FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 16682

FusionGeneSummary for HOOK3_RET

check button Fusion gene summary
Fusion gene informationFusion gene name: HOOK3_RET
Fusion gene ID: 16682
HgeneTgene
Gene symbol

HOOK3

RET

Gene ID

84376

5979

Gene namehook microtubule tethering protein 3ret proto-oncogene
SynonymsHK3CDHF12|CDHR16|HSCR1|MEN2A|MEN2B|MTC1|PTC|RET-ELE1
Cytomap

8p11.21

10q11.21

Type of geneprotein-codingprotein-coding
Descriptionprotein Hook homolog 3h-hook3hHK3hook homolog 3proto-oncogene tyrosine-protein kinase receptor RetRET receptor tyrosine kinasecadherin family member 12cadherin-related family member 16proto-oncogene c-Retrearranged during transfectionret proto-oncogene (multiple endocrine neoplasia and medullary
Modification date2018052320180527
UniProtAcc

Q86VS8

P07949

Ensembl transtripts involved in fusion geneENST00000307602, ENST00000524839, 
ENST00000355710, ENST00000340058, 
Fusion gene scores* DoF score11 X 10 X 6=66018 X 10 X 7=1260
# samples 1565
** MAII scorelog2(15/660*10)=-2.13750352374993
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(65/1260*10)=-0.954912110471462
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: HOOK3 [Title/Abstract] AND RET [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Kinase involved fusion gene, inframe and retained kinase domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneRET

GO:0030155

regulation of cell adhesion

21357690

TgeneRET

GO:0030335

positive regulation of cell migration

20702524

TgeneRET

GO:0033619

membrane protein proteolysis

21357690

TgeneRET

GO:0033630

positive regulation of cell adhesion mediated by integrin

20702524

TgeneRET

GO:0035860

glial cell-derived neurotrophic factor receptor signaling pathway

28953886

TgeneRET

GO:0043410

positive regulation of MAPK cascade

28846099


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
ChiTaRS3.1DQ104207HOOK3chr8

42823358

+RETchr10

43612030

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000307602ENST00000355710HOOK3chr8

42823358

+RETchr10

43612030

+
In-frameENST00000307602ENST00000340058HOOK3chr8

42823358

+RETchr10

43612030

+
intron-3CDSENST00000524839ENST00000355710HOOK3chr8

42823358

+RETchr10

43612030

+
intron-3CDSENST00000524839ENST00000340058HOOK3chr8

42823358

+RETchr10

43612030

+

Top

FusionProtFeatures for HOOK3_RET


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
HOOK3

Q86VS8

RET

P07949

Probably serves as a target for the spiC protein fromSalmonella typhimurium, which inactivates it, leading to a strongalteration in cellular trafficking (By similarity). Component ofthe FTS/Hook/FHIP complex (FHF complex). The FHF complex mayfunction to promote vesicle trafficking and/or fusion via thehomotypic vesicular protein sorting complex (the HOPS complex).May regulate clearance of endocytosed receptors such as MSR1.Participates in defining the architecture and localization of theGolgi complex. Acts as an adapter protein linking the dynein motorcomplex to various cargos and converts dynein from a non-processive to a highly processive motor in the presence ofdynactin. Facilitates the interaction between dynein and dynactinand activates dynein processivity (the ability to move along amicrotubule for a long distance without falling off the track)(PubMed:25035494). {ECO:0000250|UniProtKB:Q8BUK6,ECO:0000269|PubMed:11238449, ECO:0000269|PubMed:17237231,ECO:0000269|PubMed:18799622, ECO:0000269|PubMed:25035494}. Receptor tyrosine-protein kinase involved in numerouscellular mechanisms including cell proliferation, neuronalnavigation, cell migration, and cell differentiation upon bindingwith glial cell derived neurotrophic factor family ligands.Phosphorylates PTK2/FAK1. Regulates both cell death/survivalbalance and positional information. Required for the molecularmechanisms orchestration during intestine organogenesis; involvedin the development of enteric nervous system and renalorganogenesis during embryonic life, and promotes the formation ofPeyer's patch-like structures, a major component of the gut-associated lymphoid tissue. Modulates cell adhesion via itscleavage by caspase in sympathetic neurons and mediates cellmigration in an integrin (e.g. ITGB1 and ITGB3)-dependent manner.Involved in the development of the neural crest. Active in theabsence of ligand, triggering apoptosis through a mechanism thatrequires receptor intracellular caspase cleavage. Acts as adependence receptor; in the presence of the ligand GDNF insomatotrophs (within pituitary), promotes survival and downregulates growth hormone (GH) production, but triggers apoptosisin absence of GDNF. Regulates nociceptor survival and size.Triggers the differentiation of rapidly adapting (RA)mechanoreceptors. Mediator of several diseases such asneuroendocrine cancers; these diseases are characterized byaberrant integrins-regulated cell migration. Mediates, throughinteraction with GDF15-receptor GFRAL, GDF15-induced cell-signaling in the brainstem which induces inhibition of food-intake. Activates MAPK- and AKT-signaling pathways(PubMed:28846097, PubMed:28953886, PubMed:28846099). Isoform 1 incomplex with GFRAL induces higher activation of MAPK-signalingpathway than isoform 2 in complex with GFRAL (PubMed:28846099).{ECO:0000269|PubMed:20064382, ECO:0000269|PubMed:20616503,ECO:0000269|PubMed:20702524, ECO:0000269|PubMed:21357690,ECO:0000269|PubMed:21454698, ECO:0000269|PubMed:28846097,ECO:0000269|PubMed:28846099, ECO:0000269|PubMed:28953886}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneHOOK3chr8:42823358chr10:43612030ENST00000307602+112210_126374719DomainCalponin-homology (CH)
TgeneRETchr8:42823358chr10:43612030ENST00000340058+1019724_10167121073DomainProtein kinase
TgeneRETchr8:42823358chr10:43612030ENST00000355710+1020724_10167121115DomainProtein kinase
TgeneRETchr8:42823358chr10:43612030ENST00000340058+1019730_7387121073Nucleotide bindingATP
TgeneRETchr8:42823358chr10:43612030ENST00000355710+1020730_7387121115Nucleotide bindingATP
TgeneRETchr8:42823358chr10:43612030ENST00000340058+1019805_8077121073RegionNote=Inhibitors binding
TgeneRETchr8:42823358chr10:43612030ENST00000355710+1020805_8077121115RegionNote=Inhibitors binding

