTTTTGTTAAAATATTCAAAAAAATCTGAACTGTGGACGGCCCAGGAAACTATTGTCTATTTGGGGGACTACTTG
ACTGTGAAGAAAAAAGGCAGACAAAGAAATGCTTTTTGGGTTCATCATCTTCATCAAGAAGAAATTCTGGGGAGGTATGTTGGGAAAGAC
TATAAGGAGCAGAAGGGGCTCTGGCACCACTTCACTGATGTGGAGCGACAGATGACCGCACAGCACTATGTGACAGAATTTAACAAGAGA
CTCTATGAACAAAACATTCCCACCCAGATATTCTACATCCCATCCACAATACTACTGATTTTAGAGGACAAGACAATAAAGGGATGTATC
AGTGTGGAGCCTTACATACTGGGAGAATTTGTAAAATTGTCAAATAACACGAAAGTGGTGAAAACAGAATACAAAGCCACAGAATATGGC
TTGGCCTATGGCCATTTTTCTTATGAGTTTTCTAATCATAGAGATGTTGTGGTCGATTTACAAGGTTGGGTAACCGGTAATGGAAAAGGA
CTCATCTACCTCACAGATCCCCAGATTCACTCCGTTGATCAGAAAGTTTTCACTACCAATTTTGGAAAGAGAGGAATTTTTTACTTCTTT

>In-frame_ANK2_ENST00000506722_chr4_113825670_+_ALPK1_ENST00000504176_chr4_113350305_+_2961nt
ATGACCACCATGTTGCAAAAGAGCCTGCTGAAGGAGTTTGACCACCATTTGCTGTCCGCTGCAGAAGCCTGCAAGCTGGCAGCTGCCTTC
AGTGCCTATACGCCGCTCTTCGTGCTCACAGCTGTGAATATCCGTGGCACGTGTTTATTGTCCTACAGTAGTTCAAATGACTGTCCTCCA
GAATTGAAAAACTTACATCTGTGTGAAGCCAAAGAGGCCTTTGAGATTGGCCTCCTCACCAAGAGAGATGATGAGCCTGTTACTGGAAAA
CAGGAGCTTCACAGCTTTGTCAAAGCTGCTTTCGGTCTCACCACAGTGCACAGAAGGCTCCATGGGGAGACAGGGACGGTCCATGCAGCA
AGTCAGCTCTGTAAGGAAGCAATGGGGAAGCTGTACAATTTCAGCACTTCCTCCAGAAGTCAGGACAGAGAAGCTCTGTCTCAAGAAGTT
ATGTCTGTGATTGCCCAGGTGAAGGAACATTTACAAGTTCAAAGCTTCTCAAATGTAGATGACAGATCTTATGTTCCCGAGAGTTTCGAG
TGCAGGTTGGATAAACTTATCTTGCATGGGCAAGGGGATTTCCAAAAAATCCTTGACACCTATTCACAGCACCATACTTCGGTGTGTGAA
GTATTTGAAAGTGATTGTGGAAACAACAAAAATGAACAGAAAGATGCAAAAACAGGAGTCTGCATCACTGCTCTAAAAACAGAAATAAAA
AACATAGATACTGTGAGTACTACTCAAGAAAAGCCACATTGTCAAAGAGACACAGGAATATCTTCCTCCCTAATGGGTAAGAATGTTCAG
AGGGAACTCAGAAGGGGAGGAAGGAGAAACTGGACCCATTCTGATGCATTTCGAGTCTCCTTGGATCAAGATGTGGAGACTGAGACTGAG
CCATCGGACTACAGCAATGGTGAGGGAGCTGTTTTCAACAAGTCTCTGAGTGGCAGCCAGACTTCCAGTGCTTGGAGCAACTTATCAGGG
TTTAGTTCCTCTGCAAGCTGGGAGGAAGTGAATTATCACGTTGACGACAGGTCAGCCAGAAAAGAGCCTGGCAAAGAACATCTGGTGGAC
