FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 16660

FusionGeneSummary for HOMER1_MAST2

check button Fusion gene summary
Fusion gene informationFusion gene name: HOMER1_MAST2
Fusion gene ID: 16660
HgeneTgene
Gene symbol

HOMER1

MAST2

Gene ID

9456

23139

Gene namehomer scaffold protein 1microtubule associated serine/threonine kinase 2
SynonymsHOMER|HOMER1A|HOMER1B|HOMER1C|SYN47|Ves-1MAST205|MTSSK
Cytomap

5q14.1

1p34.1

Type of geneprotein-codingprotein-coding
Descriptionhomer protein homolog 1homer homolog 1homer scaffolding protein 1homer, neuronal immediate early gene, 1homer-1microtubule-associated serine/threonine-protein kinase 2microtubule associated testis specific serine/threonine protein kinase
Modification date2018052320180523
UniProtAcc

Q86YM7

Q6P0Q8

Ensembl transtripts involved in fusion geneENST00000334082, ENST00000535690, 
ENST00000508576, ENST00000282260, 
ENST00000372009, ENST00000361297, 
ENST00000477968, 
Fusion gene scores* DoF score3 X 3 X 3=279 X 8 X 8=576
# samples 39
** MAII scorelog2(3/27*10)=0.15200309344505
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(9/576*10)=-2.67807190511264
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: HOMER1 [Title/Abstract] AND MAST2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationKinase involved fusion gene, inframe and retained kinase domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneHOMER1

GO:0051592

response to calcium ion

14505576


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLGGTCGA-HT-7882-01AHOMER1chr5

78808593

-MAST2chr1

46348036

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000334082ENST00000372009HOMER1chr5

78808593

-MAST2chr1

46348036

+
In-frameENST00000334082ENST00000361297HOMER1chr5

78808593

-MAST2chr1

46348036

+
5CDS-intronENST00000334082ENST00000477968HOMER1chr5

78808593

-MAST2chr1

46348036

+
In-frameENST00000535690ENST00000372009HOMER1chr5

78808593

-MAST2chr1

46348036

+
In-frameENST00000535690ENST00000361297HOMER1chr5

78808593

-MAST2chr1

46348036

+
5CDS-intronENST00000535690ENST00000477968HOMER1chr5

78808593

-MAST2chr1

46348036

+
In-frameENST00000508576ENST00000372009HOMER1chr5

78808593

-MAST2chr1

46348036

+
In-frameENST00000508576ENST00000361297HOMER1chr5

78808593

-MAST2chr1

46348036

+
5CDS-intronENST00000508576ENST00000477968HOMER1chr5

78808593

-MAST2chr1

46348036

+
In-frameENST00000282260ENST00000372009HOMER1chr5

78808593

-MAST2chr1

46348036

+
In-frameENST00000282260ENST00000361297HOMER1chr5

78808593

-MAST2chr1

46348036

+
5CDS-intronENST00000282260ENST00000477968HOMER1chr5

78808593

-MAST2chr1

46348036

+

Top

FusionProtFeatures for HOMER1_MAST2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
HOMER1

Q86YM7

MAST2

Q6P0Q8

Postsynaptic density scaffolding protein. Binds andcross-links cytoplasmic regions of GRM1, GRM5, ITPR1, DNM3, RYR1,RYR2, SHANK1 and SHANK3. By physically linking GRM1 and GRM5 withER-associated ITPR1 receptors, it aids the coupling of surfacereceptors to intracellular calcium release. May also couple GRM1to PI3 kinase through its interaction with AGAP2. Isoform 1regulates the trafficking and surface expression of GRM5. Isoform3 acts as a natural dominant negative, in dynamic competition withconstitutively expressed isoform 1 to regulate synapticmetabotropic glutamate function. Isoform 3, may be involved in thestructural changes that occur at synapses during long-lastingneuronal plasticity and development. Forms a high-order complexwith SHANK1, which in turn is necessary for the structural andfunctional integrity of dendritic spines (By similarity).{ECO:0000250|UniProtKB:Q9Z214}. Appears to link the dystrophin/utrophin network withmicrotubule filaments via the syntrophins. Phosphorylation of DMDor UTRN may modulate their affinities for associated proteins.Functions in a multi-protein complex in spermatid maturation.Regulates lipopolysaccharide-induced IL-12 synthesis inmacrophages by forming a complex with TRAF6, resulting in theinhibition of TRAF6 NF-kappa-B activation (By similarity).{ECO:0000250}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneMAST2chr5:78808593chr1:46348036ENST00000361297+2291104_11921561799DomainPDZ
TgeneMAST2chr5:78808593chr1:46348036ENST00000361297+229512_7851561799DomainProtein kinase
TgeneMAST2chr5:78808593chr1:46348036ENST00000361297+229786_8541561799DomainNote=AGC-kinase C-terminal
TgeneMAST2chr5:78808593chr1:46348036ENST00000361297+229518_5261561799Nucleotide bindingATP

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneHOMER1chr5:78808593chr1:46348036ENST00000282260-16181_3521225Coiled coilOntology_term=ECO:0000255
HgeneHOMER1chr5:78808593chr1:46348036ENST00000334082-19181_3521355Coiled coilOntology_term=ECO:0000255
HgeneHOMER1chr5:78808593chr1:46348036ENST00000508576-16181_3521178Coiled coilOntology_term=ECO:0000255
HgeneHOMER1chr5:78808593chr1:46348036ENST00000282260-161_1101225DomainWH1
HgeneHOMER1chr5:78808593chr1:46348036ENST00000334082-191_1101355DomainWH1
HgeneHOMER1chr5:78808593chr1:46348036ENST00000508576-161_1101178DomainWH1
HgeneHOMER1chr5:78808593chr1:46348036ENST00000282260-16290_3541225RegionRequired for tetramerization
HgeneHOMER1chr5:78808593chr1:46348036ENST00000334082-19290_3541355RegionRequired for tetramerization
HgeneHOMER1chr5:78808593chr1:46348036ENST00000508576-16290_3541178RegionRequired for tetramerization


Top

FusionGeneSequence for HOMER1_MAST2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_HOMER1_ENST00000334082_chr5_78808593_-_MAST2_ENST00000372009_chr1_46348036_+_1454aa
MGRSXAFQEEAAFVGQVTARAXLXPLAHHLHYHGHTHHSMATQVTVLWTAPGISLQMHLLTFLLFLPVGLMGGAGLWPLCPLQDMELTLL
APLSHHHAPHRKSCISCLSSLQLMSCTFXRSISAQRAYQMRKDGSPQPCGLAPGASVPDDPQYPLTVKXXXXIMFTKKDSQRLMSAQRAQ
KWLLXCSWXKSXXLSLPAQHVSWNAWSLTLKSSTTFXKQLRATPKRDKGLNVTFPATSLASWASPGIPXKKWPSXAAVTVLTLQRQMILL
RAMGHLCHLKRHPLKRTSRPLSSSAMAPMGLYFWCGTSPPGSALPXRRSTSRTXSYGTRSSRPSWSVTYXLSLRTPLWSACSAPLIPSAT
CAWXWSTLKGETVPLCXRILGPCLWTWCVYTLRKLCWPWSTYTTMASCTVTSSLTTSXLHPWGTSSSRTLDCPKLASXVXQRTCMRVILK
RMPGNSWTSRYAGPQNTLRLRXSCARAMGSQWTGGPWALSCMSSWWAASLFLEILRRSSLGRXSVMRLCGLRVMRHCPQTPRTSPPNCST
RTLWRDLAQAVPMRXSSTHSLLVWTGQDFSARRLNLFLSWSQRMILAILTPAQSDTTTWTRRMRKKXVRMAALRSASSLPALQGSTRCTA
AWSGSHCSRSAGHHPRPSAAXVRRRRTIQMAWQGSKAETGAGXLAPLRYYGSGCRCLSHPTQRVTQALQXQCDAAAQASWMRLGSRRALR
RPAAPSGGNHRRVYGSXHPHLERGYLGLSLNTQGSSGQSWMRKLLAGAVVPVQLWRPEAVGPHSWLREPQPRPSVTWLCVGPATGCSLGT
QQRSALLALSTKXSSPPQPQPSHSSFLRNTTPAPRWPAPCPHILSRPTHHPGTLLHMASPCGPFASTWVTPMSTPCTIWCGTWRMEVRPV
RQGFVKVTSSPMSMGNLCMAWCTRRWXSXSXRVETRWPFQQLPWRTHPLKWGQLGRAATRPRWPEGARGAAARMGKKAEKGAPCSARSPS
KHPCSTPAAAFLPLTAPCHQGRVGQALPHTATAFPPDLPLKATGXPPMLCIQNSHGPRVRSHPVHHYSRGCSRLRNWQQHLPPLRRSXPL
LASTALTCPTLNXRRNCRPGKXALWRXLEPGVCCLARGPCQGRGCCSLLPHGPXAPSGRTEPNDGSRCRSKKPFVRWTPQRTTPRKGLRT
ARVHRSXAWHLTQKXARVWPLKEQERVGKRILSRPETLGAWAQWSQAYXQGSHWGLPEWKVPVVPTGGSGAHKPLRRLPAPPQQAPTXVS
LEPQTPSLLKVAGRPSTSTPRHXQHFLPALRDSPPPAVALLPAPPLGSXACGPGNPLLRAQTGHPQAERQPWQVGXPTSRIWKTQLQPSL
RTCLPGSRGRHSHLVPPDWPIHLMRIPARAGYGSLSVHKQXKRIQPXASPKCLMPQVTEGRTFHAEAAPSPRSLSPASGGAKNQGAIKSI

>In-frame_HOMER1_ENST00000334082_chr5_78808593_-_MAST2_ENST00000361297_chr1_46348036_+_1644aa
MGRSXAFQEEAAFVGQVTARAXLXPLAHHLHYHGHTHHSMATQVTVLWTAPGISLQMHLLTFLLFLPVGLMGGAGLWPLCPLQDMELTLL
APLSHHHAPHRKSCISCLSSLQLMSCTFXRSISAQRAYQMRKDGSPQPCGLAPGASVPDDPQYPLTVKXXXXIMFTKKDSQRPPHKWKSD
XQSLFPPTLQTACCPWQMEPXALFIIRXLRWPETAWINLGVASLHHNTSTNFKIIWRNFYKMLMSAQRAQKWLLXCSWXKSXXLSLPAQH
VSWNAWSLTLKSSTTFXKQLRATPKRDKGLNVTFPATSLASWASPGIPXKKWPSXAAVTVLTLQRQMILLRAMGHLCHLKRHPLKRTSRP
LSSSAMAPMGLYFWCGTSPPGSALPXRRSTSRTXSYGTRSSRPSWSVTYXLSLRTPLWSACSAPLIPSATCAWXWSTLKGETVPLCXRIL
GPCLWTWCVYTLRKLCWPWSTYTTMASCTVTSSLTTSXLHPWGTSSSRTLDCPKLASXVXQRTCMRVILKRMPGNSWTSRYAGPQNTLRL
RXSCARAMGSQWTGGPWALSCMSSWWAASLFLEILRRSSLGRXSVMRLCGLRVMRHCPQTPRTSPPNCSTRTLWRDLAQAVPMRXSSTHS
LLVWTGQDFSARRLNLFLSWSQRMILAILTPAQSDTTTWTRRMRKKXVRMAALRSASSLPALQGSTRCTAAWSGSHCSRSAGHHPRPSAA
XVRRRRTIQMAWQGSKAETGAGXLAPLRYYGSGCRCLSHPTQRVTQALQXQCDAAAQASWMRLGSRRALRRPAAPSGGNHRRVYGSXHPH
LERGYLGLSLNTQGSSGQSWMRKLLAGAVVPVQLWRPEAVGPHSWLREPQPRPSVTWLCVGPATGCSLGTQQRSALLALSTKXSSPPQPQ
PSHSSFLRNTTPAPRWPAPCPHILSRPTHHPGTLLQAGTSCQPLAAXGLPSSSTELARSMASPCGPFASTWVTPMSTPCTIWCGTWRMEV
RPVRQGFVKVTSSPMSMGNLCMAWCTRRWXSXSXRVETRWPFQQLPWRTHPLKWGQLGRAATRPRWPEGARGAAARMGKKAEKGAPCSAR
SPSKHPCSTPAAAFLPLTAPCHQGRVGQALPHTATAFPPDLPLKATGXPPMLCIQWEGIHHRAAPPAPACPVPQPALGTHGPAPSTVWHP
SSNASTALHGASQQAASHCHHWPTPLLPHPQQLHLSGPHRPCLAMXPRPFPQSFTCHLPWAGNSHGPRVRSHPVHHYSRGCSRLRNWQQH
LPPLRRSXPLLASTALTCPTLNXRRNCRPGKXALWRXLEPGVCCLARGPCQGRGCCSLLPHGPXAPSGRTEPNDGSRCRSKKPFVRWTPQ
RTTPRKGLRTARVHRSXAWHLTQKXARVWPLKEQERVGKRILSRPETLGAWAQWSQAYXQGSHWGLPEWKVPVVPTGGSGAHKPLRRLPA
PPQQAPTXVSLEPQTPSLLKVAGRPSTSTPRHXQHFLPALRDSPPPAVALLPAPPLGSXACGPGNPLLRAQTGHPQAERQPWQVGXPTSR
IWKTQLQPSLRTCLPGSRGRHSHLVPPDWPIHLMRIPARAGYGSLSVHKQXKRIQPXASPKCLMPQVTEGRTFHAEAAPSPRSLSPASGG

>In-frame_HOMER1_ENST00000535690_chr5_78808593_-_MAST2_ENST00000372009_chr1_46348036_+_1454aa
MGRSXAFQEEAAFVGQVTARAXLXPLAHHLHYHGHTHHSMATQVTVLWTAPGISLQMHLLTFLLFLPVGLMGGAGLWPLCPLQDMELTLL
APLSHHHAPHRKSCISCLSSLQLMSCTFXRSISAQRAYQMRKDGSPQPCGLAPGASVPDDPQYPLTVKXXXXIMFTKKDSQRLMSAQRAQ
KWLLXCSWXKSXXLSLPAQHVSWNAWSLTLKSSTTFXKQLRATPKRDKGLNVTFPATSLASWASPGIPXKKWPSXAAVTVLTLQRQMILL
RAMGHLCHLKRHPLKRTSRPLSSSAMAPMGLYFWCGTSPPGSALPXRRSTSRTXSYGTRSSRPSWSVTYXLSLRTPLWSACSAPLIPSAT
CAWXWSTLKGETVPLCXRILGPCLWTWCVYTLRKLCWPWSTYTTMASCTVTSSLTTSXLHPWGTSSSRTLDCPKLASXVXQRTCMRVILK
RMPGNSWTSRYAGPQNTLRLRXSCARAMGSQWTGGPWALSCMSSWWAASLFLEILRRSSLGRXSVMRLCGLRVMRHCPQTPRTSPPNCST
RTLWRDLAQAVPMRXSSTHSLLVWTGQDFSARRLNLFLSWSQRMILAILTPAQSDTTTWTRRMRKKXVRMAALRSASSLPALQGSTRCTA
AWSGSHCSRSAGHHPRPSAAXVRRRRTIQMAWQGSKAETGAGXLAPLRYYGSGCRCLSHPTQRVTQALQXQCDAAAQASWMRLGSRRALR
RPAAPSGGNHRRVYGSXHPHLERGYLGLSLNTQGSSGQSWMRKLLAGAVVPVQLWRPEAVGPHSWLREPQPRPSVTWLCVGPATGCSLGT
QQRSALLALSTKXSSPPQPQPSHSSFLRNTTPAPRWPAPCPHILSRPTHHPGTLLHMASPCGPFASTWVTPMSTPCTIWCGTWRMEVRPV
RQGFVKVTSSPMSMGNLCMAWCTRRWXSXSXRVETRWPFQQLPWRTHPLKWGQLGRAATRPRWPEGARGAAARMGKKAEKGAPCSARSPS
KHPCSTPAAAFLPLTAPCHQGRVGQALPHTATAFPPDLPLKATGXPPMLCIQNSHGPRVRSHPVHHYSRGCSRLRNWQQHLPPLRRSXPL
LASTALTCPTLNXRRNCRPGKXALWRXLEPGVCCLARGPCQGRGCCSLLPHGPXAPSGRTEPNDGSRCRSKKPFVRWTPQRTTPRKGLRT
ARVHRSXAWHLTQKXARVWPLKEQERVGKRILSRPETLGAWAQWSQAYXQGSHWGLPEWKVPVVPTGGSGAHKPLRRLPAPPQQAPTXVS
LEPQTPSLLKVAGRPSTSTPRHXQHFLPALRDSPPPAVALLPAPPLGSXACGPGNPLLRAQTGHPQAERQPWQVGXPTSRIWKTQLQPSL
RTCLPGSRGRHSHLVPPDWPIHLMRIPARAGYGSLSVHKQXKRIQPXASPKCLMPQVTEGRTFHAEAAPSPRSLSPASGGAKNQGAIKSI