- In-frame and not-retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneHOOK3chr8:42823358chr10:43612030ENST00000307602+1122167_433374719Coiled coilOntology_term=ECO:0000255
HgeneHOOK3chr8:42823358chr10:43612030ENST00000307602+1122462_667374719Coiled coilOntology_term=ECO:0000255
HgeneHOOK3chr8:42823358chr10:43612030ENST00000307602+1122553_718374719RegionNote=Required for association with Golgi
TgeneRETchr8:42823358chr10:43612030ENST00000340058+1019168_2727121073DomainCadherin
TgeneRETchr8:42823358chr10:43612030ENST00000355710+1020168_2727121115DomainCadherin
TgeneRETchr8:42823358chr10:43612030ENST00000340058+101929_6357121073Topological domainExtracellular
TgeneRETchr8:42823358chr10:43612030ENST00000340058+1019658_11147121073Topological domainCytoplasmic
TgeneRETchr8:42823358chr10:43612030ENST00000355710+102029_6357121115Topological domainExtracellular
TgeneRETchr8:42823358chr10:43612030ENST00000355710+1020658_11147121115Topological domainCytoplasmic
TgeneRETchr8:42823358chr10:43612030ENST00000340058+1019636_6577121073TransmembraneHelical
TgeneRETchr8:42823358chr10:43612030ENST00000355710+1020636_6577121115TransmembraneHelical


Top

FusionGeneSequence for HOOK3_RET


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_HOOK3_ENST00000307602_chr8_42823358_+_RET_ENST00000355710_chr10_43612030_+_777aa
MFSVESLERAELCESLLTWIQTFNVDAPCQTVEDLTNGVVMAQVLQKIDPATFDENWLNRIKTEVGDNWRLKISNLKKILKGILDTNHEI
LGQQINDFTLPDVNLIGEHSDAAELGRMLQLILGCAVNCEQKQEYIQAIMMMEESVQHVVMTAIQELMSKESPVSAGNDATVDLDRQLKK
TTEELNEALSAKEEIAQRCHELDMQVAALQEEKSSLLAENQVLMERLNQSDSIEDPNSPAGRRHLQLQTQLEQLQEETFRLEAAKDDTRI
RCEELEKEISELRQQNDELTTLADEAQSLKDEIDVLRHSSDKVSKLEGQVESTKKKLEDLGDLRRQVKLLEEKNTMTMQNTVSLEEELRK
ANAARSQLETYKRQEDPKWEFPRKNLVLGKTLGEGEFGKVVKATAFHLKGRAGYTTVAVKMLKENASPSELRDLLSEFNVLKQVNHPHVI
KLTGACSQDGPLLLIVEYAKYGSLRGFLRESRKVGPGYLGSGGSRNSSSLDHPDERALTMGDLISFAWQISQGMQTLAEMKLVHRDLAAR
NILVAEGRKMKISDFGLSRDVTEEDSYVKRSQGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIVTLGGNPTPGIPPERLFNLLKTGH
RMERPDNCSEEMYRLMLQCWKQEPDKRPVFADISKDLEKMMVKRRDYLDLAASTPSDSLITDDGLSEEETPLVDCNNAPLPRALPSTWIE

>In-frame_HOOK3_ENST00000307602_chr8_42823358_+_RET_ENST00000340058_chr10_43612030_+_735aa
MFSVESLERAELCESLLTWIQTFNVDAPCQTVEDLTNGVVMAQVLQKIDPATFDENWLNRIKTEVGDNWRLKISNLKKILKGILDTNHEI
LGQQINDFTLPDVNLIGEHSDAAELGRMLQLILGCAVNCEQKQEYIQAIMMMEESVQHVVMTAIQELMSKESPVSAGNDATVDLDRQLKK
TTEELNEALSAKEEIAQRCHELDMQVAALQEEKSSLLAENQVLMERLNQSDSIEDPNSPAGRRHLQLQTQLEQLQEETFRLEAAKDDTRI
RCEELEKEISELRQQNDELTTLADEAQSLKDEIDVLRHSSDKVSKLEGQVESTKKKLEDLGDLRRQVKLLEEKNTMTMQNTVSLEEELRK
ANAARSQLETYKRQEDPKWEFPRKNLVLGKTLGEGEFGKVVKATAFHLKGRAGYTTVAVKMLKENASPSELRDLLSEFNVLKQVNHPHVI
KLTGACSQDGPLLLIVEYAKYGSLRGFLRESRKVGPGYLGSGGSRNSSSLDHPDERALTMGDLISFAWQISQGMQTLAEMKLVHRDLAAR
NILVAEGRKMKISDFGLSRDVTEEDSYVKRSQGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIVTLGGNPTPGIPPERLFNLLKTGH
RMERPDNCSEEMYRLMLQCWKQEPDKRPVFADISKDLEKMMVKRRDYLDLAASTPSDSLITDDGLSEEETPLVDCNNAPLPRALPSTWIE