ACTCAGTGTTCCACTGCCTTGTCTGAGGAGCTAGAGAATGACAGGGAAGGCAGAGCTATGCATTCATTGCATTCACAGCTTCATGATCTC
TCTCTTCAGGAACCCAACAATGACAATTTGGAGCCTTCTCAAAATCAGCCACAGCAACAGATGCCCTTGACACCCTTCTCGCCTCATAAT
ACCCCAGGCATTTTCTTGGCCCCTGGTGCAGGGCTTCTAGAAGGAGCTCCAGAAGGTATCCAGGAAGTCAGAAATATGGGACCCAGAAAT
ACTTCTGCTCACTCCAGACCCTCATATCGTTCTGCTTCTTGGTCTTCTGATTCTGGTAGGCCCAAGAATATGGGCACACATCCTTCAGTC
CAAAAAGAAGAAGCCTTTGAAATAATTGTTGAGTTTCCAGAAACCAACTGCGATGTCAAAGACAGGCAGGGGAAAGAGCAGGGAGAAGAA
ATTAGTGAAAGAGGCGCAGGCCCTACATTTAAAGCTAGTCCCTCCTGGGTTGACCCAGAAGGAGAAACAGCAGAAAGCACTGAAGATGCA
CCCTTAGACTTTCACAGGGTCCTGCACAATTCTCTGGGAAACATTTCCATGCTGCCATGTAGCTCCTTCACCCCTAATTGGCCTGTTCAA
AATCCTGACTCCAGAAAAAGTGGTGGCCCAGTCGCAGAGCAGGGCATCGACCCTGATGCCTCCACAGTGGATGAGGAGGGGCAACTGCTC
GACAGCATGGATGTTCCCTGCACAAATGGGCACGGCTCTCATAGACTGTGCATTCTGAGACAGCCGCCTGGTCAGAGGGCGGAGACCCCC
AATTCCTCTGTAAGCGGTAACATCCTCTTCCCTGTCCTCAGCGAGGACTGCACTACCACAGAGGAAGGAAATCAGCCTGGAAACATGCTA
AACTGCAGCCAGAACTCCAGCTCATCCTCAGTGTGGTGGCTGAAATCACCTGCATTTTCCAGTGGTTCTTCTGAGGGGGACAGCCCTTGG
TCCTATCTGAATTCCAGTGGGAGTTCTTGGGTTTCATTGCCGGGAAAGATGAGGAAAGAGATCCTTGAGGCTCGCACCTTGCAACCTGAT
GACTTTGAAAAGCTGTTGGCAGGAGTGAGGCATGATTGGCTGTTTCAGAGACTAGAGAATACGGGGGTTTTTAAGCCCAGTCAACTCCAC
CGAGCACATAGTGCTCTTTTGTTAAAATATTCAAAAAAATCTGAACTGTGGACGGCCCAGGAAACTATTGTCTATTTGGGGGACTACTTG
ACTGTGAAGAAAAAAGGCAGACAAAGAAATGCTTTTTGGGTTCATCATCTTCATCAAGAAGAAATTCTGGGGAGGTATGTTGGGAAAGAC
TATAAGGAGCAGAAGGGGCTCTGGCACCACTTCACTGATGTGGAGCGACAGATGACCGCACAGCACTATGTGACAGAATTTAACAAGAGA
CTCTATGAACAAAACATTCCCACCCAGATATTCTACATCCCATCCACAATACTACTGATTTTAGAGGACAAGACAATAAAGGGATGTATC
AGTGTGGAGCCTTACATACTGGGAGAATTTGTAAAATTGTCAAATAACACGAAAGTGGTGAAAACAGAATACAAAGCCACAGAATATGGC
TTGGCCTATGGCCATTTTTCTTATGAGTTTTCTAATCATAGAGATGTTGTGGTCGATTTACAAGGTTGGGTAACCGGTAATGGAAAAGGA
CTCATCTACCTCACAGATCCCCAGATTCACTCCGTTGATCAGAAAGTTTTCACTACCAATTTTGGAAAGAGAGGAATTTTTTACTTCTTT


* Fusion transcript sequences (Full-length transcript).