>In-frame_HOMER1_ENST00000535690_chr5_78808593_-_MAST2_ENST00000361297_chr1_46348036_+_1644aa
MGRSXAFQEEAAFVGQVTARAXLXPLAHHLHYHGHTHHSMATQVTVLWTAPGISLQMHLLTFLLFLPVGLMGGAGLWPLCPLQDMELTLL
APLSHHHAPHRKSCISCLSSLQLMSCTFXRSISAQRAYQMRKDGSPQPCGLAPGASVPDDPQYPLTVKXXXXIMFTKKDSQRPPHKWKSD
XQSLFPPTLQTACCPWQMEPXALFIIRXLRWPETAWINLGVASLHHNTSTNFKIIWRNFYKMLMSAQRAQKWLLXCSWXKSXXLSLPAQH
VSWNAWSLTLKSSTTFXKQLRATPKRDKGLNVTFPATSLASWASPGIPXKKWPSXAAVTVLTLQRQMILLRAMGHLCHLKRHPLKRTSRP
LSSSAMAPMGLYFWCGTSPPGSALPXRRSTSRTXSYGTRSSRPSWSVTYXLSLRTPLWSACSAPLIPSATCAWXWSTLKGETVPLCXRIL
GPCLWTWCVYTLRKLCWPWSTYTTMASCTVTSSLTTSXLHPWGTSSSRTLDCPKLASXVXQRTCMRVILKRMPGNSWTSRYAGPQNTLRL
RXSCARAMGSQWTGGPWALSCMSSWWAASLFLEILRRSSLGRXSVMRLCGLRVMRHCPQTPRTSPPNCSTRTLWRDLAQAVPMRXSSTHS
LLVWTGQDFSARRLNLFLSWSQRMILAILTPAQSDTTTWTRRMRKKXVRMAALRSASSLPALQGSTRCTAAWSGSHCSRSAGHHPRPSAA
XVRRRRTIQMAWQGSKAETGAGXLAPLRYYGSGCRCLSHPTQRVTQALQXQCDAAAQASWMRLGSRRALRRPAAPSGGNHRRVYGSXHPH
LERGYLGLSLNTQGSSGQSWMRKLLAGAVVPVQLWRPEAVGPHSWLREPQPRPSVTWLCVGPATGCSLGTQQRSALLALSTKXSSPPQPQ
PSHSSFLRNTTPAPRWPAPCPHILSRPTHHPGTLLQAGTSCQPLAAXGLPSSSTELARSMASPCGPFASTWVTPMSTPCTIWCGTWRMEV
RPVRQGFVKVTSSPMSMGNLCMAWCTRRWXSXSXRVETRWPFQQLPWRTHPLKWGQLGRAATRPRWPEGARGAAARMGKKAEKGAPCSAR
SPSKHPCSTPAAAFLPLTAPCHQGRVGQALPHTATAFPPDLPLKATGXPPMLCIQWEGIHHRAAPPAPACPVPQPALGTHGPAPSTVWHP
SSNASTALHGASQQAASHCHHWPTPLLPHPQQLHLSGPHRPCLAMXPRPFPQSFTCHLPWAGNSHGPRVRSHPVHHYSRGCSRLRNWQQH
LPPLRRSXPLLASTALTCPTLNXRRNCRPGKXALWRXLEPGVCCLARGPCQGRGCCSLLPHGPXAPSGRTEPNDGSRCRSKKPFVRWTPQ
RTTPRKGLRTARVHRSXAWHLTQKXARVWPLKEQERVGKRILSRPETLGAWAQWSQAYXQGSHWGLPEWKVPVVPTGGSGAHKPLRRLPA
PPQQAPTXVSLEPQTPSLLKVAGRPSTSTPRHXQHFLPALRDSPPPAVALLPAPPLGSXACGPGNPLLRAQTGHPQAERQPWQVGXPTSR
IWKTQLQPSLRTCLPGSRGRHSHLVPPDWPIHLMRIPARAGYGSLSVHKQXKRIQPXASPKCLMPQVTEGRTFHAEAAPSPRSLSPASGG

>In-frame_HOMER1_ENST00000508576_chr5_78808593_-_MAST2_ENST00000372009_chr1_46348036_+_1454aa
MGRSXAFQEEAAFVGQVTARAXLXPLAHHLHYHGHTHHSMATQVTVLWTAPGISLQMHLLTFLLFLPVGLMGGAGLWPLCPLQDMELTLL
APLSHHHAPHRKSCISCLSSLQLMSCTFXRSISAQRAYQMRKDGSPQPCGLAPGASVPDDPQYPLTVKXXXXIMFTKKDSQRLMSAQRAQ
KWLLXCSWXKSXXLSLPAQHVSWNAWSLTLKSSTTFXKQLRATPKRDKGLNVTFPATSLASWASPGIPXKKWPSXAAVTVLTLQRQMILL
RAMGHLCHLKRHPLKRTSRPLSSSAMAPMGLYFWCGTSPPGSALPXRRSTSRTXSYGTRSSRPSWSVTYXLSLRTPLWSACSAPLIPSAT
CAWXWSTLKGETVPLCXRILGPCLWTWCVYTLRKLCWPWSTYTTMASCTVTSSLTTSXLHPWGTSSSRTLDCPKLASXVXQRTCMRVILK
RMPGNSWTSRYAGPQNTLRLRXSCARAMGSQWTGGPWALSCMSSWWAASLFLEILRRSSLGRXSVMRLCGLRVMRHCPQTPRTSPPNCST
RTLWRDLAQAVPMRXSSTHSLLVWTGQDFSARRLNLFLSWSQRMILAILTPAQSDTTTWTRRMRKKXVRMAALRSASSLPALQGSTRCTA
AWSGSHCSRSAGHHPRPSAAXVRRRRTIQMAWQGSKAETGAGXLAPLRYYGSGCRCLSHPTQRVTQALQXQCDAAAQASWMRLGSRRALR
RPAAPSGGNHRRVYGSXHPHLERGYLGLSLNTQGSSGQSWMRKLLAGAVVPVQLWRPEAVGPHSWLREPQPRPSVTWLCVGPATGCSLGT
QQRSALLALSTKXSSPPQPQPSHSSFLRNTTPAPRWPAPCPHILSRPTHHPGTLLHMASPCGPFASTWVTPMSTPCTIWCGTWRMEVRPV
RQGFVKVTSSPMSMGNLCMAWCTRRWXSXSXRVETRWPFQQLPWRTHPLKWGQLGRAATRPRWPEGARGAAARMGKKAEKGAPCSARSPS
KHPCSTPAAAFLPLTAPCHQGRVGQALPHTATAFPPDLPLKATGXPPMLCIQNSHGPRVRSHPVHHYSRGCSRLRNWQQHLPPLRRSXPL
LASTALTCPTLNXRRNCRPGKXALWRXLEPGVCCLARGPCQGRGCCSLLPHGPXAPSGRTEPNDGSRCRSKKPFVRWTPQRTTPRKGLRT
ARVHRSXAWHLTQKXARVWPLKEQERVGKRILSRPETLGAWAQWSQAYXQGSHWGLPEWKVPVVPTGGSGAHKPLRRLPAPPQQAPTXVS
LEPQTPSLLKVAGRPSTSTPRHXQHFLPALRDSPPPAVALLPAPPLGSXACGPGNPLLRAQTGHPQAERQPWQVGXPTSRIWKTQLQPSL
RTCLPGSRGRHSHLVPPDWPIHLMRIPARAGYGSLSVHKQXKRIQPXASPKCLMPQVTEGRTFHAEAAPSPRSLSPASGGAKNQGAIKSI

>In-frame_HOMER1_ENST00000508576_chr5_78808593_-_MAST2_ENST00000361297_chr1_46348036_+_1644aa
MGRSXAFQEEAAFVGQVTARAXLXPLAHHLHYHGHTHHSMATQVTVLWTAPGISLQMHLLTFLLFLPVGLMGGAGLWPLCPLQDMELTLL
APLSHHHAPHRKSCISCLSSLQLMSCTFXRSISAQRAYQMRKDGSPQPCGLAPGASVPDDPQYPLTVKXXXXIMFTKKDSQRPPHKWKSD
XQSLFPPTLQTACCPWQMEPXALFIIRXLRWPETAWINLGVASLHHNTSTNFKIIWRNFYKMLMSAQRAQKWLLXCSWXKSXXLSLPAQH
VSWNAWSLTLKSSTTFXKQLRATPKRDKGLNVTFPATSLASWASPGIPXKKWPSXAAVTVLTLQRQMILLRAMGHLCHLKRHPLKRTSRP
LSSSAMAPMGLYFWCGTSPPGSALPXRRSTSRTXSYGTRSSRPSWSVTYXLSLRTPLWSACSAPLIPSATCAWXWSTLKGETVPLCXRIL
GPCLWTWCVYTLRKLCWPWSTYTTMASCTVTSSLTTSXLHPWGTSSSRTLDCPKLASXVXQRTCMRVILKRMPGNSWTSRYAGPQNTLRL
RXSCARAMGSQWTGGPWALSCMSSWWAASLFLEILRRSSLGRXSVMRLCGLRVMRHCPQTPRTSPPNCSTRTLWRDLAQAVPMRXSSTHS
LLVWTGQDFSARRLNLFLSWSQRMILAILTPAQSDTTTWTRRMRKKXVRMAALRSASSLPALQGSTRCTAAWSGSHCSRSAGHHPRPSAA
XVRRRRTIQMAWQGSKAETGAGXLAPLRYYGSGCRCLSHPTQRVTQALQXQCDAAAQASWMRLGSRRALRRPAAPSGGNHRRVYGSXHPH
LERGYLGLSLNTQGSSGQSWMRKLLAGAVVPVQLWRPEAVGPHSWLREPQPRPSVTWLCVGPATGCSLGTQQRSALLALSTKXSSPPQPQ
PSHSSFLRNTTPAPRWPAPCPHILSRPTHHPGTLLQAGTSCQPLAAXGLPSSSTELARSMASPCGPFASTWVTPMSTPCTIWCGTWRMEV
RPVRQGFVKVTSSPMSMGNLCMAWCTRRWXSXSXRVETRWPFQQLPWRTHPLKWGQLGRAATRPRWPEGARGAAARMGKKAEKGAPCSAR
SPSKHPCSTPAAAFLPLTAPCHQGRVGQALPHTATAFPPDLPLKATGXPPMLCIQWEGIHHRAAPPAPACPVPQPALGTHGPAPSTVWHP
SSNASTALHGASQQAASHCHHWPTPLLPHPQQLHLSGPHRPCLAMXPRPFPQSFTCHLPWAGNSHGPRVRSHPVHHYSRGCSRLRNWQQH
LPPLRRSXPLLASTALTCPTLNXRRNCRPGKXALWRXLEPGVCCLARGPCQGRGCCSLLPHGPXAPSGRTEPNDGSRCRSKKPFVRWTPQ
RTTPRKGLRTARVHRSXAWHLTQKXARVWPLKEQERVGKRILSRPETLGAWAQWSQAYXQGSHWGLPEWKVPVVPTGGSGAHKPLRRLPA
PPQQAPTXVSLEPQTPSLLKVAGRPSTSTPRHXQHFLPALRDSPPPAVALLPAPPLGSXACGPGNPLLRAQTGHPQAERQPWQVGXPTSR
IWKTQLQPSLRTCLPGSRGRHSHLVPPDWPIHLMRIPARAGYGSLSVHKQXKRIQPXASPKCLMPQVTEGRTFHAEAAPSPRSLSPASGG

>In-frame_HOMER1_ENST00000282260_chr5_78808593_-_MAST2_ENST00000372009_chr1_46348036_+_1454aa
MGRSXAFQEEAAFVGQVTARAXLXPLAHHLHYHGHTHHSMATQVTVLWTAPGISLQMHLLTFLLFLPVGLMGGAGLWPLCPLQDMELTLL
APLSHHHAPHRKSCISCLSSLQLMSCTFXRSISAQRAYQMRKDGSPQPCGLAPGASVPDDPQYPLTVKXXXXIMFTKKDSQRLMSAQRAQ
KWLLXCSWXKSXXLSLPAQHVSWNAWSLTLKSSTTFXKQLRATPKRDKGLNVTFPATSLASWASPGIPXKKWPSXAAVTVLTLQRQMILL
RAMGHLCHLKRHPLKRTSRPLSSSAMAPMGLYFWCGTSPPGSALPXRRSTSRTXSYGTRSSRPSWSVTYXLSLRTPLWSACSAPLIPSAT
CAWXWSTLKGETVPLCXRILGPCLWTWCVYTLRKLCWPWSTYTTMASCTVTSSLTTSXLHPWGTSSSRTLDCPKLASXVXQRTCMRVILK
RMPGNSWTSRYAGPQNTLRLRXSCARAMGSQWTGGPWALSCMSSWWAASLFLEILRRSSLGRXSVMRLCGLRVMRHCPQTPRTSPPNCST
RTLWRDLAQAVPMRXSSTHSLLVWTGQDFSARRLNLFLSWSQRMILAILTPAQSDTTTWTRRMRKKXVRMAALRSASSLPALQGSTRCTA
AWSGSHCSRSAGHHPRPSAAXVRRRRTIQMAWQGSKAETGAGXLAPLRYYGSGCRCLSHPTQRVTQALQXQCDAAAQASWMRLGSRRALR
RPAAPSGGNHRRVYGSXHPHLERGYLGLSLNTQGSSGQSWMRKLLAGAVVPVQLWRPEAVGPHSWLREPQPRPSVTWLCVGPATGCSLGT
QQRSALLALSTKXSSPPQPQPSHSSFLRNTTPAPRWPAPCPHILSRPTHHPGTLLHMASPCGPFASTWVTPMSTPCTIWCGTWRMEVRPV
RQGFVKVTSSPMSMGNLCMAWCTRRWXSXSXRVETRWPFQQLPWRTHPLKWGQLGRAATRPRWPEGARGAAARMGKKAEKGAPCSARSPS
KHPCSTPAAAFLPLTAPCHQGRVGQALPHTATAFPPDLPLKATGXPPMLCIQNSHGPRVRSHPVHHYSRGCSRLRNWQQHLPPLRRSXPL
LASTALTCPTLNXRRNCRPGKXALWRXLEPGVCCLARGPCQGRGCCSLLPHGPXAPSGRTEPNDGSRCRSKKPFVRWTPQRTTPRKGLRT
ARVHRSXAWHLTQKXARVWPLKEQERVGKRILSRPETLGAWAQWSQAYXQGSHWGLPEWKVPVVPTGGSGAHKPLRRLPAPPQQAPTXVS
LEPQTPSLLKVAGRPSTSTPRHXQHFLPALRDSPPPAVALLPAPPLGSXACGPGNPLLRAQTGHPQAERQPWQVGXPTSRIWKTQLQPSL
RTCLPGSRGRHSHLVPPDWPIHLMRIPARAGYGSLSVHKQXKRIQPXASPKCLMPQVTEGRTFHAEAAPSPRSLSPASGGAKNQGAIKSI

>In-frame_HOMER1_ENST00000282260_chr5_78808593_-_MAST2_ENST00000361297_chr1_46348036_+_1644aa
MGRSXAFQEEAAFVGQVTARAXLXPLAHHLHYHGHTHHSMATQVTVLWTAPGISLQMHLLTFLLFLPVGLMGGAGLWPLCPLQDMELTLL
APLSHHHAPHRKSCISCLSSLQLMSCTFXRSISAQRAYQMRKDGSPQPCGLAPGASVPDDPQYPLTVKXXXXIMFTKKDSQRPPHKWKSD
XQSLFPPTLQTACCPWQMEPXALFIIRXLRWPETAWINLGVASLHHNTSTNFKIIWRNFYKMLMSAQRAQKWLLXCSWXKSXXLSLPAQH
VSWNAWSLTLKSSTTFXKQLRATPKRDKGLNVTFPATSLASWASPGIPXKKWPSXAAVTVLTLQRQMILLRAMGHLCHLKRHPLKRTSRP
LSSSAMAPMGLYFWCGTSPPGSALPXRRSTSRTXSYGTRSSRPSWSVTYXLSLRTPLWSACSAPLIPSATCAWXWSTLKGETVPLCXRIL
GPCLWTWCVYTLRKLCWPWSTYTTMASCTVTSSLTTSXLHPWGTSSSRTLDCPKLASXVXQRTCMRVILKRMPGNSWTSRYAGPQNTLRL
RXSCARAMGSQWTGGPWALSCMSSWWAASLFLEILRRSSLGRXSVMRLCGLRVMRHCPQTPRTSPPNCSTRTLWRDLAQAVPMRXSSTHS
LLVWTGQDFSARRLNLFLSWSQRMILAILTPAQSDTTTWTRRMRKKXVRMAALRSASSLPALQGSTRCTAAWSGSHCSRSAGHHPRPSAA
XVRRRRTIQMAWQGSKAETGAGXLAPLRYYGSGCRCLSHPTQRVTQALQXQCDAAAQASWMRLGSRRALRRPAAPSGGNHRRVYGSXHPH
LERGYLGLSLNTQGSSGQSWMRKLLAGAVVPVQLWRPEAVGPHSWLREPQPRPSVTWLCVGPATGCSLGTQQRSALLALSTKXSSPPQPQ
PSHSSFLRNTTPAPRWPAPCPHILSRPTHHPGTLLQAGTSCQPLAAXGLPSSSTELARSMASPCGPFASTWVTPMSTPCTIWCGTWRMEV
RPVRQGFVKVTSSPMSMGNLCMAWCTRRWXSXSXRVETRWPFQQLPWRTHPLKWGQLGRAATRPRWPEGARGAAARMGKKAEKGAPCSAR
SPSKHPCSTPAAAFLPLTAPCHQGRVGQALPHTATAFPPDLPLKATGXPPMLCIQWEGIHHRAAPPAPACPVPQPALGTHGPAPSTVWHP
SSNASTALHGASQQAASHCHHWPTPLLPHPQQLHLSGPHRPCLAMXPRPFPQSFTCHLPWAGNSHGPRVRSHPVHHYSRGCSRLRNWQQH
LPPLRRSXPLLASTALTCPTLNXRRNCRPGKXALWRXLEPGVCCLARGPCQGRGCCSLLPHGPXAPSGRTEPNDGSRCRSKKPFVRWTPQ
RTTPRKGLRTARVHRSXAWHLTQKXARVWPLKEQERVGKRILSRPETLGAWAQWSQAYXQGSHWGLPEWKVPVVPTGGSGAHKPLRRLPA
PPQQAPTXVSLEPQTPSLLKVAGRPSTSTPRHXQHFLPALRDSPPPAVALLPAPPLGSXACGPGNPLLRAQTGHPQAERQPWQVGXPTSR
IWKTQLQPSLRTCLPGSRGRHSHLVPPDWPIHLMRIPARAGYGSLSVHKQXKRIQPXASPKCLMPQVTEGRTFHAEAAPSPRSLSPASGG