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_HOOK3_ENST00000307602_chr8_42823358_+_RET_ENST00000355710_chr10_43612030_+_2331nt
ATGTTCAGCGTAGAGTCGCTGGAGCGGGCGGAGCTGTGCGAGAGCCTCCTCACTTGGATCCAGACATTTAATGTGGATGCACCATGCCAG
ACCGTGGAAGATTTAACGAATGGGGTTGTGATGGCCCAGGTTCTTCAAAAGATAGATCCTGCATATTTTGATGAAAATTGGCTAAACAGA
ATCAAAACTGAAGTAGGAGATAATTGGAGGCTAAAGATAAGCAATTTAAAGAAAATTTTAAAAGGAATCTTGGATTATAATCATGAGATT
TTAGGACAGCAAATTAATGACTTTACCCTTCCTGATGTGAACCTTATTGGGGAGCATTCTGATGCAGCAGAGCTTGGAAGGATGCTTCAG
CTCATCTTAGGCTGTGCTGTGAACTGTGAACAGAAGCAAGAGTACATCCAAGCCATTATGATGATGGAGGAATCTGTTCAACATGTTGTC
ATGACAGCCATTCAAGAGCTGATGAGTAAAGAATCTCCTGTCTCTGCTGGAAATGATGCCTATGTTGACCTTGATCGTCAGCTGAAGAAA
ACTACAGAGGAACTAAATGAAGCTTTGTCAGCAAAGGAAGAAATTGCTCAAAGATGCCATGAACTGGATATGCAGGTTGCAGCATTGCAG
GAAGAGAAAAGTAGTTTGTTGGCAGAGAATCAGGTATTAATGGAAAGACTCAATCAATCTGATTCTATAGAAGACCCTAACAGTCCAGCA
GGAAGAAGGCATTTGCAGCTCCAGACTCAATTAGAACAGCTCCAAGAAGAAACATTCAGACTAGAAGCAGCCAAAGATGATTATCGAATA
CGTTGTGAAGAGTTAGAAAAGGAGATCTCTGAACTTCGGCAACAGAATGATGAACTGACCACTTTGGCAGATGAAGCTCAGTCTCTGAAA
GATGAGATCGACGTGCTGAGACATTCTTCTGATAAAGTATCTAAACTAGAAGGTCAAGTAGAATCTTATAAAAAGAAGCTAGAAGACCTT
GGTGATTTAAGGCGGCAGGTTAAACTCTTAGAAGAGAAGAATACCATGTATATGCAGAATACTGTCAGTCTAGAGGAAGAGTTAAGAAAG
GCCAACGCAGCGCGAAGTCAACTTGAAACCTACAAGAGACAGGAGGATCCAAAGTGGGAATTCCCTCGGAAGAACTTGGTTCTTGGAAAA
ACTCTAGGAGAAGGCGAATTTGGAAAAGTGGTCAAGGCAACGGCCTTCCATCTGAAAGGCAGAGCAGGGTACACCACGGTGGCCGTGAAG
ATGCTGAAAGAGAACGCCTCCCCGAGTGAGCTGCGAGACCTGCTGTCAGAGTTCAACGTCCTGAAGCAGGTCAACCACCCACATGTCATC
AAATTGTATGGGGCCTGCAGCCAGGATGGCCCGCTCCTCCTCATCGTGGAGTACGCCAAATACGGCTCCCTGCGGGGCTTCCTCCGCGAG
AGCCGCAAAGTGGGGCCTGGCTACCTGGGCAGTGGAGGCAGCCGCAACTCCAGCTCCCTGGACCACCCGGATGAGCGGGCCCTCACCATG
GGCGACCTCATCTCATTTGCCTGGCAGATCTCACAGGGGATGCAGTATCTGGCCGAGATGAAGCTCGTTCATCGGGACTTGGCAGCCAGA
AACATCCTGGTAGCTGAGGGGCGGAAGATGAAGATTTCGGATTTCGGCTTGTCCCGAGATGTTTATGAAGAGGATTCCTACGTGAAGAGG
AGCCAGGGTCGGATTCCAGTTAAATGGATGGCAATTGAATCCCTTTTTGATCATATCTACACCACGCAAAGTGATGTATGGTCTTTTGGT
GTCCTGCTGTGGGAGATCGTGACCCTAGGGGGAAACCCCTATCCTGGGATTCCTCCTGAGCGGCTCTTCAACCTTCTGAAGACCGGCCAC
CGGATGGAGAGGCCAGACAACTGCAGCGAGGAGATGTACCGCCTGATGCTGCAATGCTGGAAGCAGGAGCCGGACAAAAGGCCGGTGTTT
GCGGACATCAGCAAAGACCTGGAGAAGATGATGGTTAAGAGGAGAGACTACTTGGACCTTGCGGCGTCCACTCCATCTGACTCCCTGATT
TATGACGACGGCCTCTCAGAGGAGGAGACACCGCTGGTGGACTGTAATAATGCCCCCCTCCCTCGAGCCCTCCCTTCCACATGGATTGAA
AACAAACTCTATGGCATGTCAGACCCGAACTGGCCTGGAGAGAGTCCTGTACCACTCACGAGAGCTGATGGCACTAACACTGGGTTTCCA