>In-frame_ANK2_ENST00000506722_chr4_113825670_+_ALPK1_ENST00000458497_chr4_113350305_+_4552nt
ACAGTCTGAGGCTGTAATGGGAAAGTCGGTTCCTGGGCTGCTGTCTCATAGACATCAGCTTGCAGGGAAGCTGGGGGCTCTCCGAATTGC
CCTGCTCCGGGGCCCCTCCTGCTGCGTGACTCACAGGCACATTGCAGAGAGAAGCTGCCGCTCCCAGTAAGTAATGAAAAGAGACATGAA
GAATTGGTATTTCAAATGACCACCATGTTGCAAAAGAGCCTGCTGAAGGAGTTTGACCACCATTTGCTGTCCGCTGCAGAAGCCTGCAAG
CTGGCAGCTGCCTTCAGTGCCTATACGCCGCTCTTCGTGCTCACAGCTGTGAATATCCGTGGCACGTGTTTATTGTCCTACAGTAGTTCA
AATGACTGTCCTCCAGAATTGAAAAACTTACATCTGTGTGAAGCCAAAGAGGCCTTTGAGATTGGCCTCCTCACCAAGAGAGATGATGAG
CCTGTTACTGGAAAACAGGAGCTTCACAGCTTTGTCAAAGCTGCTTTCGGTCTCACCACAGTGCACAGAAGGCTCCATGGGGAGACAGGG
ACGGTCCATGCAGCAAGTCAGCTCTGTAAGGAAGCAATGGGGAAGCTGTACAATTTCAGCACTTCCTCCAGAAGTCAGGACAGAGAAGCT
CTGTCTCAAGAAGTTATGTCTGTGATTGCCCAGGTGAAGGAACATTTACAAGTTCAAAGCTTCTCAAATGTAGATGACAGATCTTATGTT
CCCGAGAGTTTCGAGTGCAGGTTGGATAAACTTATCTTGCATGGGCAAGGGGATTTCCAAAAAATCCTTGACACCTATTCACAGCACCAT
ACTTCGGTGTGTGAAGTATTTGAAAGTGATTGTGGAAACAACAAAAATGAACAGAAAGATGCAAAAACAGGAGTCTGCATCACTGCTCTA
AAAACAGAAATAAAAAACATAGATACTGTGAGTACTACTCAAGAAAAGCCACATTGTCAAAGAGACACAGGAATATCTTCCTCCCTAATG
GGTAAGAATGTTCAGAGGGAACTCAGAAGGGGAGGAAGGAGAAACTGGACCCATTCTGATGCATTTCGAGTCTCCTTGGATCAAGATGTG
GAGACTGAGACTGAGCCATCGGACTACAGCAATGGTGAGGGAGCTGTTTTCAACAAGTCTCTGAGTGGCAGCCAGACTTCCAGTGCTTGG
AGCAACTTATCAGGGTTTAGTTCCTCTGCAAGCTGGGAGGAAGTGAATTATCACGTTGACGACAGGTCAGCCAGAAAAGAGCCTGGCAAA
GAACATCTGGTGGACACTCAGTGTTCCACTGCCTTGTCTGAGGAGCTAGAGAATGACAGGGAAGGCAGAGCTATGCATTCATTGCATTCA
CAGCTTCATGATCTCTCTCTTCAGGAACCCAACAATGACAATTTGGAGCCTTCTCAAAATCAGCCACAGCAACAGATGCCCTTGACACCC
TTCTCGCCTCATAATACCCCAGGCATTTTCTTGGCCCCTGGTGCAGGGCTTCTAGAAGGAGCTCCAGAAGGTATCCAGGAAGTCAGAAAT
ATGGGACCCAGAAATACTTCTGCTCACTCCAGACCCTCATATCGTTCTGCTTCTTGGTCTTCTGATTCTGGTAGGCCCAAGAATATGGGC
ACACATCCTTCAGTCCAAAAAGAAGAAGCCTTTGAAATAATTGTTGAGTTTCCAGAAACCAACTGCGATGTCAAAGACAGGCAGGGGAAA
GAGCAGGGAGAAGAAATTAGTGAAAGAGGCGCAGGCCCTACATTTAAAGCTAGTCCCTCCTGGGTTGACCCAGAAGGAGAAACAGCAGAA
AGCACTGAAGATGCACCCTTAGACTTTCACAGGGTCCTGCACAATTCTCTGGGAAACATTTCCATGCTGCCATGTAGCTCCTTCACCCCT
AATTGGCCTGTTCAAAATCCTGACTCCAGAAAAAGTGGTGGCCCAGTCGCAGAGCAGGGCATCGACCCTGATGCCTCCACAGTGGATGAG