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_HOMER1_ENST00000334082_chr5_78808593_-_MAST2_ENST00000372009_chr1_46348036_+_4364nt
ATGGGAAGGAGTTGAGCCTTCCAAGAAGAGGCAGCTTTTGTCGGACAAGTAACCGCAAGAGCTTGATTGTGACCTCTAGCACATCACCTA
CACTACCACGGCCACACTCACCACTCCATGGCCACACAGGTAACAGTCCTTTGGACAGCCCCCGGAATTTCTCTCCAAATGCACCTGCTC
ACTTTTCTTTTGTTCCTGCCCGTAGGACTGATGGGCGGCGCTGGTCTTTGGCCTCTTTGCCCTCTTCAGGATATGGAACTAACACTCCTA
GCTCCACTGTCTCATCATCATGCTCCTCACAGGAAAAGCTGCATCAGTTGCCTTTCCAGCCTACAGCTGATGAGCTGCACTTTTTGACGA
AGCATTTCAGCACAGAGAGCGTACCAGATGAGGAAGGACGGCAGTCCCCAGCCATGCGGCCTCGCTCCCGGAGCCTCAGTCCCGGACGAT
CCCCAGTATCCTTTGACAGTGAAATAATAATGATGAATCATGTTTACAAAGAAAGATTCCCAAAGGCTCATGAGCGCTCAGAGAGCTCAG
AAGTGGCTTTTGTGATGCAGCTGGTGAAAAAGCTGATGATTATCATTGCCCGCCCAGCACGTCTCCTGGAATGCCTGGAGTTTGACCCTG
AAGAGTTCTACCACCTTTTAGAAGCAGCTGAGGGCCACGCCAAAGAGGGACAAGGGATTAAATGTGACATTCCCCGCTACATCGTTAGCC
AGCTGGGCCTCACCCGGGATCCCCTAGAAGAAATGGCCCAGTTGAGCAGCTGTGACAGTCCTGACACTCCAGAGACAGATGATTCTATTG
AGGGCCATGGGGCATCTCTGCCATCTAAAAAGACACCCTCTGAAGAGGACTTCGAGACCATTAAGCTCATCAGCAATGGCGCCTATGGGG
CTGTATTTCTGGTGCGGCACAAGTCCACCCGGCAGCGCTTTGCCATGAAGAAGATCAACAAGCAGAACCTGATCCTACGGAACCAGATCC
AGCAGGCCTTCGTGGAGCGTGACATACTGACTTTCGCTGAGAACCCCTTTGTGGTCAGCATGTTCTGCTCCTTTGATACCAAGCGCCACT
TGTGCATGGTGATGGAGTACGTTGAAGGGGGAGACTGTGCCACTCTGCTGAAGAATATTGGGGCCCTGCCTGTGGACATGGTGCGTCTAT
ACTTTGCGGAAACTGTGCTGGCCCTGGAGTACTTACACAACTATGGCATCGTGCACCGTGACCTCAAGCCTGACAACCTCCTAATTACAT
CCATGGGGCACATCAAGCTCACGGACTTTGGACTGTCCAAAATTGGCCTCATGAGTCTGACAACGAACTTGTATGAGGGTCATATTGAAA
AGGATGCCCGGGAATTCCTGGACAAGCAGGTATGCGGGACCCCAGAATACATTGCGCCTGAGGTGATCCTGCGCCAGGGCTATGGGAAGC
CAGTGGACTGGTGGGCCATGGGCATTATCCTGTATGAGTTCCTGGTGGGCTGCGTCCCTTTTTTTGGAGATACTCCGGAGGAGCTCTTTG
GGCAGGTGATCAGTGATGAGATTGTGTGGCCTGAGGGTGATGAGGCACTGCCCCCAGACGCCCAGGACCTCACCTCCAAACTGCTCCACC
AGAACCCTCTGGAGAGACTTGGCACAGGCAGTGCCTATGAGGTGAAGCAGCACCCATTCTTTACTGGTCTGGACTGGACAGGACTTCTCC
GCCAGAAGGCTGAATTTATTCCTCAGTTGGAGTCAGAGGATGATACTAGCTATTTTGACACCCGCTCAGAGCGATACCACCACATGGACT
CGGAGGATGAGGAAGAAGTGAGTGAGGATGGCTGCCTTGAGATCCGCCAGTTCTCTTCCTGCTCTCCAAGGTTCAACAAGGTGTACAGCA
GCATGGAGCGGCTCTCACTGCTCGAGGAGCGCCGGACACCACCCCCGACCAAGCGCAGCCTGAGTGAGGAGAAGGAGGACCATTCAGATG
GCCTGGCAGGGCTCAAAGGCCGAGACCGGAGCTGGGTGATTGGCTCCCCTGAGATATTACGGAAGCGGCTGTCGGTGTCTGAGTCATCCC
ACACAGAGAGTGACTCAAGCCCTCCAATGACAGTGCGACGCCGCTGCTCAGGCCTCCTGGATGCGCCTCGGTTCCCGGAGGGCCCTGAGG
AGGCCAGCAGCACCCTCAGGAGGCAACCACAGGAGGGTATATGGGTCCTGACACCCCCATCTGGAGAGGGGGTATCTGGGCCTGTCACTG
AACACTCAGGGGAGCAGCGGCCAAAGCTGGATGAGGAAGCTGTTGGCCGGAGCAGTGGTTCCAGTCCAGCTATGGAGACCCGAGGCCGTG
GGACCTCACAGCTGGCTGAGGGAGCCACAGCCAAGGCCATCAGTGACCTGGCTGTGCGTAGGGCCCGCCACCGGCTGCTCTCTGGGGACT
CAACAGAGAAGCGCACTGCTCGCCCTGTCAACAAAGTGATCAAGTCCGCCTCAGCCACAGCCCTCTCACTCCTCATTCCTTCGGAACACC
ACACCTGCTCCCCGTTGGCCAGCCCCATGTCCCCACATTCTCAGTCGTCCAACCCATCATCCCGGGACTCTTCTCCATATGGCTTCACCC
TGCGGGCCATTCGCGTCTACATGGGTGACTCCGATGTCTACACCGTGCACCATATGGTGTGGCACGTGGAGGATGGAGGTCCGGCCAGTG
AGGCAGGGCTTCGTCAAGGTGACCTCATCACCCATGTCAATGGGGAACCTGTGCATGGCCTGGTGCACACGGAGGTGGTAGAGCTGATCC
TGAAGAGTGGAAACAAGGTGGCCATTTCAACAACTCCCCTGGAGAACACATCCATTAAAGTGGGGCCAGCTCGGAAGGGCAGCTACAAGG
CCAAGATGGCCCGAAGGAGCAAGAGGAGCCGCGGCAAGGATGGGCAAGAAAGCAGAAAAAGGAGCTCCCTGTTCCGCAAGATCACCAAGC
AAGCATCCCTGCTCCACACCAGCCGCAGCCTTTCTTCCCTTAACCGCTCCTTGTCATCAGGGGAGAGTGGGCCAGGCTCTCCCACACACA
GCCACAGCCTTTCCCCCCGATCTCCCACTCAAGGCTACCGGGTGACCCCCGATGCTGTGCATTCAGAACTCTCACGGCCCAAGAGTGCGG
AGCCACCCCGTTCACCACTACTCAAGAGGGTGCAGTCGGCTGAGAAACTGGCAGCAGCACTTGCCGCCTCTGAGAAGAAGCTAGCCACTT
CTCGCAAGCACAGCCTTGACCTGCCCCACTCTGAACTAAAGAAGGAACTGCCGCCCAGGGAAGTGAGCCCTCTGGAGGTAGTTGGAGCCA
GGAGTGTGCTGTCTGGCAAGGGGGCCCTGCCAGGGAAGGGGGTGCTGCAGCCTGCTCCCTCACGGGCCCTAGGCACCCTCCGGCAGGACC
GAGCCGAACGACGGGAGTCGCTGCAGAAGCAAGAAGCCATTCGTGAGGTGGACTCCTCAGAGGACGACACCGAGGAAGGGCCTGAGAACA
GCCAGGGTGCACAGGAGCTGAGCTTGGCACCTCACCCAGAAGTGAGCCAGAGTGTGGCCCCTAAAGGAGCAGGAGAGAGTGGGGAAGAGG
ATCCTTTCCCGTCCAGAGACCCTAGGAGCCTGGGCCCAATGGTCCCAAGCCTATTGACAGGGATCACACTGGGGCCTCCCAGAATGGAAA
GTCCCAGTGGTCCCCACAGGAGGCTCGGGAGCCCACAAGCCATTGAGGAGGCTGCCAGCTCCTCCTCAGCAGGCCCCAACCTAGGTCAGT
CTGGAGCCACAGACCCCATCCCTCCTGAAGGTTGCTGGAAGGCCCAGCACCTCCACACCCAGGCACTAACAGCACTTTCTCCCAGCACTT
CGGGACTCACCCCCACCAGCAGTTGCTCTCCTCCCAGCTCCACCTCTGGGAAGCTGAGCATGTGGTCCTGGAAATCCCTTATTGAGGGCC
CAGACAGGGCATCCCCAAGCAGAAAGGCAACCATGGCAGGTGGGCTAGCCAACCTCCAGGATTTGGAAAACACAACTCCAGCCCAGCCTA
AGAACCTGTCTCCCAGGGAGCAGGGGAAGACACAGCCACCTAGTGCCCCCAGACTGGCCCATCCATCTTATGAGGATCCCAGCCAGGGCT
GGCTATGGGAGTCTGAGTGTGCACAAGCAGTGAAAGAGGATCCAGCCCTGAGCATCACCCAAGTGCCTGATGCCTCAGGTGACAGAAGGC
AGGACGTTCCATGCCGAGGCTGCCCCCTCACCCAGAAGTCTGAGCCCAGCCTCAGGAGGGGCCAAGAACCAGGGGGCCATCAAAAGCATC

>In-frame_HOMER1_ENST00000334082_chr5_78808593_-_MAST2_ENST00000361297_chr1_46348036_+_4934nt
ATGGGAAGGAGTTGAGCCTTCCAAGAAGAGGCAGCTTTTGTCGGACAAGTAACCGCAAGAGCTTGATTGTGACCTCTAGCACATCACCTA
CACTACCACGGCCACACTCACCACTCCATGGCCACACAGGTAACAGTCCTTTGGACAGCCCCCGGAATTTCTCTCCAAATGCACCTGCTC
ACTTTTCTTTTGTTCCTGCCCGTAGGACTGATGGGCGGCGCTGGTCTTTGGCCTCTTTGCCCTCTTCAGGATATGGAACTAACACTCCTA
GCTCCACTGTCTCATCATCATGCTCCTCACAGGAAAAGCTGCATCAGTTGCCTTTCCAGCCTACAGCTGATGAGCTGCACTTTTTGACGA
AGCATTTCAGCACAGAGAGCGTACCAGATGAGGAAGGACGGCAGTCCCCAGCCATGCGGCCTCGCTCCCGGAGCCTCAGTCCCGGACGAT
CCCCAGTATCCTTTGACAGTGAAATAATAATGATGAATCATGTTTACAAAGAAAGATTCCCAAAGGCCACCGCACAAATGGAAGAGCGAC
TAGCAGAGTTTATTTCCTCCAACACTCCAGACAGCGTGCTGCCCTTGGCAGATGGAGCCCTGAGCTTTATTCATCATCAGGTGATTGAGA
TGGCCCGAGACTGCCTGGATAAATCTCGGAGTGGCCTCATTACATCACAATACTTCTACGAACTTCAAGATAATTTGGAGAAACTTTTAC
AAGATGCTCATGAGCGCTCAGAGAGCTCAGAAGTGGCTTTTGTGATGCAGCTGGTGAAAAAGCTGATGATTATCATTGCCCGCCCAGCAC
GTCTCCTGGAATGCCTGGAGTTTGACCCTGAAGAGTTCTACCACCTTTTAGAAGCAGCTGAGGGCCACGCCAAAGAGGGACAAGGGATTA
AATGTGACATTCCCCGCTACATCGTTAGCCAGCTGGGCCTCACCCGGGATCCCCTAGAAGAAATGGCCCAGTTGAGCAGCTGTGACAGTC
CTGACACTCCAGAGACAGATGATTCTATTGAGGGCCATGGGGCATCTCTGCCATCTAAAAAGACACCCTCTGAAGAGGACTTCGAGACCA
TTAAGCTCATCAGCAATGGCGCCTATGGGGCTGTATTTCTGGTGCGGCACAAGTCCACCCGGCAGCGCTTTGCCATGAAGAAGATCAACA
AGCAGAACCTGATCCTACGGAACCAGATCCAGCAGGCCTTCGTGGAGCGTGACATACTGACTTTCGCTGAGAACCCCTTTGTGGTCAGCA
TGTTCTGCTCCTTTGATACCAAGCGCCACTTGTGCATGGTGATGGAGTACGTTGAAGGGGGAGACTGTGCCACTCTGCTGAAGAATATTG
GGGCCCTGCCTGTGGACATGGTGCGTCTATACTTTGCGGAAACTGTGCTGGCCCTGGAGTACTTACACAACTATGGCATCGTGCACCGTG
ACCTCAAGCCTGACAACCTCCTAATTACATCCATGGGGCACATCAAGCTCACGGACTTTGGACTGTCCAAAATTGGCCTCATGAGTCTGA
CAACGAACTTGTATGAGGGTCATATTGAAAAGGATGCCCGGGAATTCCTGGACAAGCAGGTATGCGGGACCCCAGAATACATTGCGCCTG
AGGTGATCCTGCGCCAGGGCTATGGGAAGCCAGTGGACTGGTGGGCCATGGGCATTATCCTGTATGAGTTCCTGGTGGGCTGCGTCCCTT
TTTTTGGAGATACTCCGGAGGAGCTCTTTGGGCAGGTGATCAGTGATGAGATTGTGTGGCCTGAGGGTGATGAGGCACTGCCCCCAGACG
CCCAGGACCTCACCTCCAAACTGCTCCACCAGAACCCTCTGGAGAGACTTGGCACAGGCAGTGCCTATGAGGTGAAGCAGCACCCATTCT
TTACTGGTCTGGACTGGACAGGACTTCTCCGCCAGAAGGCTGAATTTATTCCTCAGTTGGAGTCAGAGGATGATACTAGCTATTTTGACA
CCCGCTCAGAGCGATACCACCACATGGACTCGGAGGATGAGGAAGAAGTGAGTGAGGATGGCTGCCTTGAGATCCGCCAGTTCTCTTCCT
GCTCTCCAAGGTTCAACAAGGTGTACAGCAGCATGGAGCGGCTCTCACTGCTCGAGGAGCGCCGGACACCACCCCCGACCAAGCGCAGCC
TGAGTGAGGAGAAGGAGGACCATTCAGATGGCCTGGCAGGGCTCAAAGGCCGAGACCGGAGCTGGGTGATTGGCTCCCCTGAGATATTAC
GGAAGCGGCTGTCGGTGTCTGAGTCATCCCACACAGAGAGTGACTCAAGCCCTCCAATGACAGTGCGACGCCGCTGCTCAGGCCTCCTGG
ATGCGCCTCGGTTCCCGGAGGGCCCTGAGGAGGCCAGCAGCACCCTCAGGAGGCAACCACAGGAGGGTATATGGGTCCTGACACCCCCAT
CTGGAGAGGGGGTATCTGGGCCTGTCACTGAACACTCAGGGGAGCAGCGGCCAAAGCTGGATGAGGAAGCTGTTGGCCGGAGCAGTGGTT
CCAGTCCAGCTATGGAGACCCGAGGCCGTGGGACCTCACAGCTGGCTGAGGGAGCCACAGCCAAGGCCATCAGTGACCTGGCTGTGCGTA
GGGCCCGCCACCGGCTGCTCTCTGGGGACTCAACAGAGAAGCGCACTGCTCGCCCTGTCAACAAAGTGATCAAGTCCGCCTCAGCCACAG
CCCTCTCACTCCTCATTCCTTCGGAACACCACACCTGCTCCCCGTTGGCCAGCCCCATGTCCCCACATTCTCAGTCGTCCAACCCATCAT
CCCGGGACTCTTCTCCAAGCAGGGACTTCTTGCCAGCCCTTGGCAGCATGAGGCCTCCCATCATCATCCACCGAGCTGGCAAGAAGTATG
GCTTCACCCTGCGGGCCATTCGCGTCTACATGGGTGACTCCGATGTCTACACCGTGCACCATATGGTGTGGCACGTGGAGGATGGAGGTC
CGGCCAGTGAGGCAGGGCTTCGTCAAGGTGACCTCATCACCCATGTCAATGGGGAACCTGTGCATGGCCTGGTGCACACGGAGGTGGTAG
AGCTGATCCTGAAGAGTGGAAACAAGGTGGCCATTTCAACAACTCCCCTGGAGAACACATCCATTAAAGTGGGGCCAGCTCGGAAGGGCA
GCTACAAGGCCAAGATGGCCCGAAGGAGCAAGAGGAGCCGCGGCAAGGATGGGCAAGAAAGCAGAAAAAGGAGCTCCCTGTTCCGCAAGA
TCACCAAGCAAGCATCCCTGCTCCACACCAGCCGCAGCCTTTCTTCCCTTAACCGCTCCTTGTCATCAGGGGAGAGTGGGCCAGGCTCTC
CCACACACAGCCACAGCCTTTCCCCCCGATCTCCCACTCAAGGCTACCGGGTGACCCCCGATGCTGTGCATTCAGTGGGAGGGAATTCAT
CACAGAGCAGCTCCCCCAGCTCCAGCGTGCCCAGTTCCCCAGCCGGCTCTGGGCACACACGGCCCAGCTCCCTCCACGGTCTGGCACCCA
AGCTCCAACGCCAGTACCGCTCTCCACGGCGCAAGTCAGCAGGCAGCATCCCACTGTCACCACTGGCCCACACCCCTTCTCCCCCACCCC
CAACAGCTTCACCTCAGCGGTCCCCATCGCCCCTGTCTGGCCATGTAGCCCAGGCCTTTCCCACAAAGCTTCACTTGTCACCTCCCCTGG
GCAGGCAACTCTCACGGCCCAAGAGTGCGGAGCCACCCCGTTCACCACTACTCAAGAGGGTGCAGTCGGCTGAGAAACTGGCAGCAGCAC
TTGCCGCCTCTGAGAAGAAGCTAGCCACTTCTCGCAAGCACAGCCTTGACCTGCCCCACTCTGAACTAAAGAAGGAACTGCCGCCCAGGG
AAGTGAGCCCTCTGGAGGTAGTTGGAGCCAGGAGTGTGCTGTCTGGCAAGGGGGCCCTGCCAGGGAAGGGGGTGCTGCAGCCTGCTCCCT
CACGGGCCCTAGGCACCCTCCGGCAGGACCGAGCCGAACGACGGGAGTCGCTGCAGAAGCAAGAAGCCATTCGTGAGGTGGACTCCTCAG
AGGACGACACCGAGGAAGGGCCTGAGAACAGCCAGGGTGCACAGGAGCTGAGCTTGGCACCTCACCCAGAAGTGAGCCAGAGTGTGGCCC
CTAAAGGAGCAGGAGAGAGTGGGGAAGAGGATCCTTTCCCGTCCAGAGACCCTAGGAGCCTGGGCCCAATGGTCCCAAGCCTATTGACAG
GGATCACACTGGGGCCTCCCAGAATGGAAAGTCCCAGTGGTCCCCACAGGAGGCTCGGGAGCCCACAAGCCATTGAGGAGGCTGCCAGCT
CCTCCTCAGCAGGCCCCAACCTAGGTCAGTCTGGAGCCACAGACCCCATCCCTCCTGAAGGTTGCTGGAAGGCCCAGCACCTCCACACCC
AGGCACTAACAGCACTTTCTCCCAGCACTTCGGGACTCACCCCCACCAGCAGTTGCTCTCCTCCCAGCTCCACCTCTGGGAAGCTGAGCA
TGTGGTCCTGGAAATCCCTTATTGAGGGCCCAGACAGGGCATCCCCAAGCAGAAAGGCAACCATGGCAGGTGGGCTAGCCAACCTCCAGG
ATTTGGAAAACACAACTCCAGCCCAGCCTAAGAACCTGTCTCCCAGGGAGCAGGGGAAGACACAGCCACCTAGTGCCCCCAGACTGGCCC
ATCCATCTTATGAGGATCCCAGCCAGGGCTGGCTATGGGAGTCTGAGTGTGCACAAGCAGTGAAAGAGGATCCAGCCCTGAGCATCACCC
AAGTGCCTGATGCCTCAGGTGACAGAAGGCAGGACGTTCCATGCCGAGGCTGCCCCCTCACCCAGAAGTCTGAGCCCAGCCTCAGGAGGG