>In-frame_HOOK3_ENST00000307602_chr8_42823358_+_RET_ENST00000340058_chr10_43612030_+_2205nt
ATGTTCAGCGTAGAGTCGCTGGAGCGGGCGGAGCTGTGCGAGAGCCTCCTCACTTGGATCCAGACATTTAATGTGGATGCACCATGCCAG
ACCGTGGAAGATTTAACGAATGGGGTTGTGATGGCCCAGGTTCTTCAAAAGATAGATCCTGCATATTTTGATGAAAATTGGCTAAACAGA
ATCAAAACTGAAGTAGGAGATAATTGGAGGCTAAAGATAAGCAATTTAAAGAAAATTTTAAAAGGAATCTTGGATTATAATCATGAGATT
TTAGGACAGCAAATTAATGACTTTACCCTTCCTGATGTGAACCTTATTGGGGAGCATTCTGATGCAGCAGAGCTTGGAAGGATGCTTCAG
CTCATCTTAGGCTGTGCTGTGAACTGTGAACAGAAGCAAGAGTACATCCAAGCCATTATGATGATGGAGGAATCTGTTCAACATGTTGTC
ATGACAGCCATTCAAGAGCTGATGAGTAAAGAATCTCCTGTCTCTGCTGGAAATGATGCCTATGTTGACCTTGATCGTCAGCTGAAGAAA
ACTACAGAGGAACTAAATGAAGCTTTGTCAGCAAAGGAAGAAATTGCTCAAAGATGCCATGAACTGGATATGCAGGTTGCAGCATTGCAG
GAAGAGAAAAGTAGTTTGTTGGCAGAGAATCAGGTATTAATGGAAAGACTCAATCAATCTGATTCTATAGAAGACCCTAACAGTCCAGCA
GGAAGAAGGCATTTGCAGCTCCAGACTCAATTAGAACAGCTCCAAGAAGAAACATTCAGACTAGAAGCAGCCAAAGATGATTATCGAATA
CGTTGTGAAGAGTTAGAAAAGGAGATCTCTGAACTTCGGCAACAGAATGATGAACTGACCACTTTGGCAGATGAAGCTCAGTCTCTGAAA
GATGAGATCGACGTGCTGAGACATTCTTCTGATAAAGTATCTAAACTAGAAGGTCAAGTAGAATCTTATAAAAAGAAGCTAGAAGACCTT
GGTGATTTAAGGCGGCAGGTTAAACTCTTAGAAGAGAAGAATACCATGTATATGCAGAATACTGTCAGTCTAGAGGAAGAGTTAAGAAAG
GCCAACGCAGCGCGAAGTCAACTTGAAACCTACAAGAGACAGGAGGATCCAAAGTGGGAATTCCCTCGGAAGAACTTGGTTCTTGGAAAA
ACTCTAGGAGAAGGCGAATTTGGAAAAGTGGTCAAGGCAACGGCCTTCCATCTGAAAGGCAGAGCAGGGTACACCACGGTGGCCGTGAAG
ATGCTGAAAGAGAACGCCTCCCCGAGTGAGCTGCGAGACCTGCTGTCAGAGTTCAACGTCCTGAAGCAGGTCAACCACCCACATGTCATC
AAATTGTATGGGGCCTGCAGCCAGGATGGCCCGCTCCTCCTCATCGTGGAGTACGCCAAATACGGCTCCCTGCGGGGCTTCCTCCGCGAG
AGCCGCAAAGTGGGGCCTGGCTACCTGGGCAGTGGAGGCAGCCGCAACTCCAGCTCCCTGGACCACCCGGATGAGCGGGCCCTCACCATG
GGCGACCTCATCTCATTTGCCTGGCAGATCTCACAGGGGATGCAGTATCTGGCCGAGATGAAGCTCGTTCATCGGGACTTGGCAGCCAGA
AACATCCTGGTAGCTGAGGGGCGGAAGATGAAGATTTCGGATTTCGGCTTGTCCCGAGATGTTTATGAAGAGGATTCCTACGTGAAGAGG
AGCCAGGGTCGGATTCCAGTTAAATGGATGGCAATTGAATCCCTTTTTGATCATATCTACACCACGCAAAGTGATGTATGGTCTTTTGGT
GTCCTGCTGTGGGAGATCGTGACCCTAGGGGGAAACCCCTATCCTGGGATTCCTCCTGAGCGGCTCTTCAACCTTCTGAAGACCGGCCAC
CGGATGGAGAGGCCAGACAACTGCAGCGAGGAGATGTACCGCCTGATGCTGCAATGCTGGAAGCAGGAGCCGGACAAAAGGCCGGTGTTT
GCGGACATCAGCAAAGACCTGGAGAAGATGATGGTTAAGAGGAGAGACTACTTGGACCTTGCGGCGTCCACTCCATCTGACTCCCTGATT
TATGACGACGGCCTCTCAGAGGAGGAGACACCGCTGGTGGACTGTAATAATGCCCCCCTCCCTCGAGCCCTCCCTTCCACATGGATTGAA