GAGGGGCAACTGCTCGACAGCATGGATGTTCCCTGCACAAATGGGCACGGCTCTCATAGACTGTGCATTCTGAGACAGCCGCCTGGTCAG
AGGGCGGAGACCCCCAATTCCTCTGTAAGCGGTAACATCCTCTTCCCTGTCCTCAGCGAGGACTGCACTACCACAGAGGAAGGAAATCAG
CCTGGAAACATGCTAAACTGCAGCCAGAACTCCAGCTCATCCTCAGTGTGGTGGCTGAAATCACCTGCATTTTCCAGTGGTTCTTCTGAG
GGGGACAGCCCTTGGTCCTATCTGAATTCCAGTGGGAGTTCTTGGGTTTCATTGCCGGGAAAGATGAGGAAAGAGATCCTTGAGGCTCGC
ACCTTGCAACCTGATGACTTTGAAAAGCTGTTGGCAGGAGTGAGGCATGATTGGCTGTTTCAGAGACTAGAGAATACGGGGGTTTTTAAG
CCCAGTCAACTCCACCGAGCACATAGTGCTCTTTTGTTAAAATATTCAAAAAAATCTGAACTGTGGACGGCCCAGGAAACTATTGTCTAT
TTGGGGGACTACTTGACTGTGAAGAAAAAAGGCAGACAAAGAAATGCTTTTTGGGTTCATCATCTTCATCAAGAAGAAATTCTGGGGAGG
TATGTTGGGAAAGACTATAAGGAGCAGAAGGGGCTCTGGCACCACTTCACTGATGTGGAGCGACAGATGACCGCACAGCACTATGTGACA
GAATTTAACAAGAGACTCTATGAACAAAACATTCCCACCCAGATATTCTACATCCCATCCACAATACTACTGATTTTAGAGGACAAGACA
ATAAAGGGATGTATCAGTGTGGAGCCTTACATACTGGGAGAATTTGTAAAATTGTCAAATAACACGAAAGTGGTGAAAACAGAATACAAA
GCCACAGAATATGGCTTGGCCTATGGCCATTTTTCTTATGAGTTTTCTAATCATAGAGATGTTGTGGTCGATTTACAAGGTTGGGTAACC
GGTAATGGAAAAGGACTCATCTACCTCACAGATCCCCAGATTCACTCCGTTGATCAGAAAGTTTTCACTACCAATTTTGGAAAGAGAGGA
ATTTTTTACTTCTTTAATAACCAGCATGTGGAATGTAATGAAATCTGCCATCGTCTTTCTTTGACTAGACCTTCAATGGAGAAACCATGC
ACATAGAATACGGCACAGTCTGGTCCTTTGGGGCTTGGGCAGGGCCGTGACACAGGTTCTGGCCAATGATTTGCAAGAGGAATTGATCAG
TATCACTTTAAGTCCTGCATTTAATTGGCAGCACAAGATCCTGCAGAGCCTCTTTCCCTCTGCCACAGTTATCAAGAATGGGTCAGGAGA
CCGCTGCTTCTGGGCATAAGTCCTGCAAGGAAAGCAACATGGAAAACAGCCCCAACTCACCCATGAGGGATGAAAAGCACTCTTGAGAAA
GGCATGTGTTGTTTAAGCCATTGAGATTTTAGAGCTTTTTGTCACTATCTGTCAAGACTGATACTACTGGGGCTTTTCCTATTGATTTGG
GAGTTCTTTACATATTAAAAAAATGTGAGCCTTTGTGATACGAATTCAATTTGTTTTCCTGTCTTTTGACATTTGACTTTGCATAAAAGT
TTATCTGTGCATAATTTTATATGTAGTTGAATTCATCAATCTTTTATTTTGTATGGCTTTTTGGTTATGTATAATACTTAGATCCTCCTT
ATACTCTGAGTTTCTTTCTTTTTAATTCTCCTGTATTTCCTTCTAGTATAATTAAATCTGTAAAAAGTAAGATGGAAGAGTGGTACAGTT
TTCTTTATCCAGTCTGTCCTTGATGGGCATTTAGGTAGACTGGATAAAGAAAATGTGGTACATATACACCATGGAACACTATGTGTATTA
ATCCACTCTCACACTGCTATGAAGAGATACCTGAGACTGGGTAATTTAGAAAGAAAAGAGGTTTAATTAACTCACAGTTCCACATGGCTG
GGGAGACCTCAGGAAACTTACAATCATGGCAGAAGGCACCTCTTCATAGGGTAGCAGGAGAGAGAATGAGTGCCAGCAGGGGAAATGCCA
GATGCTTATAAAGCCATCAGATCTTGTGAGAATTCATTCACTCTCACGAGAACAGCATGGGAAAAACTGCCTCAATTACCTCCTACCAGG