>In-frame_HOMER1_ENST00000535690_chr5_78808593_-_MAST2_ENST00000372009_chr1_46348036_+_4364nt
ATGGGAAGGAGTTGAGCCTTCCAAGAAGAGGCAGCTTTTGTCGGACAAGTAACCGCAAGAGCTTGATTGTGACCTCTAGCACATCACCTA
CACTACCACGGCCACACTCACCACTCCATGGCCACACAGGTAACAGTCCTTTGGACAGCCCCCGGAATTTCTCTCCAAATGCACCTGCTC
ACTTTTCTTTTGTTCCTGCCCGTAGGACTGATGGGCGGCGCTGGTCTTTGGCCTCTTTGCCCTCTTCAGGATATGGAACTAACACTCCTA
GCTCCACTGTCTCATCATCATGCTCCTCACAGGAAAAGCTGCATCAGTTGCCTTTCCAGCCTACAGCTGATGAGCTGCACTTTTTGACGA
AGCATTTCAGCACAGAGAGCGTACCAGATGAGGAAGGACGGCAGTCCCCAGCCATGCGGCCTCGCTCCCGGAGCCTCAGTCCCGGACGAT
CCCCAGTATCCTTTGACAGTGAAATAATAATGATGAATCATGTTTACAAAGAAAGATTCCCAAAGGCTCATGAGCGCTCAGAGAGCTCAG
AAGTGGCTTTTGTGATGCAGCTGGTGAAAAAGCTGATGATTATCATTGCCCGCCCAGCACGTCTCCTGGAATGCCTGGAGTTTGACCCTG
AAGAGTTCTACCACCTTTTAGAAGCAGCTGAGGGCCACGCCAAAGAGGGACAAGGGATTAAATGTGACATTCCCCGCTACATCGTTAGCC
AGCTGGGCCTCACCCGGGATCCCCTAGAAGAAATGGCCCAGTTGAGCAGCTGTGACAGTCCTGACACTCCAGAGACAGATGATTCTATTG
AGGGCCATGGGGCATCTCTGCCATCTAAAAAGACACCCTCTGAAGAGGACTTCGAGACCATTAAGCTCATCAGCAATGGCGCCTATGGGG
CTGTATTTCTGGTGCGGCACAAGTCCACCCGGCAGCGCTTTGCCATGAAGAAGATCAACAAGCAGAACCTGATCCTACGGAACCAGATCC
AGCAGGCCTTCGTGGAGCGTGACATACTGACTTTCGCTGAGAACCCCTTTGTGGTCAGCATGTTCTGCTCCTTTGATACCAAGCGCCACT
TGTGCATGGTGATGGAGTACGTTGAAGGGGGAGACTGTGCCACTCTGCTGAAGAATATTGGGGCCCTGCCTGTGGACATGGTGCGTCTAT
ACTTTGCGGAAACTGTGCTGGCCCTGGAGTACTTACACAACTATGGCATCGTGCACCGTGACCTCAAGCCTGACAACCTCCTAATTACAT
CCATGGGGCACATCAAGCTCACGGACTTTGGACTGTCCAAAATTGGCCTCATGAGTCTGACAACGAACTTGTATGAGGGTCATATTGAAA
AGGATGCCCGGGAATTCCTGGACAAGCAGGTATGCGGGACCCCAGAATACATTGCGCCTGAGGTGATCCTGCGCCAGGGCTATGGGAAGC
CAGTGGACTGGTGGGCCATGGGCATTATCCTGTATGAGTTCCTGGTGGGCTGCGTCCCTTTTTTTGGAGATACTCCGGAGGAGCTCTTTG
GGCAGGTGATCAGTGATGAGATTGTGTGGCCTGAGGGTGATGAGGCACTGCCCCCAGACGCCCAGGACCTCACCTCCAAACTGCTCCACC
AGAACCCTCTGGAGAGACTTGGCACAGGCAGTGCCTATGAGGTGAAGCAGCACCCATTCTTTACTGGTCTGGACTGGACAGGACTTCTCC
GCCAGAAGGCTGAATTTATTCCTCAGTTGGAGTCAGAGGATGATACTAGCTATTTTGACACCCGCTCAGAGCGATACCACCACATGGACT
CGGAGGATGAGGAAGAAGTGAGTGAGGATGGCTGCCTTGAGATCCGCCAGTTCTCTTCCTGCTCTCCAAGGTTCAACAAGGTGTACAGCA
GCATGGAGCGGCTCTCACTGCTCGAGGAGCGCCGGACACCACCCCCGACCAAGCGCAGCCTGAGTGAGGAGAAGGAGGACCATTCAGATG
GCCTGGCAGGGCTCAAAGGCCGAGACCGGAGCTGGGTGATTGGCTCCCCTGAGATATTACGGAAGCGGCTGTCGGTGTCTGAGTCATCCC
ACACAGAGAGTGACTCAAGCCCTCCAATGACAGTGCGACGCCGCTGCTCAGGCCTCCTGGATGCGCCTCGGTTCCCGGAGGGCCCTGAGG
AGGCCAGCAGCACCCTCAGGAGGCAACCACAGGAGGGTATATGGGTCCTGACACCCCCATCTGGAGAGGGGGTATCTGGGCCTGTCACTG
AACACTCAGGGGAGCAGCGGCCAAAGCTGGATGAGGAAGCTGTTGGCCGGAGCAGTGGTTCCAGTCCAGCTATGGAGACCCGAGGCCGTG
GGACCTCACAGCTGGCTGAGGGAGCCACAGCCAAGGCCATCAGTGACCTGGCTGTGCGTAGGGCCCGCCACCGGCTGCTCTCTGGGGACT
CAACAGAGAAGCGCACTGCTCGCCCTGTCAACAAAGTGATCAAGTCCGCCTCAGCCACAGCCCTCTCACTCCTCATTCCTTCGGAACACC
ACACCTGCTCCCCGTTGGCCAGCCCCATGTCCCCACATTCTCAGTCGTCCAACCCATCATCCCGGGACTCTTCTCCATATGGCTTCACCC
TGCGGGCCATTCGCGTCTACATGGGTGACTCCGATGTCTACACCGTGCACCATATGGTGTGGCACGTGGAGGATGGAGGTCCGGCCAGTG
AGGCAGGGCTTCGTCAAGGTGACCTCATCACCCATGTCAATGGGGAACCTGTGCATGGCCTGGTGCACACGGAGGTGGTAGAGCTGATCC
TGAAGAGTGGAAACAAGGTGGCCATTTCAACAACTCCCCTGGAGAACACATCCATTAAAGTGGGGCCAGCTCGGAAGGGCAGCTACAAGG
CCAAGATGGCCCGAAGGAGCAAGAGGAGCCGCGGCAAGGATGGGCAAGAAAGCAGAAAAAGGAGCTCCCTGTTCCGCAAGATCACCAAGC
AAGCATCCCTGCTCCACACCAGCCGCAGCCTTTCTTCCCTTAACCGCTCCTTGTCATCAGGGGAGAGTGGGCCAGGCTCTCCCACACACA
GCCACAGCCTTTCCCCCCGATCTCCCACTCAAGGCTACCGGGTGACCCCCGATGCTGTGCATTCAGAACTCTCACGGCCCAAGAGTGCGG
AGCCACCCCGTTCACCACTACTCAAGAGGGTGCAGTCGGCTGAGAAACTGGCAGCAGCACTTGCCGCCTCTGAGAAGAAGCTAGCCACTT
CTCGCAAGCACAGCCTTGACCTGCCCCACTCTGAACTAAAGAAGGAACTGCCGCCCAGGGAAGTGAGCCCTCTGGAGGTAGTTGGAGCCA
GGAGTGTGCTGTCTGGCAAGGGGGCCCTGCCAGGGAAGGGGGTGCTGCAGCCTGCTCCCTCACGGGCCCTAGGCACCCTCCGGCAGGACC
GAGCCGAACGACGGGAGTCGCTGCAGAAGCAAGAAGCCATTCGTGAGGTGGACTCCTCAGAGGACGACACCGAGGAAGGGCCTGAGAACA
GCCAGGGTGCACAGGAGCTGAGCTTGGCACCTCACCCAGAAGTGAGCCAGAGTGTGGCCCCTAAAGGAGCAGGAGAGAGTGGGGAAGAGG
ATCCTTTCCCGTCCAGAGACCCTAGGAGCCTGGGCCCAATGGTCCCAAGCCTATTGACAGGGATCACACTGGGGCCTCCCAGAATGGAAA
GTCCCAGTGGTCCCCACAGGAGGCTCGGGAGCCCACAAGCCATTGAGGAGGCTGCCAGCTCCTCCTCAGCAGGCCCCAACCTAGGTCAGT
CTGGAGCCACAGACCCCATCCCTCCTGAAGGTTGCTGGAAGGCCCAGCACCTCCACACCCAGGCACTAACAGCACTTTCTCCCAGCACTT
CGGGACTCACCCCCACCAGCAGTTGCTCTCCTCCCAGCTCCACCTCTGGGAAGCTGAGCATGTGGTCCTGGAAATCCCTTATTGAGGGCC
CAGACAGGGCATCCCCAAGCAGAAAGGCAACCATGGCAGGTGGGCTAGCCAACCTCCAGGATTTGGAAAACACAACTCCAGCCCAGCCTA
AGAACCTGTCTCCCAGGGAGCAGGGGAAGACACAGCCACCTAGTGCCCCCAGACTGGCCCATCCATCTTATGAGGATCCCAGCCAGGGCT
GGCTATGGGAGTCTGAGTGTGCACAAGCAGTGAAAGAGGATCCAGCCCTGAGCATCACCCAAGTGCCTGATGCCTCAGGTGACAGAAGGC
AGGACGTTCCATGCCGAGGCTGCCCCCTCACCCAGAAGTCTGAGCCCAGCCTCAGGAGGGGCCAAGAACCAGGGGGCCATCAAAAGCATC

>In-frame_HOMER1_ENST00000535690_chr5_78808593_-_MAST2_ENST00000361297_chr1_46348036_+_4934nt
ATGGGAAGGAGTTGAGCCTTCCAAGAAGAGGCAGCTTTTGTCGGACAAGTAACCGCAAGAGCTTGATTGTGACCTCTAGCACATCACCTA
CACTACCACGGCCACACTCACCACTCCATGGCCACACAGGTAACAGTCCTTTGGACAGCCCCCGGAATTTCTCTCCAAATGCACCTGCTC
ACTTTTCTTTTGTTCCTGCCCGTAGGACTGATGGGCGGCGCTGGTCTTTGGCCTCTTTGCCCTCTTCAGGATATGGAACTAACACTCCTA
GCTCCACTGTCTCATCATCATGCTCCTCACAGGAAAAGCTGCATCAGTTGCCTTTCCAGCCTACAGCTGATGAGCTGCACTTTTTGACGA
AGCATTTCAGCACAGAGAGCGTACCAGATGAGGAAGGACGGCAGTCCCCAGCCATGCGGCCTCGCTCCCGGAGCCTCAGTCCCGGACGAT
CCCCAGTATCCTTTGACAGTGAAATAATAATGATGAATCATGTTTACAAAGAAAGATTCCCAAAGGCCACCGCACAAATGGAAGAGCGAC
TAGCAGAGTTTATTTCCTCCAACACTCCAGACAGCGTGCTGCCCTTGGCAGATGGAGCCCTGAGCTTTATTCATCATCAGGTGATTGAGA
TGGCCCGAGACTGCCTGGATAAATCTCGGAGTGGCCTCATTACATCACAATACTTCTACGAACTTCAAGATAATTTGGAGAAACTTTTAC
AAGATGCTCATGAGCGCTCAGAGAGCTCAGAAGTGGCTTTTGTGATGCAGCTGGTGAAAAAGCTGATGATTATCATTGCCCGCCCAGCAC
GTCTCCTGGAATGCCTGGAGTTTGACCCTGAAGAGTTCTACCACCTTTTAGAAGCAGCTGAGGGCCACGCCAAAGAGGGACAAGGGATTA
AATGTGACATTCCCCGCTACATCGTTAGCCAGCTGGGCCTCACCCGGGATCCCCTAGAAGAAATGGCCCAGTTGAGCAGCTGTGACAGTC
CTGACACTCCAGAGACAGATGATTCTATTGAGGGCCATGGGGCATCTCTGCCATCTAAAAAGACACCCTCTGAAGAGGACTTCGAGACCA
TTAAGCTCATCAGCAATGGCGCCTATGGGGCTGTATTTCTGGTGCGGCACAAGTCCACCCGGCAGCGCTTTGCCATGAAGAAGATCAACA
AGCAGAACCTGATCCTACGGAACCAGATCCAGCAGGCCTTCGTGGAGCGTGACATACTGACTTTCGCTGAGAACCCCTTTGTGGTCAGCA
TGTTCTGCTCCTTTGATACCAAGCGCCACTTGTGCATGGTGATGGAGTACGTTGAAGGGGGAGACTGTGCCACTCTGCTGAAGAATATTG
GGGCCCTGCCTGTGGACATGGTGCGTCTATACTTTGCGGAAACTGTGCTGGCCCTGGAGTACTTACACAACTATGGCATCGTGCACCGTG
ACCTCAAGCCTGACAACCTCCTAATTACATCCATGGGGCACATCAAGCTCACGGACTTTGGACTGTCCAAAATTGGCCTCATGAGTCTGA
CAACGAACTTGTATGAGGGTCATATTGAAAAGGATGCCCGGGAATTCCTGGACAAGCAGGTATGCGGGACCCCAGAATACATTGCGCCTG
AGGTGATCCTGCGCCAGGGCTATGGGAAGCCAGTGGACTGGTGGGCCATGGGCATTATCCTGTATGAGTTCCTGGTGGGCTGCGTCCCTT
TTTTTGGAGATACTCCGGAGGAGCTCTTTGGGCAGGTGATCAGTGATGAGATTGTGTGGCCTGAGGGTGATGAGGCACTGCCCCCAGACG
CCCAGGACCTCACCTCCAAACTGCTCCACCAGAACCCTCTGGAGAGACTTGGCACAGGCAGTGCCTATGAGGTGAAGCAGCACCCATTCT
TTACTGGTCTGGACTGGACAGGACTTCTCCGCCAGAAGGCTGAATTTATTCCTCAGTTGGAGTCAGAGGATGATACTAGCTATTTTGACA
CCCGCTCAGAGCGATACCACCACATGGACTCGGAGGATGAGGAAGAAGTGAGTGAGGATGGCTGCCTTGAGATCCGCCAGTTCTCTTCCT
GCTCTCCAAGGTTCAACAAGGTGTACAGCAGCATGGAGCGGCTCTCACTGCTCGAGGAGCGCCGGACACCACCCCCGACCAAGCGCAGCC
TGAGTGAGGAGAAGGAGGACCATTCAGATGGCCTGGCAGGGCTCAAAGGCCGAGACCGGAGCTGGGTGATTGGCTCCCCTGAGATATTAC
GGAAGCGGCTGTCGGTGTCTGAGTCATCCCACACAGAGAGTGACTCAAGCCCTCCAATGACAGTGCGACGCCGCTGCTCAGGCCTCCTGG
ATGCGCCTCGGTTCCCGGAGGGCCCTGAGGAGGCCAGCAGCACCCTCAGGAGGCAACCACAGGAGGGTATATGGGTCCTGACACCCCCAT
CTGGAGAGGGGGTATCTGGGCCTGTCACTGAACACTCAGGGGAGCAGCGGCCAAAGCTGGATGAGGAAGCTGTTGGCCGGAGCAGTGGTT
CCAGTCCAGCTATGGAGACCCGAGGCCGTGGGACCTCACAGCTGGCTGAGGGAGCCACAGCCAAGGCCATCAGTGACCTGGCTGTGCGTA
GGGCCCGCCACCGGCTGCTCTCTGGGGACTCAACAGAGAAGCGCACTGCTCGCCCTGTCAACAAAGTGATCAAGTCCGCCTCAGCCACAG
CCCTCTCACTCCTCATTCCTTCGGAACACCACACCTGCTCCCCGTTGGCCAGCCCCATGTCCCCACATTCTCAGTCGTCCAACCCATCAT
CCCGGGACTCTTCTCCAAGCAGGGACTTCTTGCCAGCCCTTGGCAGCATGAGGCCTCCCATCATCATCCACCGAGCTGGCAAGAAGTATG
GCTTCACCCTGCGGGCCATTCGCGTCTACATGGGTGACTCCGATGTCTACACCGTGCACCATATGGTGTGGCACGTGGAGGATGGAGGTC
CGGCCAGTGAGGCAGGGCTTCGTCAAGGTGACCTCATCACCCATGTCAATGGGGAACCTGTGCATGGCCTGGTGCACACGGAGGTGGTAG
AGCTGATCCTGAAGAGTGGAAACAAGGTGGCCATTTCAACAACTCCCCTGGAGAACACATCCATTAAAGTGGGGCCAGCTCGGAAGGGCA
GCTACAAGGCCAAGATGGCCCGAAGGAGCAAGAGGAGCCGCGGCAAGGATGGGCAAGAAAGCAGAAAAAGGAGCTCCCTGTTCCGCAAGA
TCACCAAGCAAGCATCCCTGCTCCACACCAGCCGCAGCCTTTCTTCCCTTAACCGCTCCTTGTCATCAGGGGAGAGTGGGCCAGGCTCTC
CCACACACAGCCACAGCCTTTCCCCCCGATCTCCCACTCAAGGCTACCGGGTGACCCCCGATGCTGTGCATTCAGTGGGAGGGAATTCAT
CACAGAGCAGCTCCCCCAGCTCCAGCGTGCCCAGTTCCCCAGCCGGCTCTGGGCACACACGGCCCAGCTCCCTCCACGGTCTGGCACCCA
AGCTCCAACGCCAGTACCGCTCTCCACGGCGCAAGTCAGCAGGCAGCATCCCACTGTCACCACTGGCCCACACCCCTTCTCCCCCACCCC
CAACAGCTTCACCTCAGCGGTCCCCATCGCCCCTGTCTGGCCATGTAGCCCAGGCCTTTCCCACAAAGCTTCACTTGTCACCTCCCCTGG
GCAGGCAACTCTCACGGCCCAAGAGTGCGGAGCCACCCCGTTCACCACTACTCAAGAGGGTGCAGTCGGCTGAGAAACTGGCAGCAGCAC
TTGCCGCCTCTGAGAAGAAGCTAGCCACTTCTCGCAAGCACAGCCTTGACCTGCCCCACTCTGAACTAAAGAAGGAACTGCCGCCCAGGG
AAGTGAGCCCTCTGGAGGTAGTTGGAGCCAGGAGTGTGCTGTCTGGCAAGGGGGCCCTGCCAGGGAAGGGGGTGCTGCAGCCTGCTCCCT
CACGGGCCCTAGGCACCCTCCGGCAGGACCGAGCCGAACGACGGGAGTCGCTGCAGAAGCAAGAAGCCATTCGTGAGGTGGACTCCTCAG
AGGACGACACCGAGGAAGGGCCTGAGAACAGCCAGGGTGCACAGGAGCTGAGCTTGGCACCTCACCCAGAAGTGAGCCAGAGTGTGGCCC
CTAAAGGAGCAGGAGAGAGTGGGGAAGAGGATCCTTTCCCGTCCAGAGACCCTAGGAGCCTGGGCCCAATGGTCCCAAGCCTATTGACAG
GGATCACACTGGGGCCTCCCAGAATGGAAAGTCCCAGTGGTCCCCACAGGAGGCTCGGGAGCCCACAAGCCATTGAGGAGGCTGCCAGCT
CCTCCTCAGCAGGCCCCAACCTAGGTCAGTCTGGAGCCACAGACCCCATCCCTCCTGAAGGTTGCTGGAAGGCCCAGCACCTCCACACCC
AGGCACTAACAGCACTTTCTCCCAGCACTTCGGGACTCACCCCCACCAGCAGTTGCTCTCCTCCCAGCTCCACCTCTGGGAAGCTGAGCA
TGTGGTCCTGGAAATCCCTTATTGAGGGCCCAGACAGGGCATCCCCAAGCAGAAAGGCAACCATGGCAGGTGGGCTAGCCAACCTCCAGG
ATTTGGAAAACACAACTCCAGCCCAGCCTAAGAACCTGTCTCCCAGGGAGCAGGGGAAGACACAGCCACCTAGTGCCCCCAGACTGGCCC
ATCCATCTTATGAGGATCCCAGCCAGGGCTGGCTATGGGAGTCTGAGTGTGCACAAGCAGTGAAAGAGGATCCAGCCCTGAGCATCACCC
AAGTGCCTGATGCCTCAGGTGACAGAAGGCAGGACGTTCCATGCCGAGGCTGCCCCCTCACCCAGAAGTCTGAGCCCAGCCTCAGGAGGG