* Fusion transcript sequences (Full-length transcript).
>In-frame_HOOK3_ENST00000307602_chr8_42823358_+_RET_ENST00000355710_chr10_43612030_+_4613nt
CGGTCCCGAGTGAAAGGAGAAGGAGGGGCGCTGGGGGTGACGGTGCGGAGCCGCTGCCAGCGCTGGGCGAGAGTCGGCGGCCGGATCCGA
GGAGCAGGCGGGCCTGAGGCCGAGTCAGCTGCGCGGGCCCCCGGATCCCCCGACAGAGCGGCGGCGGTGTCTGGCCAGGCGGTAGGCGCT
GCCTGGCCGCGGCGGGGAAGATGTTCAGCGTAGAGTCGCTGGAGCGGGCGGAGCTGTGCGAGAGCCTCCTCACTTGGATCCAGACATTTA
ATGTGGATGCACCATGCCAGACCGTGGAAGATTTAACGAATGGGGTTGTGATGGCCCAGGTTCTTCAAAAGATAGATCCTGCATATTTTG
ATGAAAATTGGCTAAACAGAATCAAAACTGAAGTAGGAGATAATTGGAGGCTAAAGATAAGCAATTTAAAGAAAATTTTAAAAGGAATCT
TGGATTATAATCATGAGATTTTAGGACAGCAAATTAATGACTTTACCCTTCCTGATGTGAACCTTATTGGGGAGCATTCTGATGCAGCAG
AGCTTGGAAGGATGCTTCAGCTCATCTTAGGCTGTGCTGTGAACTGTGAACAGAAGCAAGAGTACATCCAAGCCATTATGATGATGGAGG
AATCTGTTCAACATGTTGTCATGACAGCCATTCAAGAGCTGATGAGTAAAGAATCTCCTGTCTCTGCTGGAAATGATGCCTATGTTGACC
TTGATCGTCAGCTGAAGAAAACTACAGAGGAACTAAATGAAGCTTTGTCAGCAAAGGAAGAAATTGCTCAAAGATGCCATGAACTGGATA
TGCAGGTTGCAGCATTGCAGGAAGAGAAAAGTAGTTTGTTGGCAGAGAATCAGGTATTAATGGAAAGACTCAATCAATCTGATTCTATAG
AAGACCCTAACAGTCCAGCAGGAAGAAGGCATTTGCAGCTCCAGACTCAATTAGAACAGCTCCAAGAAGAAACATTCAGACTAGAAGCAG
CCAAAGATGATTATCGAATACGTTGTGAAGAGTTAGAAAAGGAGATCTCTGAACTTCGGCAACAGAATGATGAACTGACCACTTTGGCAG
ATGAAGCTCAGTCTCTGAAAGATGAGATCGACGTGCTGAGACATTCTTCTGATAAAGTATCTAAACTAGAAGGTCAAGTAGAATCTTATA
AAAAGAAGCTAGAAGACCTTGGTGATTTAAGGCGGCAGGTTAAACTCTTAGAAGAGAAGAATACCATGTATATGCAGAATACTGTCAGTC
TAGAGGAAGAGTTAAGAAAGGCCAACGCAGCGCGAAGTCAACTTGAAACCTACAAGAGACAGGAGGATCCAAAGTGGGAATTCCCTCGGA
AGAACTTGGTTCTTGGAAAAACTCTAGGAGAAGGCGAATTTGGAAAAGTGGTCAAGGCAACGGCCTTCCATCTGAAAGGCAGAGCAGGGT
ACACCACGGTGGCCGTGAAGATGCTGAAAGAGAACGCCTCCCCGAGTGAGCTGCGAGACCTGCTGTCAGAGTTCAACGTCCTGAAGCAGG
TCAACCACCCACATGTCATCAAATTGTATGGGGCCTGCAGCCAGGATGGCCCGCTCCTCCTCATCGTGGAGTACGCCAAATACGGCTCCC
TGCGGGGCTTCCTCCGCGAGAGCCGCAAAGTGGGGCCTGGCTACCTGGGCAGTGGAGGCAGCCGCAACTCCAGCTCCCTGGACCACCCGG
ATGAGCGGGCCCTCACCATGGGCGACCTCATCTCATTTGCCTGGCAGATCTCACAGGGGATGCAGTATCTGGCCGAGATGAAGCTCGTTC
ATCGGGACTTGGCAGCCAGAAACATCCTGGTAGCTGAGGGGCGGAAGATGAAGATTTCGGATTTCGGCTTGTCCCGAGATGTTTATGAAG
AGGATTCCTACGTGAAGAGGAGCCAGGGTCGGATTCCAGTTAAATGGATGGCAATTGAATCCCTTTTTGATCATATCTACACCACGCAAA
GTGATGTATGGTCTTTTGGTGTCCTGCTGTGGGAGATCGTGACCCTAGGGGGAAACCCCTATCCTGGGATTCCTCCTGAGCGGCTCTTCA
ACCTTCTGAAGACCGGCCACCGGATGGAGAGGCCAGACAACTGCAGCGAGGAGATGTACCGCCTGATGCTGCAATGCTGGAAGCAGGAGC
CGGACAAAAGGCCGGTGTTTGCGGACATCAGCAAAGACCTGGAGAAGATGATGGTTAAGAGGAGAGACTACTTGGACCTTGCGGCGTCCA