TCCTTCCCATGACACATGGGAATTATGGGACTACAATTCGAGATGAGATTTGGGTGGGGACACAAAGCCAAACCATATCACAATGTAACC
ATAAAAAAGAATGAGATCATGTCCTTTGCAGGGACATGGATAGAGCTGGAGGCCATTATTTTTAGCAAACTAATGCAAGAACAGAAAACT
AAATACCACTTGTTCTCACTTATAGGTGAGAGCTAAGTGATGAGAGTAGGTGGACACATAGAGGGAACAACACACACCAGGGCTTATCAG
AGGGTGGACAGTGGGAGGAGGGAGAGGATCAGGAAAAATAACTAATGGGTACTAGGCTGAATACCTGGGTGATGAAGTAATTCGCACAAC

>In-frame_ANK2_ENST00000506722_chr4_113825670_+_ALPK1_ENST00000177648_chr4_113350305_+_3758nt
ACAGTCTGAGGCTGTAATGGGAAAGTCGGTTCCTGGGCTGCTGTCTCATAGACATCAGCTTGCAGGGAAGCTGGGGGCTCTCCGAATTGC
CCTGCTCCGGGGCCCCTCCTGCTGCGTGACTCACAGGCACATTGCAGAGAGAAGCTGCCGCTCCCAGTAAGTAATGAAAAGAGACATGAA
GAATTGGTATTTCAAATGACCACCATGTTGCAAAAGAGCCTGCTGAAGGAGTTTGACCACCATTTGCTGTCCGCTGCAGAAGCCTGCAAG
CTGGCAGCTGCCTTCAGTGCCTATACGCCGCTCTTCGTGCTCACAGCTGTGAATATCCGTGGCACGTGTTTATTGTCCTACAGTAGTTCA
AATGACTGTCCTCCAGAATTGAAAAACTTACATCTGTGTGAAGCCAAAGAGGCCTTTGAGATTGGCCTCCTCACCAAGAGAGATGATGAG
CCTGTTACTGGAAAACAGGAGCTTCACAGCTTTGTCAAAGCTGCTTTCGGTCTCACCACAGTGCACAGAAGGCTCCATGGGGAGACAGGG
ACGGTCCATGCAGCAAGTCAGCTCTGTAAGGAAGCAATGGGGAAGCTGTACAATTTCAGCACTTCCTCCAGAAGTCAGGACAGAGAAGCT
CTGTCTCAAGAAGTTATGTCTGTGATTGCCCAGGTGAAGGAACATTTACAAGTTCAAAGCTTCTCAAATGTAGATGACAGATCTTATGTT
CCCGAGAGTTTCGAGTGCAGGTTGGATAAACTTATCTTGCATGGGCAAGGGGATTTCCAAAAAATCCTTGACACCTATTCACAGCACCAT
ACTTCGGTGTGTGAAGTATTTGAAAGTGATTGTGGAAACAACAAAAATGAACAGAAAGATGCAAAAACAGGAGTCTGCATCACTGCTCTA
AAAACAGAAATAAAAAACATAGATACTGTGAGTACTACTCAAGAAAAGCCACATTGTCAAAGAGACACAGGAATATCTTCCTCCCTAATG
GGTAAGAATGTTCAGAGGGAACTCAGAAGGGGAGGAAGGAGAAACTGGACCCATTCTGATGCATTTCGAGTCTCCTTGGATCAAGATGTG
GAGACTGAGACTGAGCCATCGGACTACAGCAATGGTGAGGGAGCTGTTTTCAACAAGTCTCTGAGTGGCAGCCAGACTTCCAGTGCTTGG
AGCAACTTATCAGGGTTTAGTTCCTCTGCAAGCTGGGAGGAAGTGAATTATCACGTTGACGACAGGTCAGCCAGAAAAGAGCCTGGCAAA
GAACATCTGGTGGACACTCAGTGTTCCACTGCCTTGTCTGAGGAGCTAGAGAATGACAGGGAAGGCAGAGCTATGCATTCATTGCATTCA
CAGCTTCATGATCTCTCTCTTCAGGAACCCAACAATGACAATTTGGAGCCTTCTCAAAATCAGCCACAGCAACAGATGCCCTTGACACCC
TTCTCGCCTCATAATACCCCAGGCATTTTCTTGGCCCCTGGTGCAGGGCTTCTAGAAGGAGCTCCAGAAGGTATCCAGGAAGTCAGAAAT
ATGGGACCCAGAAATACTTCTGCTCACTCCAGACCCTCATATCGTTCTGCTTCTTGGTCTTCTGATTCTGGTAGGCCCAAGAATATGGGC