>In-frame_HOMER1_ENST00000508576_chr5_78808593_-_MAST2_ENST00000372009_chr1_46348036_+_4364nt
ATGGGAAGGAGTTGAGCCTTCCAAGAAGAGGCAGCTTTTGTCGGACAAGTAACCGCAAGAGCTTGATTGTGACCTCTAGCACATCACCTA
CACTACCACGGCCACACTCACCACTCCATGGCCACACAGGTAACAGTCCTTTGGACAGCCCCCGGAATTTCTCTCCAAATGCACCTGCTC
ACTTTTCTTTTGTTCCTGCCCGTAGGACTGATGGGCGGCGCTGGTCTTTGGCCTCTTTGCCCTCTTCAGGATATGGAACTAACACTCCTA
GCTCCACTGTCTCATCATCATGCTCCTCACAGGAAAAGCTGCATCAGTTGCCTTTCCAGCCTACAGCTGATGAGCTGCACTTTTTGACGA
AGCATTTCAGCACAGAGAGCGTACCAGATGAGGAAGGACGGCAGTCCCCAGCCATGCGGCCTCGCTCCCGGAGCCTCAGTCCCGGACGAT
CCCCAGTATCCTTTGACAGTGAAATAATAATGATGAATCATGTTTACAAAGAAAGATTCCCAAAGGCTCATGAGCGCTCAGAGAGCTCAG
AAGTGGCTTTTGTGATGCAGCTGGTGAAAAAGCTGATGATTATCATTGCCCGCCCAGCACGTCTCCTGGAATGCCTGGAGTTTGACCCTG
AAGAGTTCTACCACCTTTTAGAAGCAGCTGAGGGCCACGCCAAAGAGGGACAAGGGATTAAATGTGACATTCCCCGCTACATCGTTAGCC
AGCTGGGCCTCACCCGGGATCCCCTAGAAGAAATGGCCCAGTTGAGCAGCTGTGACAGTCCTGACACTCCAGAGACAGATGATTCTATTG
AGGGCCATGGGGCATCTCTGCCATCTAAAAAGACACCCTCTGAAGAGGACTTCGAGACCATTAAGCTCATCAGCAATGGCGCCTATGGGG
CTGTATTTCTGGTGCGGCACAAGTCCACCCGGCAGCGCTTTGCCATGAAGAAGATCAACAAGCAGAACCTGATCCTACGGAACCAGATCC
AGCAGGCCTTCGTGGAGCGTGACATACTGACTTTCGCTGAGAACCCCTTTGTGGTCAGCATGTTCTGCTCCTTTGATACCAAGCGCCACT
TGTGCATGGTGATGGAGTACGTTGAAGGGGGAGACTGTGCCACTCTGCTGAAGAATATTGGGGCCCTGCCTGTGGACATGGTGCGTCTAT
ACTTTGCGGAAACTGTGCTGGCCCTGGAGTACTTACACAACTATGGCATCGTGCACCGTGACCTCAAGCCTGACAACCTCCTAATTACAT
CCATGGGGCACATCAAGCTCACGGACTTTGGACTGTCCAAAATTGGCCTCATGAGTCTGACAACGAACTTGTATGAGGGTCATATTGAAA
AGGATGCCCGGGAATTCCTGGACAAGCAGGTATGCGGGACCCCAGAATACATTGCGCCTGAGGTGATCCTGCGCCAGGGCTATGGGAAGC
CAGTGGACTGGTGGGCCATGGGCATTATCCTGTATGAGTTCCTGGTGGGCTGCGTCCCTTTTTTTGGAGATACTCCGGAGGAGCTCTTTG
GGCAGGTGATCAGTGATGAGATTGTGTGGCCTGAGGGTGATGAGGCACTGCCCCCAGACGCCCAGGACCTCACCTCCAAACTGCTCCACC
AGAACCCTCTGGAGAGACTTGGCACAGGCAGTGCCTATGAGGTGAAGCAGCACCCATTCTTTACTGGTCTGGACTGGACAGGACTTCTCC
GCCAGAAGGCTGAATTTATTCCTCAGTTGGAGTCAGAGGATGATACTAGCTATTTTGACACCCGCTCAGAGCGATACCACCACATGGACT
CGGAGGATGAGGAAGAAGTGAGTGAGGATGGCTGCCTTGAGATCCGCCAGTTCTCTTCCTGCTCTCCAAGGTTCAACAAGGTGTACAGCA
GCATGGAGCGGCTCTCACTGCTCGAGGAGCGCCGGACACCACCCCCGACCAAGCGCAGCCTGAGTGAGGAGAAGGAGGACCATTCAGATG
GCCTGGCAGGGCTCAAAGGCCGAGACCGGAGCTGGGTGATTGGCTCCCCTGAGATATTACGGAAGCGGCTGTCGGTGTCTGAGTCATCCC
ACACAGAGAGTGACTCAAGCCCTCCAATGACAGTGCGACGCCGCTGCTCAGGCCTCCTGGATGCGCCTCGGTTCCCGGAGGGCCCTGAGG
AGGCCAGCAGCACCCTCAGGAGGCAACCACAGGAGGGTATATGGGTCCTGACACCCCCATCTGGAGAGGGGGTATCTGGGCCTGTCACTG
AACACTCAGGGGAGCAGCGGCCAAAGCTGGATGAGGAAGCTGTTGGCCGGAGCAGTGGTTCCAGTCCAGCTATGGAGACCCGAGGCCGTG
GGACCTCACAGCTGGCTGAGGGAGCCACAGCCAAGGCCATCAGTGACCTGGCTGTGCGTAGGGCCCGCCACCGGCTGCTCTCTGGGGACT
CAACAGAGAAGCGCACTGCTCGCCCTGTCAACAAAGTGATCAAGTCCGCCTCAGCCACAGCCCTCTCACTCCTCATTCCTTCGGAACACC
ACACCTGCTCCCCGTTGGCCAGCCCCATGTCCCCACATTCTCAGTCGTCCAACCCATCATCCCGGGACTCTTCTCCATATGGCTTCACCC
TGCGGGCCATTCGCGTCTACATGGGTGACTCCGATGTCTACACCGTGCACCATATGGTGTGGCACGTGGAGGATGGAGGTCCGGCCAGTG
AGGCAGGGCTTCGTCAAGGTGACCTCATCACCCATGTCAATGGGGAACCTGTGCATGGCCTGGTGCACACGGAGGTGGTAGAGCTGATCC
TGAAGAGTGGAAACAAGGTGGCCATTTCAACAACTCCCCTGGAGAACACATCCATTAAAGTGGGGCCAGCTCGGAAGGGCAGCTACAAGG
CCAAGATGGCCCGAAGGAGCAAGAGGAGCCGCGGCAAGGATGGGCAAGAAAGCAGAAAAAGGAGCTCCCTGTTCCGCAAGATCACCAAGC
AAGCATCCCTGCTCCACACCAGCCGCAGCCTTTCTTCCCTTAACCGCTCCTTGTCATCAGGGGAGAGTGGGCCAGGCTCTCCCACACACA
GCCACAGCCTTTCCCCCCGATCTCCCACTCAAGGCTACCGGGTGACCCCCGATGCTGTGCATTCAGAACTCTCACGGCCCAAGAGTGCGG
AGCCACCCCGTTCACCACTACTCAAGAGGGTGCAGTCGGCTGAGAAACTGGCAGCAGCACTTGCCGCCTCTGAGAAGAAGCTAGCCACTT
CTCGCAAGCACAGCCTTGACCTGCCCCACTCTGAACTAAAGAAGGAACTGCCGCCCAGGGAAGTGAGCCCTCTGGAGGTAGTTGGAGCCA
GGAGTGTGCTGTCTGGCAAGGGGGCCCTGCCAGGGAAGGGGGTGCTGCAGCCTGCTCCCTCACGGGCCCTAGGCACCCTCCGGCAGGACC
GAGCCGAACGACGGGAGTCGCTGCAGAAGCAAGAAGCCATTCGTGAGGTGGACTCCTCAGAGGACGACACCGAGGAAGGGCCTGAGAACA
GCCAGGGTGCACAGGAGCTGAGCTTGGCACCTCACCCAGAAGTGAGCCAGAGTGTGGCCCCTAAAGGAGCAGGAGAGAGTGGGGAAGAGG
ATCCTTTCCCGTCCAGAGACCCTAGGAGCCTGGGCCCAATGGTCCCAAGCCTATTGACAGGGATCACACTGGGGCCTCCCAGAATGGAAA
GTCCCAGTGGTCCCCACAGGAGGCTCGGGAGCCCACAAGCCATTGAGGAGGCTGCCAGCTCCTCCTCAGCAGGCCCCAACCTAGGTCAGT
CTGGAGCCACAGACCCCATCCCTCCTGAAGGTTGCTGGAAGGCCCAGCACCTCCACACCCAGGCACTAACAGCACTTTCTCCCAGCACTT
CGGGACTCACCCCCACCAGCAGTTGCTCTCCTCCCAGCTCCACCTCTGGGAAGCTGAGCATGTGGTCCTGGAAATCCCTTATTGAGGGCC
CAGACAGGGCATCCCCAAGCAGAAAGGCAACCATGGCAGGTGGGCTAGCCAACCTCCAGGATTTGGAAAACACAACTCCAGCCCAGCCTA
AGAACCTGTCTCCCAGGGAGCAGGGGAAGACACAGCCACCTAGTGCCCCCAGACTGGCCCATCCATCTTATGAGGATCCCAGCCAGGGCT
GGCTATGGGAGTCTGAGTGTGCACAAGCAGTGAAAGAGGATCCAGCCCTGAGCATCACCCAAGTGCCTGATGCCTCAGGTGACAGAAGGC
AGGACGTTCCATGCCGAGGCTGCCCCCTCACCCAGAAGTCTGAGCCCAGCCTCAGGAGGGGCCAAGAACCAGGGGGCCATCAAAAGCATC