CTCCATCTGACTCCCTGATTTATGACGACGGCCTCTCAGAGGAGGAGACACCGCTGGTGGACTGTAATAATGCCCCCCTCCCTCGAGCCC
TCCCTTCCACATGGATTGAAAACAAACTCTATGGCATGTCAGACCCGAACTGGCCTGGAGAGAGTCCTGTACCACTCACGAGAGCTGATG
GCACTAACACTGGGTTTCCAAGATATCCAAATGATAGTGTATATGCTAACTGGATGCTTTCACCCTCAGCGGCAAAATTAATGGACACGT
TTGATAGTTAACATTTCTTTGTGAAAGGTAATGGACTCACAAGGGGAAGAAACATGCTGAGAATGGAAAGTCTACCGGCCCTTTCTTTGT
GAACGTCACATTGGCCGAGCCGTGTTCAGTTCCCAGGTGGCAGACTCGTTTTTGGTAGTTTGTTTTAACTTCCAAGGTGGTTTTACTTCT
GATAGCCGGTGATTTTCCCTCCTAGCAGACATGCCACACCGGGTAAGAGCTCTGAGTCTTAGTGGTTAAGCATTCCTTTCTCTTCAGTGC
CCAGCAGCACCCAGTGTTGGTCTGTGTCCATCAGTGACCACCAACATTCTGTGTTCACATGTGTGGGTCCAACACTTACTACCTGGTGTA
TGAAATTGGACCTGAACTGTTGGATTTTTCTAGTTGCCGCCAAACAAGGCAAAAAAATTTAAACATGAAGCACACACACAAAAAAGGCAG
TAGGAAAAATGCTGGCCCTGATGACCTGTCCTTATTCAGAATGAGAGACTGCGGGGGGGGCCTGGGGGTAGTGTCAATGCCCCTCCAGGG
CTGGAGGGGAAGAGGGGCCCCGAGGATGGGCCTGGGCTCAGCATTCGAGATCTTGAGAATGATTTTTTTTAAATCATGCAACCTTTCCTT
AGGAAGACATTTGGTTTTCATCATGATTAAGATGATTCCTAGATTTAGCACAATGGAGAGATTCCATGCCATCTTTACTATGTGGATGGT
GGTATCAGGGAAGAGGGCTCACAAGACACATTTGTCCCCCGGGCCCACCACATCATCCTCACGTGTTCGGTACTGAGCAGCCACTACCCC
TGATGAGAACAGTATGAAGAAAGGGGGCTGTTGGAGTCCCAGAATTGCTGACAGCAGAGGCTTTGCTGCTGTGAATCCCACCTGCCACCA
GCCTGCAGCACACCCCACAGCCAAGTAGAGGCGAAAGCAGTGGCTCATCCTACCTGTTAGGAGCAGGTAGGGCTTGTACTCACTTTAATT
TGAATCTTATCAACTTACTCATAAAGGGACAGGCTAGCTAGCTGTGTTAGAAGTAGCAATGACAATGACCAAGGACTGCTACACCTCTGA
TTACAATTCTGATGTGAAAAAGATGGTGTTTGGCTCTTATAGAGCCTGTGTGAAAGGCCCATGGATCAGCTCTTCCTGTGTTTGTAATTT
AATGCTGCTACAAGATGTTTCTGTTTCTTAGATTCTGACCATGACTCATAAGCTTCTTGTCATTCTTCATTGCTTGTTTGTGGTCACAGA
TGCACAACACTCCTCCAGTCTTGTGGGGGCAGCTTTTGGGAAGTCTCAGCAGCTCTTCTGGCTGTGTTGTCAGCACTGTAACTTCGCAGA
AAAGAGTCGGATTACCAAAACACTGCCTGCTCTTCAGACTTAAAGCACTGATAGGACTTAAAATAGTCTCATTCAAATACTGTATTTTAT
ATAGGCATTTCACAAAAACAGCAAAATTGTGGCATTTTGTGAGGCCAAGGCTTGGATGCGTGTGTAATAGAGCCTTGTGGTGTGTGCGCA
CACACCCAGAGGGAGAGTTTGAAAAATGCTTATTGGACACGTAACCTGGCTCTAATTTGGGCTGTTTTTCAGATACACTGTGATAAGTTC
TTTTACAAATATCTATAGACATGGTAAACTTTTGGTTTTCAGATATGCTTAATGATAGTCTTACTAAATGCAGAAATAAGAATAAACTTT
CTCAAATTATTAAAAATGCCTACACAGTAAGTGTGAATTGCTGCAACAGGTTTGTTCTCAGGAGGGTAAGAACTCCAGGTCTAAACAGCT
GACCCAGTGATGGGGAATTTATCCTTGACCAATTTATCCTTGACCAATAACCTAATTGTCTATTCCTGAGTTATAAAAGTCCCCATCCTT
ATTAGCTCTACTGGAATTTTCATACACGTAAATGCAGAAGTTACTAAGTATTAAGTATTACTGAGTATTAAGTAGTAATCTGTCAGTTAT
TAAAATTTGTAAAATCTATTTATGAAAGGTCATTAAACCAGATCATGTTCCTTTTTTTGTAATCAAGGTGACTAAGAAAATCAGTTGTGT