ACACATCCTTCAGTCCAAAAAGAAGAAGCCTTTGAAATAATTGTTGAGTTTCCAGAAACCAACTGCGATGTCAAAGACAGGCAGGGGAAA
GAGCAGGGAGAAGAAATTAGTGAAAGAGGCGCAGGCCCTACATTTAAAGCTAGTCCCTCCTGGGTTGACCCAGAAGGAGAAACAGCAGAA
AGCACTGAAGATGCACCCTTAGACTTTCACAGGGTCCTGCACAATTCTCTGGGAAACATTTCCATGCTGCCATGTAGCTCCTTCACCCCT
AATTGGCCTGTTCAAAATCCTGACTCCAGAAAAAGTGGTGGCCCAGTCGCAGAGCAGGGCATCGACCCTGATGCCTCCACAGTGGATGAG
GAGGGGCAACTGCTCGACAGCATGGATGTTCCCTGCACAAATGGGCACGGCTCTCATAGACTGTGCATTCTGAGACAGCCGCCTGGTCAG
AGGGCGGAGACCCCCAATTCCTCTGTAAGCGGTAACATCCTCTTCCCTGTCCTCAGCGAGGACTGCACTACCACAGAGGAAGGAAATCAG
CCTGGAAACATGCTAAACTGCAGCCAGAACTCCAGCTCATCCTCAGTGTGGTGGCTGAAATCACCTGCATTTTCCAGTGGTTCTTCTGAG
GGGGACAGCCCTTGGTCCTATCTGAATTCCAGTGGGAGTTCTTGGGTTTCATTGCCGGGAAAGATGAGGAAAGAGATCCTTGAGGCTCGC
ACCTTGCAACCTGATGACTTTGAAAAGCTGTTGGCAGGAGTGAGGCATGATTGGCTGTTTCAGAGACTAGAGAATACGGGGGTTTTTAAG
CCCAGTCAACTCCACCGAGCACATAGTGCTCTTTTGTTAAAATATTCAAAAAAATCTGAACTGTGGACGGCCCAGGAAACTATTGTCTAT
TTGGGGGACTACTTGACTGTGAAGAAAAAAGGCAGACAAAGAAATGCTTTTTGGGTTCATCATCTTCATCAAGAAGAAATTCTGGGGAGG
TATGTTGGGAAAGACTATAAGGAGCAGAAGGGGCTCTGGCACCACTTCACTGATGTGGAGCGACAGATGACCGCACAGCACTATGTGACA
GAATTTAACAAGAGACTCTATGAACAAAACATTCCCACCCAGATATTCTACATCCCATCCACAATACTACTGATTTTAGAGGACAAGACA
ATAAAGGGATGTATCAGTGTGGAGCCTTACATACTGGGAGAATTTGTAAAATTGTCAAATAACACGAAAGTGGTGAAAACAGAATACAAA
GCCACAGAATATGGCTTGGCCTATGGCCATTTTTCTTATGAGTTTTCTAATCATAGAGATGTTGTGGTCGATTTACAAGGTTGGGTAACC
GGTAATGGAAAAGGACTCATCTACCTCACAGATCCCCAGATTCACTCCGTTGATCAGAAAGTTTTCACTACCAATTTTGGAAAGAGAGGA
ATTTTTTACTTCTTTAATAACCAGCATGTGGAATGTAATGAAATCTGCCATCGTCTTTCTTTGACTAGACCTTCAATGGAGAAACCATGC
ACATAGAATACGGCACAGTCTGGTCCTTTGGGGCTTGGGCAGGGCCGTGACACAGGTTCTGGCCAATGATTTGCAAGAGGAATTGATCAG
TATCACTTTAAGTCCTGCATTTAATTGGCAGCACAAGATCCTGCAGAGCCTCTTTCCCTCTGCCACAGTTATCAAGAATGGGTCAGGAGA
CCGCTGCTTCTGGGCATAAGTCCTGCAAGGAAAGCAACATGGAAAACAGCCCCAACTCACCCATGAGGGATGAAAAGCACTCTTGAGAAA
GGCATGTGTTGTTTAAGCCATTGAGATTTTAGAGCTTTTTGTCACTATCTGTCAAGACTGATACTACTGGGGCTTTTCCTATTGATTTGG
GAGTTCTTTACATATTAAAAAAATGTGAGCCTTTGTGATACGAATTCAATTTGTTTTCCTGTCTTTTGACATTTGACTTTGCATAAAAGT
TTATCTGTGCATAATTTTATATGTAGTTGAATTCATCAATCTTTTATTTTGTATGGCTTTTTGGTTATGTATAATACTTAGATCCTCCTT