>In-frame_HOMER1_ENST00000508576_chr5_78808593_-_MAST2_ENST00000361297_chr1_46348036_+_4934nt
ATGGGAAGGAGTTGAGCCTTCCAAGAAGAGGCAGCTTTTGTCGGACAAGTAACCGCAAGAGCTTGATTGTGACCTCTAGCACATCACCTA
CACTACCACGGCCACACTCACCACTCCATGGCCACACAGGTAACAGTCCTTTGGACAGCCCCCGGAATTTCTCTCCAAATGCACCTGCTC
ACTTTTCTTTTGTTCCTGCCCGTAGGACTGATGGGCGGCGCTGGTCTTTGGCCTCTTTGCCCTCTTCAGGATATGGAACTAACACTCCTA
GCTCCACTGTCTCATCATCATGCTCCTCACAGGAAAAGCTGCATCAGTTGCCTTTCCAGCCTACAGCTGATGAGCTGCACTTTTTGACGA
AGCATTTCAGCACAGAGAGCGTACCAGATGAGGAAGGACGGCAGTCCCCAGCCATGCGGCCTCGCTCCCGGAGCCTCAGTCCCGGACGAT
CCCCAGTATCCTTTGACAGTGAAATAATAATGATGAATCATGTTTACAAAGAAAGATTCCCAAAGGCCACCGCACAAATGGAAGAGCGAC
TAGCAGAGTTTATTTCCTCCAACACTCCAGACAGCGTGCTGCCCTTGGCAGATGGAGCCCTGAGCTTTATTCATCATCAGGTGATTGAGA
TGGCCCGAGACTGCCTGGATAAATCTCGGAGTGGCCTCATTACATCACAATACTTCTACGAACTTCAAGATAATTTGGAGAAACTTTTAC
AAGATGCTCATGAGCGCTCAGAGAGCTCAGAAGTGGCTTTTGTGATGCAGCTGGTGAAAAAGCTGATGATTATCATTGCCCGCCCAGCAC
GTCTCCTGGAATGCCTGGAGTTTGACCCTGAAGAGTTCTACCACCTTTTAGAAGCAGCTGAGGGCCACGCCAAAGAGGGACAAGGGATTA
AATGTGACATTCCCCGCTACATCGTTAGCCAGCTGGGCCTCACCCGGGATCCCCTAGAAGAAATGGCCCAGTTGAGCAGCTGTGACAGTC
CTGACACTCCAGAGACAGATGATTCTATTGAGGGCCATGGGGCATCTCTGCCATCTAAAAAGACACCCTCTGAAGAGGACTTCGAGACCA
TTAAGCTCATCAGCAATGGCGCCTATGGGGCTGTATTTCTGGTGCGGCACAAGTCCACCCGGCAGCGCTTTGCCATGAAGAAGATCAACA
AGCAGAACCTGATCCTACGGAACCAGATCCAGCAGGCCTTCGTGGAGCGTGACATACTGACTTTCGCTGAGAACCCCTTTGTGGTCAGCA
TGTTCTGCTCCTTTGATACCAAGCGCCACTTGTGCATGGTGATGGAGTACGTTGAAGGGGGAGACTGTGCCACTCTGCTGAAGAATATTG
GGGCCCTGCCTGTGGACATGGTGCGTCTATACTTTGCGGAAACTGTGCTGGCCCTGGAGTACTTACACAACTATGGCATCGTGCACCGTG
ACCTCAAGCCTGACAACCTCCTAATTACATCCATGGGGCACATCAAGCTCACGGACTTTGGACTGTCCAAAATTGGCCTCATGAGTCTGA
CAACGAACTTGTATGAGGGTCATATTGAAAAGGATGCCCGGGAATTCCTGGACAAGCAGGTATGCGGGACCCCAGAATACATTGCGCCTG
AGGTGATCCTGCGCCAGGGCTATGGGAAGCCAGTGGACTGGTGGGCCATGGGCATTATCCTGTATGAGTTCCTGGTGGGCTGCGTCCCTT
TTTTTGGAGATACTCCGGAGGAGCTCTTTGGGCAGGTGATCAGTGATGAGATTGTGTGGCCTGAGGGTGATGAGGCACTGCCCCCAGACG
CCCAGGACCTCACCTCCAAACTGCTCCACCAGAACCCTCTGGAGAGACTTGGCACAGGCAGTGCCTATGAGGTGAAGCAGCACCCATTCT
TTACTGGTCTGGACTGGACAGGACTTCTCCGCCAGAAGGCTGAATTTATTCCTCAGTTGGAGTCAGAGGATGATACTAGCTATTTTGACA
CCCGCTCAGAGCGATACCACCACATGGACTCGGAGGATGAGGAAGAAGTGAGTGAGGATGGCTGCCTTGAGATCCGCCAGTTCTCTTCCT
GCTCTCCAAGGTTCAACAAGGTGTACAGCAGCATGGAGCGGCTCTCACTGCTCGAGGAGCGCCGGACACCACCCCCGACCAAGCGCAGCC
TGAGTGAGGAGAAGGAGGACCATTCAGATGGCCTGGCAGGGCTCAAAGGCCGAGACCGGAGCTGGGTGATTGGCTCCCCTGAGATATTAC
GGAAGCGGCTGTCGGTGTCTGAGTCATCCCACACAGAGAGTGACTCAAGCCCTCCAATGACAGTGCGACGCCGCTGCTCAGGCCTCCTGG
ATGCGCCTCGGTTCCCGGAGGGCCCTGAGGAGGCCAGCAGCACCCTCAGGAGGCAACCACAGGAGGGTATATGGGTCCTGACACCCCCAT
CTGGAGAGGGGGTATCTGGGCCTGTCACTGAACACTCAGGGGAGCAGCGGCCAAAGCTGGATGAGGAAGCTGTTGGCCGGAGCAGTGGTT
CCAGTCCAGCTATGGAGACCCGAGGCCGTGGGACCTCACAGCTGGCTGAGGGAGCCACAGCCAAGGCCATCAGTGACCTGGCTGTGCGTA
GGGCCCGCCACCGGCTGCTCTCTGGGGACTCAACAGAGAAGCGCACTGCTCGCCCTGTCAACAAAGTGATCAAGTCCGCCTCAGCCACAG
CCCTCTCACTCCTCATTCCTTCGGAACACCACACCTGCTCCCCGTTGGCCAGCCCCATGTCCCCACATTCTCAGTCGTCCAACCCATCAT
CCCGGGACTCTTCTCCAAGCAGGGACTTCTTGCCAGCCCTTGGCAGCATGAGGCCTCCCATCATCATCCACCGAGCTGGCAAGAAGTATG
GCTTCACCCTGCGGGCCATTCGCGTCTACATGGGTGACTCCGATGTCTACACCGTGCACCATATGGTGTGGCACGTGGAGGATGGAGGTC
CGGCCAGTGAGGCAGGGCTTCGTCAAGGTGACCTCATCACCCATGTCAATGGGGAACCTGTGCATGGCCTGGTGCACACGGAGGTGGTAG
AGCTGATCCTGAAGAGTGGAAACAAGGTGGCCATTTCAACAACTCCCCTGGAGAACACATCCATTAAAGTGGGGCCAGCTCGGAAGGGCA
GCTACAAGGCCAAGATGGCCCGAAGGAGCAAGAGGAGCCGCGGCAAGGATGGGCAAGAAAGCAGAAAAAGGAGCTCCCTGTTCCGCAAGA
TCACCAAGCAAGCATCCCTGCTCCACACCAGCCGCAGCCTTTCTTCCCTTAACCGCTCCTTGTCATCAGGGGAGAGTGGGCCAGGCTCTC
CCACACACAGCCACAGCCTTTCCCCCCGATCTCCCACTCAAGGCTACCGGGTGACCCCCGATGCTGTGCATTCAGTGGGAGGGAATTCAT
CACAGAGCAGCTCCCCCAGCTCCAGCGTGCCCAGTTCCCCAGCCGGCTCTGGGCACACACGGCCCAGCTCCCTCCACGGTCTGGCACCCA
AGCTCCAACGCCAGTACCGCTCTCCACGGCGCAAGTCAGCAGGCAGCATCCCACTGTCACCACTGGCCCACACCCCTTCTCCCCCACCCC
CAACAGCTTCACCTCAGCGGTCCCCATCGCCCCTGTCTGGCCATGTAGCCCAGGCCTTTCCCACAAAGCTTCACTTGTCACCTCCCCTGG
GCAGGCAACTCTCACGGCCCAAGAGTGCGGAGCCACCCCGTTCACCACTACTCAAGAGGGTGCAGTCGGCTGAGAAACTGGCAGCAGCAC
TTGCCGCCTCTGAGAAGAAGCTAGCCACTTCTCGCAAGCACAGCCTTGACCTGCCCCACTCTGAACTAAAGAAGGAACTGCCGCCCAGGG
AAGTGAGCCCTCTGGAGGTAGTTGGAGCCAGGAGTGTGCTGTCTGGCAAGGGGGCCCTGCCAGGGAAGGGGGTGCTGCAGCCTGCTCCCT
CACGGGCCCTAGGCACCCTCCGGCAGGACCGAGCCGAACGACGGGAGTCGCTGCAGAAGCAAGAAGCCATTCGTGAGGTGGACTCCTCAG
AGGACGACACCGAGGAAGGGCCTGAGAACAGCCAGGGTGCACAGGAGCTGAGCTTGGCACCTCACCCAGAAGTGAGCCAGAGTGTGGCCC
CTAAAGGAGCAGGAGAGAGTGGGGAAGAGGATCCTTTCCCGTCCAGAGACCCTAGGAGCCTGGGCCCAATGGTCCCAAGCCTATTGACAG
GGATCACACTGGGGCCTCCCAGAATGGAAAGTCCCAGTGGTCCCCACAGGAGGCTCGGGAGCCCACAAGCCATTGAGGAGGCTGCCAGCT
CCTCCTCAGCAGGCCCCAACCTAGGTCAGTCTGGAGCCACAGACCCCATCCCTCCTGAAGGTTGCTGGAAGGCCCAGCACCTCCACACCC
AGGCACTAACAGCACTTTCTCCCAGCACTTCGGGACTCACCCCCACCAGCAGTTGCTCTCCTCCCAGCTCCACCTCTGGGAAGCTGAGCA
TGTGGTCCTGGAAATCCCTTATTGAGGGCCCAGACAGGGCATCCCCAAGCAGAAAGGCAACCATGGCAGGTGGGCTAGCCAACCTCCAGG
ATTTGGAAAACACAACTCCAGCCCAGCCTAAGAACCTGTCTCCCAGGGAGCAGGGGAAGACACAGCCACCTAGTGCCCCCAGACTGGCCC
ATCCATCTTATGAGGATCCCAGCCAGGGCTGGCTATGGGAGTCTGAGTGTGCACAAGCAGTGAAAGAGGATCCAGCCCTGAGCATCACCC
AAGTGCCTGATGCCTCAGGTGACAGAAGGCAGGACGTTCCATGCCGAGGCTGCCCCCTCACCCAGAAGTCTGAGCCCAGCCTCAGGAGGG

>In-frame_HOMER1_ENST00000282260_chr5_78808593_-_MAST2_ENST00000372009_chr1_46348036_+_4364nt
ATGGGAAGGAGTTGAGCCTTCCAAGAAGAGGCAGCTTTTGTCGGACAAGTAACCGCAAGAGCTTGATTGTGACCTCTAGCACATCACCTA
CACTACCACGGCCACACTCACCACTCCATGGCCACACAGGTAACAGTCCTTTGGACAGCCCCCGGAATTTCTCTCCAAATGCACCTGCTC
ACTTTTCTTTTGTTCCTGCCCGTAGGACTGATGGGCGGCGCTGGTCTTTGGCCTCTTTGCCCTCTTCAGGATATGGAACTAACACTCCTA
GCTCCACTGTCTCATCATCATGCTCCTCACAGGAAAAGCTGCATCAGTTGCCTTTCCAGCCTACAGCTGATGAGCTGCACTTTTTGACGA
AGCATTTCAGCACAGAGAGCGTACCAGATGAGGAAGGACGGCAGTCCCCAGCCATGCGGCCTCGCTCCCGGAGCCTCAGTCCCGGACGAT
CCCCAGTATCCTTTGACAGTGAAATAATAATGATGAATCATGTTTACAAAGAAAGATTCCCAAAGGCTCATGAGCGCTCAGAGAGCTCAG
AAGTGGCTTTTGTGATGCAGCTGGTGAAAAAGCTGATGATTATCATTGCCCGCCCAGCACGTCTCCTGGAATGCCTGGAGTTTGACCCTG
AAGAGTTCTACCACCTTTTAGAAGCAGCTGAGGGCCACGCCAAAGAGGGACAAGGGATTAAATGTGACATTCCCCGCTACATCGTTAGCC
AGCTGGGCCTCACCCGGGATCCCCTAGAAGAAATGGCCCAGTTGAGCAGCTGTGACAGTCCTGACACTCCAGAGACAGATGATTCTATTG
AGGGCCATGGGGCATCTCTGCCATCTAAAAAGACACCCTCTGAAGAGGACTTCGAGACCATTAAGCTCATCAGCAATGGCGCCTATGGGG
CTGTATTTCTGGTGCGGCACAAGTCCACCCGGCAGCGCTTTGCCATGAAGAAGATCAACAAGCAGAACCTGATCCTACGGAACCAGATCC
AGCAGGCCTTCGTGGAGCGTGACATACTGACTTTCGCTGAGAACCCCTTTGTGGTCAGCATGTTCTGCTCCTTTGATACCAAGCGCCACT
TGTGCATGGTGATGGAGTACGTTGAAGGGGGAGACTGTGCCACTCTGCTGAAGAATATTGGGGCCCTGCCTGTGGACATGGTGCGTCTAT
ACTTTGCGGAAACTGTGCTGGCCCTGGAGTACTTACACAACTATGGCATCGTGCACCGTGACCTCAAGCCTGACAACCTCCTAATTACAT
CCATGGGGCACATCAAGCTCACGGACTTTGGACTGTCCAAAATTGGCCTCATGAGTCTGACAACGAACTTGTATGAGGGTCATATTGAAA
AGGATGCCCGGGAATTCCTGGACAAGCAGGTATGCGGGACCCCAGAATACATTGCGCCTGAGGTGATCCTGCGCCAGGGCTATGGGAAGC
CAGTGGACTGGTGGGCCATGGGCATTATCCTGTATGAGTTCCTGGTGGGCTGCGTCCCTTTTTTTGGAGATACTCCGGAGGAGCTCTTTG
GGCAGGTGATCAGTGATGAGATTGTGTGGCCTGAGGGTGATGAGGCACTGCCCCCAGACGCCCAGGACCTCACCTCCAAACTGCTCCACC
AGAACCCTCTGGAGAGACTTGGCACAGGCAGTGCCTATGAGGTGAAGCAGCACCCATTCTTTACTGGTCTGGACTGGACAGGACTTCTCC
GCCAGAAGGCTGAATTTATTCCTCAGTTGGAGTCAGAGGATGATACTAGCTATTTTGACACCCGCTCAGAGCGATACCACCACATGGACT
CGGAGGATGAGGAAGAAGTGAGTGAGGATGGCTGCCTTGAGATCCGCCAGTTCTCTTCCTGCTCTCCAAGGTTCAACAAGGTGTACAGCA
GCATGGAGCGGCTCTCACTGCTCGAGGAGCGCCGGACACCACCCCCGACCAAGCGCAGCCTGAGTGAGGAGAAGGAGGACCATTCAGATG
GCCTGGCAGGGCTCAAAGGCCGAGACCGGAGCTGGGTGATTGGCTCCCCTGAGATATTACGGAAGCGGCTGTCGGTGTCTGAGTCATCCC
ACACAGAGAGTGACTCAAGCCCTCCAATGACAGTGCGACGCCGCTGCTCAGGCCTCCTGGATGCGCCTCGGTTCCCGGAGGGCCCTGAGG
AGGCCAGCAGCACCCTCAGGAGGCAACCACAGGAGGGTATATGGGTCCTGACACCCCCATCTGGAGAGGGGGTATCTGGGCCTGTCACTG
AACACTCAGGGGAGCAGCGGCCAAAGCTGGATGAGGAAGCTGTTGGCCGGAGCAGTGGTTCCAGTCCAGCTATGGAGACCCGAGGCCGTG
GGACCTCACAGCTGGCTGAGGGAGCCACAGCCAAGGCCATCAGTGACCTGGCTGTGCGTAGGGCCCGCCACCGGCTGCTCTCTGGGGACT
CAACAGAGAAGCGCACTGCTCGCCCTGTCAACAAAGTGATCAAGTCCGCCTCAGCCACAGCCCTCTCACTCCTCATTCCTTCGGAACACC
ACACCTGCTCCCCGTTGGCCAGCCCCATGTCCCCACATTCTCAGTCGTCCAACCCATCATCCCGGGACTCTTCTCCATATGGCTTCACCC
TGCGGGCCATTCGCGTCTACATGGGTGACTCCGATGTCTACACCGTGCACCATATGGTGTGGCACGTGGAGGATGGAGGTCCGGCCAGTG
AGGCAGGGCTTCGTCAAGGTGACCTCATCACCCATGTCAATGGGGAACCTGTGCATGGCCTGGTGCACACGGAGGTGGTAGAGCTGATCC
TGAAGAGTGGAAACAAGGTGGCCATTTCAACAACTCCCCTGGAGAACACATCCATTAAAGTGGGGCCAGCTCGGAAGGGCAGCTACAAGG
CCAAGATGGCCCGAAGGAGCAAGAGGAGCCGCGGCAAGGATGGGCAAGAAAGCAGAAAAAGGAGCTCCCTGTTCCGCAAGATCACCAAGC
AAGCATCCCTGCTCCACACCAGCCGCAGCCTTTCTTCCCTTAACCGCTCCTTGTCATCAGGGGAGAGTGGGCCAGGCTCTCCCACACACA
GCCACAGCCTTTCCCCCCGATCTCCCACTCAAGGCTACCGGGTGACCCCCGATGCTGTGCATTCAGAACTCTCACGGCCCAAGAGTGCGG
AGCCACCCCGTTCACCACTACTCAAGAGGGTGCAGTCGGCTGAGAAACTGGCAGCAGCACTTGCCGCCTCTGAGAAGAAGCTAGCCACTT
CTCGCAAGCACAGCCTTGACCTGCCCCACTCTGAACTAAAGAAGGAACTGCCGCCCAGGGAAGTGAGCCCTCTGGAGGTAGTTGGAGCCA
GGAGTGTGCTGTCTGGCAAGGGGGCCCTGCCAGGGAAGGGGGTGCTGCAGCCTGCTCCCTCACGGGCCCTAGGCACCCTCCGGCAGGACC
GAGCCGAACGACGGGAGTCGCTGCAGAAGCAAGAAGCCATTCGTGAGGTGGACTCCTCAGAGGACGACACCGAGGAAGGGCCTGAGAACA
GCCAGGGTGCACAGGAGCTGAGCTTGGCACCTCACCCAGAAGTGAGCCAGAGTGTGGCCCCTAAAGGAGCAGGAGAGAGTGGGGAAGAGG
ATCCTTTCCCGTCCAGAGACCCTAGGAGCCTGGGCCCAATGGTCCCAAGCCTATTGACAGGGATCACACTGGGGCCTCCCAGAATGGAAA
GTCCCAGTGGTCCCCACAGGAGGCTCGGGAGCCCACAAGCCATTGAGGAGGCTGCCAGCTCCTCCTCAGCAGGCCCCAACCTAGGTCAGT
CTGGAGCCACAGACCCCATCCCTCCTGAAGGTTGCTGGAAGGCCCAGCACCTCCACACCCAGGCACTAACAGCACTTTCTCCCAGCACTT
CGGGACTCACCCCCACCAGCAGTTGCTCTCCTCCCAGCTCCACCTCTGGGAAGCTGAGCATGTGGTCCTGGAAATCCCTTATTGAGGGCC
CAGACAGGGCATCCCCAAGCAGAAAGGCAACCATGGCAGGTGGGCTAGCCAACCTCCAGGATTTGGAAAACACAACTCCAGCCCAGCCTA
AGAACCTGTCTCCCAGGGAGCAGGGGAAGACACAGCCACCTAGTGCCCCCAGACTGGCCCATCCATCTTATGAGGATCCCAGCCAGGGCT
GGCTATGGGAGTCTGAGTGTGCACAAGCAGTGAAAGAGGATCCAGCCCTGAGCATCACCCAAGTGCCTGATGCCTCAGGTGACAGAAGGC
AGGACGTTCCATGCCGAGGCTGCCCCCTCACCCAGAAGTCTGAGCCCAGCCTCAGGAGGGGCCAAGAACCAGGGGGCCATCAAAAGCATC