>In-frame_HOOK3_ENST00000307602_chr8_42823358_+_RET_ENST00000340058_chr10_43612030_+_3155nt
CGGTCCCGAGTGAAAGGAGAAGGAGGGGCGCTGGGGGTGACGGTGCGGAGCCGCTGCCAGCGCTGGGCGAGAGTCGGCGGCCGGATCCGA
GGAGCAGGCGGGCCTGAGGCCGAGTCAGCTGCGCGGGCCCCCGGATCCCCCGACAGAGCGGCGGCGGTGTCTGGCCAGGCGGTAGGCGCT
GCCTGGCCGCGGCGGGGAAGATGTTCAGCGTAGAGTCGCTGGAGCGGGCGGAGCTGTGCGAGAGCCTCCTCACTTGGATCCAGACATTTA
ATGTGGATGCACCATGCCAGACCGTGGAAGATTTAACGAATGGGGTTGTGATGGCCCAGGTTCTTCAAAAGATAGATCCTGCATATTTTG
ATGAAAATTGGCTAAACAGAATCAAAACTGAAGTAGGAGATAATTGGAGGCTAAAGATAAGCAATTTAAAGAAAATTTTAAAAGGAATCT
TGGATTATAATCATGAGATTTTAGGACAGCAAATTAATGACTTTACCCTTCCTGATGTGAACCTTATTGGGGAGCATTCTGATGCAGCAG
AGCTTGGAAGGATGCTTCAGCTCATCTTAGGCTGTGCTGTGAACTGTGAACAGAAGCAAGAGTACATCCAAGCCATTATGATGATGGAGG
AATCTGTTCAACATGTTGTCATGACAGCCATTCAAGAGCTGATGAGTAAAGAATCTCCTGTCTCTGCTGGAAATGATGCCTATGTTGACC
TTGATCGTCAGCTGAAGAAAACTACAGAGGAACTAAATGAAGCTTTGTCAGCAAAGGAAGAAATTGCTCAAAGATGCCATGAACTGGATA
TGCAGGTTGCAGCATTGCAGGAAGAGAAAAGTAGTTTGTTGGCAGAGAATCAGGTATTAATGGAAAGACTCAATCAATCTGATTCTATAG
AAGACCCTAACAGTCCAGCAGGAAGAAGGCATTTGCAGCTCCAGACTCAATTAGAACAGCTCCAAGAAGAAACATTCAGACTAGAAGCAG
CCAAAGATGATTATCGAATACGTTGTGAAGAGTTAGAAAAGGAGATCTCTGAACTTCGGCAACAGAATGATGAACTGACCACTTTGGCAG
ATGAAGCTCAGTCTCTGAAAGATGAGATCGACGTGCTGAGACATTCTTCTGATAAAGTATCTAAACTAGAAGGTCAAGTAGAATCTTATA
AAAAGAAGCTAGAAGACCTTGGTGATTTAAGGCGGCAGGTTAAACTCTTAGAAGAGAAGAATACCATGTATATGCAGAATACTGTCAGTC
TAGAGGAAGAGTTAAGAAAGGCCAACGCAGCGCGAAGTCAACTTGAAACCTACAAGAGACAGGAGGATCCAAAGTGGGAATTCCCTCGGA
AGAACTTGGTTCTTGGAAAAACTCTAGGAGAAGGCGAATTTGGAAAAGTGGTCAAGGCAACGGCCTTCCATCTGAAAGGCAGAGCAGGGT
ACACCACGGTGGCCGTGAAGATGCTGAAAGAGAACGCCTCCCCGAGTGAGCTGCGAGACCTGCTGTCAGAGTTCAACGTCCTGAAGCAGG
TCAACCACCCACATGTCATCAAATTGTATGGGGCCTGCAGCCAGGATGGCCCGCTCCTCCTCATCGTGGAGTACGCCAAATACGGCTCCC
TGCGGGGCTTCCTCCGCGAGAGCCGCAAAGTGGGGCCTGGCTACCTGGGCAGTGGAGGCAGCCGCAACTCCAGCTCCCTGGACCACCCGG
ATGAGCGGGCCCTCACCATGGGCGACCTCATCTCATTTGCCTGGCAGATCTCACAGGGGATGCAGTATCTGGCCGAGATGAAGCTCGTTC
ATCGGGACTTGGCAGCCAGAAACATCCTGGTAGCTGAGGGGCGGAAGATGAAGATTTCGGATTTCGGCTTGTCCCGAGATGTTTATGAAG
AGGATTCCTACGTGAAGAGGAGCCAGGGTCGGATTCCAGTTAAATGGATGGCAATTGAATCCCTTTTTGATCATATCTACACCACGCAAA
GTGATGTATGGTCTTTTGGTGTCCTGCTGTGGGAGATCGTGACCCTAGGGGGAAACCCCTATCCTGGGATTCCTCCTGAGCGGCTCTTCA
ACCTTCTGAAGACCGGCCACCGGATGGAGAGGCCAGACAACTGCAGCGAGGAGATGTACCGCCTGATGCTGCAATGCTGGAAGCAGGAGC
CGGACAAAAGGCCGGTGTTTGCGGACATCAGCAAAGACCTGGAGAAGATGATGGTTAAGAGGAGAGACTACTTGGACCTTGCGGCGTCCA
CTCCATCTGACTCCCTGATTTATGACGACGGCCTCTCAGAGGAGGAGACACCGCTGGTGGACTGTAATAATGCCCCCCTCCCTCGAGCCC
TCCCTTCCACATGGATTGAAAACAAACTCTATGGTAGAATTTCCCATGCATTTACTAGATTCTAGCACCGCTGTCCCCTTTGCACTATCC
TTCCTCTCTGTGATGCTTTTTAAAAATGTTTCTGGTCTGAACAAAACCAAAGTCTGCTCTGAACCTTTTTATTTGTAAATGTCTGACTTT
GCATCCAGTTTACATTTAGGCATTATTGCAACTATGTTTTTCTAAAAGGATGTGAAAATAAGTGTAATTACCACATTGCCCAGCAACTTA
GGATGGTAGAGGAAAAAACAGATCAGGGCGGAACTCTCAGGGGAGACCAAGAACAGGTTGAATAAGGCGCTTCTGGGGTGGGAATCAAGT
CATAGTACTTCTACTTTAACTAAGTGGATAAATATACAAATCTGGGGAGGTATTCAGTTGAGAAAGGAGCCACCAGCACCACTCAGCCTG
CACTGGGAGCACAGCCAGGTTCCCCCAGACCCCTCCTGGGCAGGCAGGTGCCTCTCAGAGGCCACCCGGCACTGGCGAGCAGCCACTGGC
CAAGCCTCAGCCCCAGTCCCAGCCACATGTCCTCCATCAGGGGTAGCGAGGTTGCAGGAGCTGGCTGGCCCTGGGAGGACGCACCCCCAC
TGCTGTTTTCACATCCTTTCCCTTACCCACCTTCAGGACGGTTGTCACTTATGAAGTCAGTGCTAAAGCTGGAGCAGTTGCTTTTTGAAA
GAACATGGTCTGTGGTGCTGTGGTCTTACAATGGACAGTAAATATGGTTCTTGCCAAAACTCCTTCTTTTGTCTTTGATTAAATACTAGA