>In-frame_ANK2_ENST00000506722_chr4_113825670_+_ALPK1_ENST00000504176_chr4_113350305_+_3317nt
ACAGTCTGAGGCTGTAATGGGAAAGTCGGTTCCTGGGCTGCTGTCTCATAGACATCAGCTTGCAGGGAAGCTGGGGGCTCTCCGAATTGC
CCTGCTCCGGGGCCCCTCCTGCTGCGTGACTCACAGGCACATTGCAGAGAGAAGCTGCCGCTCCCAGTAAGTAATGAAAAGAGACATGAA
GAATTGGTATTTCAAATGACCACCATGTTGCAAAAGAGCCTGCTGAAGGAGTTTGACCACCATTTGCTGTCCGCTGCAGAAGCCTGCAAG
CTGGCAGCTGCCTTCAGTGCCTATACGCCGCTCTTCGTGCTCACAGCTGTGAATATCCGTGGCACGTGTTTATTGTCCTACAGTAGTTCA
AATGACTGTCCTCCAGAATTGAAAAACTTACATCTGTGTGAAGCCAAAGAGGCCTTTGAGATTGGCCTCCTCACCAAGAGAGATGATGAG
CCTGTTACTGGAAAACAGGAGCTTCACAGCTTTGTCAAAGCTGCTTTCGGTCTCACCACAGTGCACAGAAGGCTCCATGGGGAGACAGGG
ACGGTCCATGCAGCAAGTCAGCTCTGTAAGGAAGCAATGGGGAAGCTGTACAATTTCAGCACTTCCTCCAGAAGTCAGGACAGAGAAGCT
CTGTCTCAAGAAGTTATGTCTGTGATTGCCCAGGTGAAGGAACATTTACAAGTTCAAAGCTTCTCAAATGTAGATGACAGATCTTATGTT
CCCGAGAGTTTCGAGTGCAGGTTGGATAAACTTATCTTGCATGGGCAAGGGGATTTCCAAAAAATCCTTGACACCTATTCACAGCACCAT
ACTTCGGTGTGTGAAGTATTTGAAAGTGATTGTGGAAACAACAAAAATGAACAGAAAGATGCAAAAACAGGAGTCTGCATCACTGCTCTA
AAAACAGAAATAAAAAACATAGATACTGTGAGTACTACTCAAGAAAAGCCACATTGTCAAAGAGACACAGGAATATCTTCCTCCCTAATG
GGTAAGAATGTTCAGAGGGAACTCAGAAGGGGAGGAAGGAGAAACTGGACCCATTCTGATGCATTTCGAGTCTCCTTGGATCAAGATGTG
GAGACTGAGACTGAGCCATCGGACTACAGCAATGGTGAGGGAGCTGTTTTCAACAAGTCTCTGAGTGGCAGCCAGACTTCCAGTGCTTGG
AGCAACTTATCAGGGTTTAGTTCCTCTGCAAGCTGGGAGGAAGTGAATTATCACGTTGACGACAGGTCAGCCAGAAAAGAGCCTGGCAAA
GAACATCTGGTGGACACTCAGTGTTCCACTGCCTTGTCTGAGGAGCTAGAGAATGACAGGGAAGGCAGAGCTATGCATTCATTGCATTCA
CAGCTTCATGATCTCTCTCTTCAGGAACCCAACAATGACAATTTGGAGCCTTCTCAAAATCAGCCACAGCAACAGATGCCCTTGACACCC
TTCTCGCCTCATAATACCCCAGGCATTTTCTTGGCCCCTGGTGCAGGGCTTCTAGAAGGAGCTCCAGAAGGTATCCAGGAAGTCAGAAAT
ATGGGACCCAGAAATACTTCTGCTCACTCCAGACCCTCATATCGTTCTGCTTCTTGGTCTTCTGATTCTGGTAGGCCCAAGAATATGGGC
ACACATCCTTCAGTCCAAAAAGAAGAAGCCTTTGAAATAATTGTTGAGTTTCCAGAAACCAACTGCGATGTCAAAGACAGGCAGGGGAAA
GAGCAGGGAGAAGAAATTAGTGAAAGAGGCGCAGGCCCTACATTTAAAGCTAGTCCCTCCTGGGTTGACCCAGAAGGAGAAACAGCAGAA
AGCACTGAAGATGCACCCTTAGACTTTCACAGGGTCCTGCACAATTCTCTGGGAAACATTTCCATGCTGCCATGTAGCTCCTTCACCCCT
AATTGGCCTGTTCAAAATCCTGACTCCAGAAAAAGTGGTGGCCCAGTCGCAGAGCAGGGCATCGACCCTGATGCCTCCACAGTGGATGAG
GAGGGGCAACTGCTCGACAGCATGGATGTTCCCTGCACAAATGGGCACGGCTCTCATAGACTGTGCATTCTGAGACAGCCGCCTGGTCAG