>In-frame_HOMER1_ENST00000282260_chr5_78808593_-_MAST2_ENST00000361297_chr1_46348036_+_4934nt
ATGGGAAGGAGTTGAGCCTTCCAAGAAGAGGCAGCTTTTGTCGGACAAGTAACCGCAAGAGCTTGATTGTGACCTCTAGCACATCACCTA
CACTACCACGGCCACACTCACCACTCCATGGCCACACAGGTAACAGTCCTTTGGACAGCCCCCGGAATTTCTCTCCAAATGCACCTGCTC
ACTTTTCTTTTGTTCCTGCCCGTAGGACTGATGGGCGGCGCTGGTCTTTGGCCTCTTTGCCCTCTTCAGGATATGGAACTAACACTCCTA
GCTCCACTGTCTCATCATCATGCTCCTCACAGGAAAAGCTGCATCAGTTGCCTTTCCAGCCTACAGCTGATGAGCTGCACTTTTTGACGA
AGCATTTCAGCACAGAGAGCGTACCAGATGAGGAAGGACGGCAGTCCCCAGCCATGCGGCCTCGCTCCCGGAGCCTCAGTCCCGGACGAT
CCCCAGTATCCTTTGACAGTGAAATAATAATGATGAATCATGTTTACAAAGAAAGATTCCCAAAGGCCACCGCACAAATGGAAGAGCGAC
TAGCAGAGTTTATTTCCTCCAACACTCCAGACAGCGTGCTGCCCTTGGCAGATGGAGCCCTGAGCTTTATTCATCATCAGGTGATTGAGA
TGGCCCGAGACTGCCTGGATAAATCTCGGAGTGGCCTCATTACATCACAATACTTCTACGAACTTCAAGATAATTTGGAGAAACTTTTAC
AAGATGCTCATGAGCGCTCAGAGAGCTCAGAAGTGGCTTTTGTGATGCAGCTGGTGAAAAAGCTGATGATTATCATTGCCCGCCCAGCAC
GTCTCCTGGAATGCCTGGAGTTTGACCCTGAAGAGTTCTACCACCTTTTAGAAGCAGCTGAGGGCCACGCCAAAGAGGGACAAGGGATTA
AATGTGACATTCCCCGCTACATCGTTAGCCAGCTGGGCCTCACCCGGGATCCCCTAGAAGAAATGGCCCAGTTGAGCAGCTGTGACAGTC
CTGACACTCCAGAGACAGATGATTCTATTGAGGGCCATGGGGCATCTCTGCCATCTAAAAAGACACCCTCTGAAGAGGACTTCGAGACCA
TTAAGCTCATCAGCAATGGCGCCTATGGGGCTGTATTTCTGGTGCGGCACAAGTCCACCCGGCAGCGCTTTGCCATGAAGAAGATCAACA
AGCAGAACCTGATCCTACGGAACCAGATCCAGCAGGCCTTCGTGGAGCGTGACATACTGACTTTCGCTGAGAACCCCTTTGTGGTCAGCA
TGTTCTGCTCCTTTGATACCAAGCGCCACTTGTGCATGGTGATGGAGTACGTTGAAGGGGGAGACTGTGCCACTCTGCTGAAGAATATTG
GGGCCCTGCCTGTGGACATGGTGCGTCTATACTTTGCGGAAACTGTGCTGGCCCTGGAGTACTTACACAACTATGGCATCGTGCACCGTG
ACCTCAAGCCTGACAACCTCCTAATTACATCCATGGGGCACATCAAGCTCACGGACTTTGGACTGTCCAAAATTGGCCTCATGAGTCTGA
CAACGAACTTGTATGAGGGTCATATTGAAAAGGATGCCCGGGAATTCCTGGACAAGCAGGTATGCGGGACCCCAGAATACATTGCGCCTG
AGGTGATCCTGCGCCAGGGCTATGGGAAGCCAGTGGACTGGTGGGCCATGGGCATTATCCTGTATGAGTTCCTGGTGGGCTGCGTCCCTT
TTTTTGGAGATACTCCGGAGGAGCTCTTTGGGCAGGTGATCAGTGATGAGATTGTGTGGCCTGAGGGTGATGAGGCACTGCCCCCAGACG
CCCAGGACCTCACCTCCAAACTGCTCCACCAGAACCCTCTGGAGAGACTTGGCACAGGCAGTGCCTATGAGGTGAAGCAGCACCCATTCT
TTACTGGTCTGGACTGGACAGGACTTCTCCGCCAGAAGGCTGAATTTATTCCTCAGTTGGAGTCAGAGGATGATACTAGCTATTTTGACA
CCCGCTCAGAGCGATACCACCACATGGACTCGGAGGATGAGGAAGAAGTGAGTGAGGATGGCTGCCTTGAGATCCGCCAGTTCTCTTCCT
GCTCTCCAAGGTTCAACAAGGTGTACAGCAGCATGGAGCGGCTCTCACTGCTCGAGGAGCGCCGGACACCACCCCCGACCAAGCGCAGCC
TGAGTGAGGAGAAGGAGGACCATTCAGATGGCCTGGCAGGGCTCAAAGGCCGAGACCGGAGCTGGGTGATTGGCTCCCCTGAGATATTAC
GGAAGCGGCTGTCGGTGTCTGAGTCATCCCACACAGAGAGTGACTCAAGCCCTCCAATGACAGTGCGACGCCGCTGCTCAGGCCTCCTGG
ATGCGCCTCGGTTCCCGGAGGGCCCTGAGGAGGCCAGCAGCACCCTCAGGAGGCAACCACAGGAGGGTATATGGGTCCTGACACCCCCAT
CTGGAGAGGGGGTATCTGGGCCTGTCACTGAACACTCAGGGGAGCAGCGGCCAAAGCTGGATGAGGAAGCTGTTGGCCGGAGCAGTGGTT
CCAGTCCAGCTATGGAGACCCGAGGCCGTGGGACCTCACAGCTGGCTGAGGGAGCCACAGCCAAGGCCATCAGTGACCTGGCTGTGCGTA
GGGCCCGCCACCGGCTGCTCTCTGGGGACTCAACAGAGAAGCGCACTGCTCGCCCTGTCAACAAAGTGATCAAGTCCGCCTCAGCCACAG
CCCTCTCACTCCTCATTCCTTCGGAACACCACACCTGCTCCCCGTTGGCCAGCCCCATGTCCCCACATTCTCAGTCGTCCAACCCATCAT
CCCGGGACTCTTCTCCAAGCAGGGACTTCTTGCCAGCCCTTGGCAGCATGAGGCCTCCCATCATCATCCACCGAGCTGGCAAGAAGTATG
GCTTCACCCTGCGGGCCATTCGCGTCTACATGGGTGACTCCGATGTCTACACCGTGCACCATATGGTGTGGCACGTGGAGGATGGAGGTC
CGGCCAGTGAGGCAGGGCTTCGTCAAGGTGACCTCATCACCCATGTCAATGGGGAACCTGTGCATGGCCTGGTGCACACGGAGGTGGTAG
AGCTGATCCTGAAGAGTGGAAACAAGGTGGCCATTTCAACAACTCCCCTGGAGAACACATCCATTAAAGTGGGGCCAGCTCGGAAGGGCA
GCTACAAGGCCAAGATGGCCCGAAGGAGCAAGAGGAGCCGCGGCAAGGATGGGCAAGAAAGCAGAAAAAGGAGCTCCCTGTTCCGCAAGA
TCACCAAGCAAGCATCCCTGCTCCACACCAGCCGCAGCCTTTCTTCCCTTAACCGCTCCTTGTCATCAGGGGAGAGTGGGCCAGGCTCTC
CCACACACAGCCACAGCCTTTCCCCCCGATCTCCCACTCAAGGCTACCGGGTGACCCCCGATGCTGTGCATTCAGTGGGAGGGAATTCAT
CACAGAGCAGCTCCCCCAGCTCCAGCGTGCCCAGTTCCCCAGCCGGCTCTGGGCACACACGGCCCAGCTCCCTCCACGGTCTGGCACCCA
AGCTCCAACGCCAGTACCGCTCTCCACGGCGCAAGTCAGCAGGCAGCATCCCACTGTCACCACTGGCCCACACCCCTTCTCCCCCACCCC
CAACAGCTTCACCTCAGCGGTCCCCATCGCCCCTGTCTGGCCATGTAGCCCAGGCCTTTCCCACAAAGCTTCACTTGTCACCTCCCCTGG
GCAGGCAACTCTCACGGCCCAAGAGTGCGGAGCCACCCCGTTCACCACTACTCAAGAGGGTGCAGTCGGCTGAGAAACTGGCAGCAGCAC
TTGCCGCCTCTGAGAAGAAGCTAGCCACTTCTCGCAAGCACAGCCTTGACCTGCCCCACTCTGAACTAAAGAAGGAACTGCCGCCCAGGG
AAGTGAGCCCTCTGGAGGTAGTTGGAGCCAGGAGTGTGCTGTCTGGCAAGGGGGCCCTGCCAGGGAAGGGGGTGCTGCAGCCTGCTCCCT
CACGGGCCCTAGGCACCCTCCGGCAGGACCGAGCCGAACGACGGGAGTCGCTGCAGAAGCAAGAAGCCATTCGTGAGGTGGACTCCTCAG
AGGACGACACCGAGGAAGGGCCTGAGAACAGCCAGGGTGCACAGGAGCTGAGCTTGGCACCTCACCCAGAAGTGAGCCAGAGTGTGGCCC
CTAAAGGAGCAGGAGAGAGTGGGGAAGAGGATCCTTTCCCGTCCAGAGACCCTAGGAGCCTGGGCCCAATGGTCCCAAGCCTATTGACAG
GGATCACACTGGGGCCTCCCAGAATGGAAAGTCCCAGTGGTCCCCACAGGAGGCTCGGGAGCCCACAAGCCATTGAGGAGGCTGCCAGCT
CCTCCTCAGCAGGCCCCAACCTAGGTCAGTCTGGAGCCACAGACCCCATCCCTCCTGAAGGTTGCTGGAAGGCCCAGCACCTCCACACCC
AGGCACTAACAGCACTTTCTCCCAGCACTTCGGGACTCACCCCCACCAGCAGTTGCTCTCCTCCCAGCTCCACCTCTGGGAAGCTGAGCA
TGTGGTCCTGGAAATCCCTTATTGAGGGCCCAGACAGGGCATCCCCAAGCAGAAAGGCAACCATGGCAGGTGGGCTAGCCAACCTCCAGG
ATTTGGAAAACACAACTCCAGCCCAGCCTAAGAACCTGTCTCCCAGGGAGCAGGGGAAGACACAGCCACCTAGTGCCCCCAGACTGGCCC
ATCCATCTTATGAGGATCCCAGCCAGGGCTGGCTATGGGAGTCTGAGTGTGCACAAGCAGTGAAAGAGGATCCAGCCCTGAGCATCACCC
AAGTGCCTGATGCCTCAGGTGACAGAAGGCAGGACGTTCCATGCCGAGGCTGCCCCCTCACCCAGAAGTCTGAGCCCAGCCTCAGGAGGG


* Fusion transcript sequences (Full-length transcript).
>In-frame_HOMER1_ENST00000334082_chr5_78808593_-_MAST2_ENST00000372009_chr1_46348036_+_5807nt
GCCTCCCGTCCCTTCCCGCGAGCAGAGGGAGGGACCGCCCTCGCTCCCCGTTCTCTCCGCCCCCTTCCCGCCCCCCGCAGCCCACTCTGC
CGCCGCGCTAGCTTCACGCCGGCGGCGCTGACCGGGAAAGCAGCACCCTCTTCTCTGCCAGCCGGCCGGCCGGCGGAGGCGGAGGCAGCG
GCAGGCTTCAGGCCGCCGGGGCTGGCGCTGCTCTGCCCGGCGGTAGCCGGAGGCGGGCGCTGATGGAAGTGTGAAGAGGCGGCGGCGGGG
CCCGGGGAATGTGAGGCGGCGCGTGGCGGCGGCGCGGAGCGTGAGAGACGAGGAGTAGGGGTGGGGGCGCTGGAGCGGCGGCTGCGCTTC
GGCTTCGAGCCCAGCTCTCCTGGCCCCAACGCGGGCTTAGCCTCCCGCCTTGGCTCGGGCAGGCGCCCGTCGACCCTTCGGCCCCTTTCG
CCCGCCCTGGAGCTGGGGGCAGGGTGCCAGTGGAAGCGTGGGGCTTGGCTCTGTGATTCATTCATTCTCCGCCGACGGGAGCCTCAGACC
CGCTGTGCTCTGAAGAGAGGAGGGAAGAGGGGGCAGCCGCGAATGAAGGGCCGGGCACCAGCCGGGCTCCATTGTGCTCGGCGGCGGGGG
GCGGGAAGGGGCTGAGGGAGGTGGGATCGGGTCCCCTCCTCCAGCTCTCCGGCGTGCGCTGCGCCCCCAGCCTGCTGCCAGCCTGGAAAT
GGCTCCGTTTATTCTCTTCGGGAGAATGAATCGATCCTGCCTAGCCTTCTCTTCGTCCTCCCCACCTCTTCTCTGCTCCGAGTCTTAGGA
GGAGAAACATTTAAAAAGACAGATTCCAATGTGGAGTGCCGTGCAGGTTGCGAGCTGCCGGGTTTGCACTTCGAGGAGATTTTCCTGTGT
AGTTTTTTTCCTAATGTGAGCGCAGGGAAGCCGTGGCATTACTGCTTTTGGGATTTTTATTCACGTGCACGTCGCGTTTGGTTGCTCGCT
CCACCCCCGGAGACCTGGTGTGGTGGAGAAATTTGAACCCGCAGCCTTAGCTCCGAAAAGGCCGAGTTACCTGGCTCTCCCTGAGTGTCG
AGGAGGACATGAGTGAAATGACCAGCGAACTCATTTTTTATAGGACTCGGTGAAGCCGGATTCTGCATTTCCCTACTTGTAGACTCATTT
TGTGGAATAGAGTTGATCGCTGTCTCCTCCGCAAAGCATTTTAACTCGAATAAGCAAATGCCGCCTCTGTTTGAACGTTTTGGTATTTAC
AAGAGAGAAATCATTTTACCTAAGAGAACTAATTGAATTGGCAGCATCCTTGAAATACCTCCGGACAAGGATCTGGGGGTGGGGGTGGAA
AAGCAACTGCGAAATAGCAGACGGAGAAATTCCTTTGGAAGTTATTCCGTAGCATAAGAGCTGAAACTTCAGAGCAAGTTTTCATTGGGC
AAAATGGGAAGGAGTTGAGCCTTCCAAGAAGAGGCAGCTTTTGTCGGACAAGTAACCGCAAGAGCTTGATTGTGACCTCTAGCACATCAC
CTACACTACCACGGCCACACTCACCACTCCATGGCCACACAGGTAACAGTCCTTTGGACAGCCCCCGGAATTTCTCTCCAAATGCACCTG
CTCACTTTTCTTTTGTTCCTGCCCGTAGGACTGATGGGCGGCGCTGGTCTTTGGCCTCTTTGCCCTCTTCAGGATATGGAACTAACACTC
CTAGCTCCACTGTCTCATCATCATGCTCCTCACAGGAAAAGCTGCATCAGTTGCCTTTCCAGCCTACAGCTGATGAGCTGCACTTTTTGA
CGAAGCATTTCAGCACAGAGAGCGTACCAGATGAGGAAGGACGGCAGTCCCCAGCCATGCGGCCTCGCTCCCGGAGCCTCAGTCCCGGAC
GATCCCCAGTATCCTTTGACAGTGAAATAATAATGATGAATCATGTTTACAAAGAAAGATTCCCAAAGGCTCATGAGCGCTCAGAGAGCT
CAGAAGTGGCTTTTGTGATGCAGCTGGTGAAAAAGCTGATGATTATCATTGCCCGCCCAGCACGTCTCCTGGAATGCCTGGAGTTTGACC
CTGAAGAGTTCTACCACCTTTTAGAAGCAGCTGAGGGCCACGCCAAAGAGGGACAAGGGATTAAATGTGACATTCCCCGCTACATCGTTA
GCCAGCTGGGCCTCACCCGGGATCCCCTAGAAGAAATGGCCCAGTTGAGCAGCTGTGACAGTCCTGACACTCCAGAGACAGATGATTCTA
TTGAGGGCCATGGGGCATCTCTGCCATCTAAAAAGACACCCTCTGAAGAGGACTTCGAGACCATTAAGCTCATCAGCAATGGCGCCTATG
GGGCTGTATTTCTGGTGCGGCACAAGTCCACCCGGCAGCGCTTTGCCATGAAGAAGATCAACAAGCAGAACCTGATCCTACGGAACCAGA
TCCAGCAGGCCTTCGTGGAGCGTGACATACTGACTTTCGCTGAGAACCCCTTTGTGGTCAGCATGTTCTGCTCCTTTGATACCAAGCGCC
ACTTGTGCATGGTGATGGAGTACGTTGAAGGGGGAGACTGTGCCACTCTGCTGAAGAATATTGGGGCCCTGCCTGTGGACATGGTGCGTC
TATACTTTGCGGAAACTGTGCTGGCCCTGGAGTACTTACACAACTATGGCATCGTGCACCGTGACCTCAAGCCTGACAACCTCCTAATTA
CATCCATGGGGCACATCAAGCTCACGGACTTTGGACTGTCCAAAATTGGCCTCATGAGTCTGACAACGAACTTGTATGAGGGTCATATTG
AAAAGGATGCCCGGGAATTCCTGGACAAGCAGGTATGCGGGACCCCAGAATACATTGCGCCTGAGGTGATCCTGCGCCAGGGCTATGGGA
AGCCAGTGGACTGGTGGGCCATGGGCATTATCCTGTATGAGTTCCTGGTGGGCTGCGTCCCTTTTTTTGGAGATACTCCGGAGGAGCTCT
TTGGGCAGGTGATCAGTGATGAGATTGTGTGGCCTGAGGGTGATGAGGCACTGCCCCCAGACGCCCAGGACCTCACCTCCAAACTGCTCC
ACCAGAACCCTCTGGAGAGACTTGGCACAGGCAGTGCCTATGAGGTGAAGCAGCACCCATTCTTTACTGGTCTGGACTGGACAGGACTTC
TCCGCCAGAAGGCTGAATTTATTCCTCAGTTGGAGTCAGAGGATGATACTAGCTATTTTGACACCCGCTCAGAGCGATACCACCACATGG
ACTCGGAGGATGAGGAAGAAGTGAGTGAGGATGGCTGCCTTGAGATCCGCCAGTTCTCTTCCTGCTCTCCAAGGTTCAACAAGGTGTACA
GCAGCATGGAGCGGCTCTCACTGCTCGAGGAGCGCCGGACACCACCCCCGACCAAGCGCAGCCTGAGTGAGGAGAAGGAGGACCATTCAG
ATGGCCTGGCAGGGCTCAAAGGCCGAGACCGGAGCTGGGTGATTGGCTCCCCTGAGATATTACGGAAGCGGCTGTCGGTGTCTGAGTCAT
CCCACACAGAGAGTGACTCAAGCCCTCCAATGACAGTGCGACGCCGCTGCTCAGGCCTCCTGGATGCGCCTCGGTTCCCGGAGGGCCCTG
AGGAGGCCAGCAGCACCCTCAGGAGGCAACCACAGGAGGGTATATGGGTCCTGACACCCCCATCTGGAGAGGGGGTATCTGGGCCTGTCA
CTGAACACTCAGGGGAGCAGCGGCCAAAGCTGGATGAGGAAGCTGTTGGCCGGAGCAGTGGTTCCAGTCCAGCTATGGAGACCCGAGGCC
GTGGGACCTCACAGCTGGCTGAGGGAGCCACAGCCAAGGCCATCAGTGACCTGGCTGTGCGTAGGGCCCGCCACCGGCTGCTCTCTGGGG
ACTCAACAGAGAAGCGCACTGCTCGCCCTGTCAACAAAGTGATCAAGTCCGCCTCAGCCACAGCCCTCTCACTCCTCATTCCTTCGGAAC
ACCACACCTGCTCCCCGTTGGCCAGCCCCATGTCCCCACATTCTCAGTCGTCCAACCCATCATCCCGGGACTCTTCTCCATATGGCTTCA
CCCTGCGGGCCATTCGCGTCTACATGGGTGACTCCGATGTCTACACCGTGCACCATATGGTGTGGCACGTGGAGGATGGAGGTCCGGCCA
GTGAGGCAGGGCTTCGTCAAGGTGACCTCATCACCCATGTCAATGGGGAACCTGTGCATGGCCTGGTGCACACGGAGGTGGTAGAGCTGA
TCCTGAAGAGTGGAAACAAGGTGGCCATTTCAACAACTCCCCTGGAGAACACATCCATTAAAGTGGGGCCAGCTCGGAAGGGCAGCTACA
AGGCCAAGATGGCCCGAAGGAGCAAGAGGAGCCGCGGCAAGGATGGGCAAGAAAGCAGAAAAAGGAGCTCCCTGTTCCGCAAGATCACCA
AGCAAGCATCCCTGCTCCACACCAGCCGCAGCCTTTCTTCCCTTAACCGCTCCTTGTCATCAGGGGAGAGTGGGCCAGGCTCTCCCACAC
ACAGCCACAGCCTTTCCCCCCGATCTCCCACTCAAGGCTACCGGGTGACCCCCGATGCTGTGCATTCAGAACTCTCACGGCCCAAGAGTG
CGGAGCCACCCCGTTCACCACTACTCAAGAGGGTGCAGTCGGCTGAGAAACTGGCAGCAGCACTTGCCGCCTCTGAGAAGAAGCTAGCCA
CTTCTCGCAAGCACAGCCTTGACCTGCCCCACTCTGAACTAAAGAAGGAACTGCCGCCCAGGGAAGTGAGCCCTCTGGAGGTAGTTGGAG
CCAGGAGTGTGCTGTCTGGCAAGGGGGCCCTGCCAGGGAAGGGGGTGCTGCAGCCTGCTCCCTCACGGGCCCTAGGCACCCTCCGGCAGG
ACCGAGCCGAACGACGGGAGTCGCTGCAGAAGCAAGAAGCCATTCGTGAGGTGGACTCCTCAGAGGACGACACCGAGGAAGGGCCTGAGA
ACAGCCAGGGTGCACAGGAGCTGAGCTTGGCACCTCACCCAGAAGTGAGCCAGAGTGTGGCCCCTAAAGGAGCAGGAGAGAGTGGGGAAG
AGGATCCTTTCCCGTCCAGAGACCCTAGGAGCCTGGGCCCAATGGTCCCAAGCCTATTGACAGGGATCACACTGGGGCCTCCCAGAATGG
AAAGTCCCAGTGGTCCCCACAGGAGGCTCGGGAGCCCACAAGCCATTGAGGAGGCTGCCAGCTCCTCCTCAGCAGGCCCCAACCTAGGTC
AGTCTGGAGCCACAGACCCCATCCCTCCTGAAGGTTGCTGGAAGGCCCAGCACCTCCACACCCAGGCACTAACAGCACTTTCTCCCAGCA
CTTCGGGACTCACCCCCACCAGCAGTTGCTCTCCTCCCAGCTCCACCTCTGGGAAGCTGAGCATGTGGTCCTGGAAATCCCTTATTGAGG
GCCCAGACAGGGCATCCCCAAGCAGAAAGGCAACCATGGCAGGTGGGCTAGCCAACCTCCAGGATTTGGAAAACACAACTCCAGCCCAGC
CTAAGAACCTGTCTCCCAGGGAGCAGGGGAAGACACAGCCACCTAGTGCCCCCAGACTGGCCCATCCATCTTATGAGGATCCCAGCCAGG
GCTGGCTATGGGAGTCTGAGTGTGCACAAGCAGTGAAAGAGGATCCAGCCCTGAGCATCACCCAAGTGCCTGATGCCTCAGGTGACAGAA
GGCAGGACGTTCCATGCCGAGGCTGCCCCCTCACCCAGAAGTCTGAGCCCAGCCTCAGGAGGGGCCAAGAACCAGGGGGCCATCAAAAGC