Top

FusionGenePPI for HOOK3_RET


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
HOOK3CUL3, AKTIP, HOOK1, HOOK2, HOOK3, FAM160A2, VPS16, VPS41, SCFD1, CCDC8, ZC4H2, COMTD1, TNFSF13B, IFT57, FNTB, MRE11A, NTRK1, SSX2IP, CEP63, DUSP3, FAM160A1, MTMR4, SYCE3, RALBP1, CDC16, NCAPH2, KLHL10, KLHL20RETSTAT3, DOK6, DOK5, SRC, SHC1, PTPRF, DOK2, DOK4, DOK1, GRB2, CRK, PLCG1, PDLIM7, GRB7, FRS2, NRTN, GFRA1, GRB10, IKBKG, MCRS1, CBL, CBLC, RET, HSP90AA1, NOTCH2NL, NOTCH3, AIP, EGFR, NTRK1, ZBTB48, HNRNPD, SORT1, SYNCRIP, SGTB, BAG6, HIST1H3A, KYNU, TXNL4A, ZCCHC8, ICE2, MAPK3, PTK2, MAPK1, PTPRR, DUSP26


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for HOOK3_RET


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
TgeneRETP07949DB05294VandetanibProto-oncogene tyrosine-protein kinase receptor Ret {ECO:0000305}small moleculeapproved
TgeneRETP07949DB08896RegorafenibProto-oncogene tyrosine-protein kinase receptor Ret {ECO:0000305}small moleculeapproved
TgeneRETP07949DB00398SorafenibProto-oncogene tyrosine-protein kinase receptor Ret {ECO:0000305}small moleculeapproved|investigational
TgeneRETP07949DB08875CabozantinibProto-oncogene tyrosine-protein kinase receptor Ret {ECO:0000305}small moleculeapproved|investigational
TgeneRETP07949DB08901PonatinibProto-oncogene tyrosine-protein kinase receptor Ret {ECO:0000305}small moleculeapproved|investigational

Top

RelatedDiseases for HOOK3_RET


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneHOOK3C0032460Polycystic Ovary Syndrome1CTD_human
TgeneRETC3888239HIRSCHSPRUNG DISEASE, SUSCEPTIBILITY TO, 115UNIPROT
TgeneRETC0025268Multiple Endocrine Neoplasia Type 2a14CTD_human;ORPHANET;UNIPROT
TgeneRETC1833921Familial medullary thyroid carcinoma14CTD_human;ORPHANET;UNIPROT
TgeneRETC0025269Multiple Endocrine Neoplasia Type 2b8CTD_human;ORPHANET;UNIPROT
TgeneRETC1275808Congenital central hypoventilation4CTD_human;ORPHANET;UNIPROT
TgeneRETC0009404Colorectal Neoplasms2CTD_human
TgeneRETC0019569Hirschsprung Disease2CTD_human;HPO;ORPHANET
TgeneRETC0006413Burkitt Lymphoma1CTD_human
TgeneRETC0027662Multiple Endocrine Neoplasia1CTD_human
TgeneRETC0031511Pheochromocytoma1CTD_human;HPO;UNIPROT
TgeneRETC0038220Status Epilepticus1CTD_human
TgeneRETC0040136Thyroid Neoplasm1CTD_human
TgeneRETC0206693Medullary carcinoma1CTD_human
TgeneRETC0238462Medullary carcinoma of thyroid1CTD_human;HPO
TgeneRETC0740340Amyloidosis, Familial1CTD_human
TgeneRETC1609433Congenital absence of kidneys syndrome1CTD_human;ORPHANET