AGGGCGGAGACCCCCAATTCCTCTGTAAGCGGTAACATCCTCTTCCCTGTCCTCAGCGAGGACTGCACTACCACAGAGGAAGGAAATCAG
CCTGGAAACATGCTAAACTGCAGCCAGAACTCCAGCTCATCCTCAGTGTGGTGGCTGAAATCACCTGCATTTTCCAGTGGTTCTTCTGAG
GGGGACAGCCCTTGGTCCTATCTGAATTCCAGTGGGAGTTCTTGGGTTTCATTGCCGGGAAAGATGAGGAAAGAGATCCTTGAGGCTCGC
ACCTTGCAACCTGATGACTTTGAAAAGCTGTTGGCAGGAGTGAGGCATGATTGGCTGTTTCAGAGACTAGAGAATACGGGGGTTTTTAAG
CCCAGTCAACTCCACCGAGCACATAGTGCTCTTTTGTTAAAATATTCAAAAAAATCTGAACTGTGGACGGCCCAGGAAACTATTGTCTAT
TTGGGGGACTACTTGACTGTGAAGAAAAAAGGCAGACAAAGAAATGCTTTTTGGGTTCATCATCTTCATCAAGAAGAAATTCTGGGGAGG
TATGTTGGGAAAGACTATAAGGAGCAGAAGGGGCTCTGGCACCACTTCACTGATGTGGAGCGACAGATGACCGCACAGCACTATGTGACA
GAATTTAACAAGAGACTCTATGAACAAAACATTCCCACCCAGATATTCTACATCCCATCCACAATACTACTGATTTTAGAGGACAAGACA
ATAAAGGGATGTATCAGTGTGGAGCCTTACATACTGGGAGAATTTGTAAAATTGTCAAATAACACGAAAGTGGTGAAAACAGAATACAAA
GCCACAGAATATGGCTTGGCCTATGGCCATTTTTCTTATGAGTTTTCTAATCATAGAGATGTTGTGGTCGATTTACAAGGTTGGGTAACC
GGTAATGGAAAAGGACTCATCTACCTCACAGATCCCCAGATTCACTCCGTTGATCAGAAAGTTTTCACTACCAATTTTGGAAAGAGAGGA
ATTTTTTACTTCTTTAATAACCAGCATGTGGAATGTAATGAAATCTGCCATCGTCTTTCTTTGACTAGACCTTCAATGGAGAAACCATGC
ACATAGAATACGGCACAGTCTGGTCCTTTGGGGCTTGGGCAGGGCCGTGACACAGGTTCTGGCCAATGATTTGCAAGAGGAATTGATCAG


Top

FusionGenePPI for ANK2_ALPK1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ANK2SIGMAR1, EPB42, NDEL1, TNIK, KIAA0368, TAF9, TP53, UBAC2, ABCE1, POPDC2, HAX1, NUFIP1, DGUOK, DNAAF2, PALM2, NTRK1, CEP120, RAPGEF5, CHL1, MAPK8IP1, HIF1ANALPK1MYC, HSP90AA1, ALOXE3, XPO1, SCGB1D2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneANK2chr4:113825670chr4:113350305ENST00000357077+146966_1125-183958SPTBN1
HgeneANK2chr4:113825670chr4:113350305ENST00000394537+145966_1125-181873SPTBN1
HgeneANK2chr4:113825670chr4:113350305ENST00000506722+247966_112571864SPTBN1
HgeneANK2chr4:113825670chr4:113350305ENST00000510275+114966_1125-2556SPTBN1


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ANK2_ALPK1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for ANK2_ALPK1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneANK2C1970119CARDIAC ARRHYTHMIA, ANKYRIN-B-RELATED1CTD_human;UNIPROT