>In-frame_HOMER1_ENST00000334082_chr5_78808593_-_MAST2_ENST00000361297_chr1_46348036_+_6435nt
GCCTCCCGTCCCTTCCCGCGAGCAGAGGGAGGGACCGCCCTCGCTCCCCGTTCTCTCCGCCCCCTTCCCGCCCCCCGCAGCCCACTCTGC
CGCCGCGCTAGCTTCACGCCGGCGGCGCTGACCGGGAAAGCAGCACCCTCTTCTCTGCCAGCCGGCCGGCCGGCGGAGGCGGAGGCAGCG
GCAGGCTTCAGGCCGCCGGGGCTGGCGCTGCTCTGCCCGGCGGTAGCCGGAGGCGGGCGCTGATGGAAGTGTGAAGAGGCGGCGGCGGGG
CCCGGGGAATGTGAGGCGGCGCGTGGCGGCGGCGCGGAGCGTGAGAGACGAGGAGTAGGGGTGGGGGCGCTGGAGCGGCGGCTGCGCTTC
GGCTTCGAGCCCAGCTCTCCTGGCCCCAACGCGGGCTTAGCCTCCCGCCTTGGCTCGGGCAGGCGCCCGTCGACCCTTCGGCCCCTTTCG
CCCGCCCTGGAGCTGGGGGCAGGGTGCCAGTGGAAGCGTGGGGCTTGGCTCTGTGATTCATTCATTCTCCGCCGACGGGAGCCTCAGACC
CGCTGTGCTCTGAAGAGAGGAGGGAAGAGGGGGCAGCCGCGAATGAAGGGCCGGGCACCAGCCGGGCTCCATTGTGCTCGGCGGCGGGGG
GCGGGAAGGGGCTGAGGGAGGTGGGATCGGGTCCCCTCCTCCAGCTCTCCGGCGTGCGCTGCGCCCCCAGCCTGCTGCCAGCCTGGAAAT
GGCTCCGTTTATTCTCTTCGGGAGAATGAATCGATCCTGCCTAGCCTTCTCTTCGTCCTCCCCACCTCTTCTCTGCTCCGAGTCTTAGGA
GGAGAAACATTTAAAAAGACAGATTCCAATGTGGAGTGCCGTGCAGGTTGCGAGCTGCCGGGTTTGCACTTCGAGGAGATTTTCCTGTGT
AGTTTTTTTCCTAATGTGAGCGCAGGGAAGCCGTGGCATTACTGCTTTTGGGATTTTTATTCACGTGCACGTCGCGTTTGGTTGCTCGCT
CCACCCCCGGAGACCTGGTGTGGTGGAGAAATTTGAACCCGCAGCCTTAGCTCCGAAAAGGCCGAGTTACCTGGCTCTCCCTGAGTGTCG
AGGAGGACATGAGTGAAATGACCAGCGAACTCATTTTTTATAGGACTCGGTGAAGCCGGATTCTGCATTTCCCTACTTGTAGACTCATTT
TGTGGAATAGAGTTGATCGCTGTCTCCTCCGCAAAGCATTTTAACTCGAATAAGCAAATGCCGCCTCTGTTTGAACGTTTTGGTATTTAC
AAGAGAGAAATCATTTTACCTAAGAGAACTAATTGAATTGGCAGCATCCTTGAAATACCTCCGGACAAGGATCTGGGGGTGGGGGTGGAA
AAGCAACTGCGAAATAGCAGACGGAGAAATTCCTTTGGAAGTTATTCCGTAGCATAAGAGCTGAAACTTCAGAGCAAGTTTTCATTGGGC
AAAATGGGAAGGAGTTGAGCCTTCCAAGAAGAGGCAGCTTTTGTCGGACAAGTAACCGCAAGAGCTTGATTGTGACCTCTAGCACATCAC
CTACACTACCACGGCCACACTCACCACTCCATGGCCACACAGGTAACAGTCCTTTGGACAGCCCCCGGAATTTCTCTCCAAATGCACCTG
CTCACTTTTCTTTTGTTCCTGCCCGTAGGACTGATGGGCGGCGCTGGTCTTTGGCCTCTTTGCCCTCTTCAGGATATGGAACTAACACTC
CTAGCTCCACTGTCTCATCATCATGCTCCTCACAGGAAAAGCTGCATCAGTTGCCTTTCCAGCCTACAGCTGATGAGCTGCACTTTTTGA
CGAAGCATTTCAGCACAGAGAGCGTACCAGATGAGGAAGGACGGCAGTCCCCAGCCATGCGGCCTCGCTCCCGGAGCCTCAGTCCCGGAC
GATCCCCAGTATCCTTTGACAGTGAAATAATAATGATGAATCATGTTTACAAAGAAAGATTCCCAAAGGCCACCGCACAAATGGAAGAGC
GACTAGCAGAGTTTATTTCCTCCAACACTCCAGACAGCGTGCTGCCCTTGGCAGATGGAGCCCTGAGCTTTATTCATCATCAGGTGATTG
AGATGGCCCGAGACTGCCTGGATAAATCTCGGAGTGGCCTCATTACATCACAATACTTCTACGAACTTCAAGATAATTTGGAGAAACTTT
TACAAGATGCTCATGAGCGCTCAGAGAGCTCAGAAGTGGCTTTTGTGATGCAGCTGGTGAAAAAGCTGATGATTATCATTGCCCGCCCAG
CACGTCTCCTGGAATGCCTGGAGTTTGACCCTGAAGAGTTCTACCACCTTTTAGAAGCAGCTGAGGGCCACGCCAAAGAGGGACAAGGGA
TTAAATGTGACATTCCCCGCTACATCGTTAGCCAGCTGGGCCTCACCCGGGATCCCCTAGAAGAAATGGCCCAGTTGAGCAGCTGTGACA
GTCCTGACACTCCAGAGACAGATGATTCTATTGAGGGCCATGGGGCATCTCTGCCATCTAAAAAGACACCCTCTGAAGAGGACTTCGAGA
CCATTAAGCTCATCAGCAATGGCGCCTATGGGGCTGTATTTCTGGTGCGGCACAAGTCCACCCGGCAGCGCTTTGCCATGAAGAAGATCA
ACAAGCAGAACCTGATCCTACGGAACCAGATCCAGCAGGCCTTCGTGGAGCGTGACATACTGACTTTCGCTGAGAACCCCTTTGTGGTCA
GCATGTTCTGCTCCTTTGATACCAAGCGCCACTTGTGCATGGTGATGGAGTACGTTGAAGGGGGAGACTGTGCCACTCTGCTGAAGAATA
TTGGGGCCCTGCCTGTGGACATGGTGCGTCTATACTTTGCGGAAACTGTGCTGGCCCTGGAGTACTTACACAACTATGGCATCGTGCACC
GTGACCTCAAGCCTGACAACCTCCTAATTACATCCATGGGGCACATCAAGCTCACGGACTTTGGACTGTCCAAAATTGGCCTCATGAGTC
TGACAACGAACTTGTATGAGGGTCATATTGAAAAGGATGCCCGGGAATTCCTGGACAAGCAGGTATGCGGGACCCCAGAATACATTGCGC
CTGAGGTGATCCTGCGCCAGGGCTATGGGAAGCCAGTGGACTGGTGGGCCATGGGCATTATCCTGTATGAGTTCCTGGTGGGCTGCGTCC
CTTTTTTTGGAGATACTCCGGAGGAGCTCTTTGGGCAGGTGATCAGTGATGAGATTGTGTGGCCTGAGGGTGATGAGGCACTGCCCCCAG
ACGCCCAGGACCTCACCTCCAAACTGCTCCACCAGAACCCTCTGGAGAGACTTGGCACAGGCAGTGCCTATGAGGTGAAGCAGCACCCAT
TCTTTACTGGTCTGGACTGGACAGGACTTCTCCGCCAGAAGGCTGAATTTATTCCTCAGTTGGAGTCAGAGGATGATACTAGCTATTTTG
ACACCCGCTCAGAGCGATACCACCACATGGACTCGGAGGATGAGGAAGAAGTGAGTGAGGATGGCTGCCTTGAGATCCGCCAGTTCTCTT
CCTGCTCTCCAAGGTTCAACAAGGTGTACAGCAGCATGGAGCGGCTCTCACTGCTCGAGGAGCGCCGGACACCACCCCCGACCAAGCGCA
GCCTGAGTGAGGAGAAGGAGGACCATTCAGATGGCCTGGCAGGGCTCAAAGGCCGAGACCGGAGCTGGGTGATTGGCTCCCCTGAGATAT
TACGGAAGCGGCTGTCGGTGTCTGAGTCATCCCACACAGAGAGTGACTCAAGCCCTCCAATGACAGTGCGACGCCGCTGCTCAGGCCTCC
TGGATGCGCCTCGGTTCCCGGAGGGCCCTGAGGAGGCCAGCAGCACCCTCAGGAGGCAACCACAGGAGGGTATATGGGTCCTGACACCCC
CATCTGGAGAGGGGGTATCTGGGCCTGTCACTGAACACTCAGGGGAGCAGCGGCCAAAGCTGGATGAGGAAGCTGTTGGCCGGAGCAGTG
GTTCCAGTCCAGCTATGGAGACCCGAGGCCGTGGGACCTCACAGCTGGCTGAGGGAGCCACAGCCAAGGCCATCAGTGACCTGGCTGTGC
GTAGGGCCCGCCACCGGCTGCTCTCTGGGGACTCAACAGAGAAGCGCACTGCTCGCCCTGTCAACAAAGTGATCAAGTCCGCCTCAGCCA
CAGCCCTCTCACTCCTCATTCCTTCGGAACACCACACCTGCTCCCCGTTGGCCAGCCCCATGTCCCCACATTCTCAGTCGTCCAACCCAT
CATCCCGGGACTCTTCTCCAAGCAGGGACTTCTTGCCAGCCCTTGGCAGCATGAGGCCTCCCATCATCATCCACCGAGCTGGCAAGAAGT
ATGGCTTCACCCTGCGGGCCATTCGCGTCTACATGGGTGACTCCGATGTCTACACCGTGCACCATATGGTGTGGCACGTGGAGGATGGAG
GTCCGGCCAGTGAGGCAGGGCTTCGTCAAGGTGACCTCATCACCCATGTCAATGGGGAACCTGTGCATGGCCTGGTGCACACGGAGGTGG
TAGAGCTGATCCTGAAGAGTGGAAACAAGGTGGCCATTTCAACAACTCCCCTGGAGAACACATCCATTAAAGTGGGGCCAGCTCGGAAGG
GCAGCTACAAGGCCAAGATGGCCCGAAGGAGCAAGAGGAGCCGCGGCAAGGATGGGCAAGAAAGCAGAAAAAGGAGCTCCCTGTTCCGCA
AGATCACCAAGCAAGCATCCCTGCTCCACACCAGCCGCAGCCTTTCTTCCCTTAACCGCTCCTTGTCATCAGGGGAGAGTGGGCCAGGCT
CTCCCACACACAGCCACAGCCTTTCCCCCCGATCTCCCACTCAAGGCTACCGGGTGACCCCCGATGCTGTGCATTCAGTGGGAGGGAATT
CATCACAGAGCAGCTCCCCCAGCTCCAGCGTGCCCAGTTCCCCAGCCGGCTCTGGGCACACACGGCCCAGCTCCCTCCACGGTCTGGCAC
CCAAGCTCCAACGCCAGTACCGCTCTCCACGGCGCAAGTCAGCAGGCAGCATCCCACTGTCACCACTGGCCCACACCCCTTCTCCCCCAC
CCCCAACAGCTTCACCTCAGCGGTCCCCATCGCCCCTGTCTGGCCATGTAGCCCAGGCCTTTCCCACAAAGCTTCACTTGTCACCTCCCC
TGGGCAGGCAACTCTCACGGCCCAAGAGTGCGGAGCCACCCCGTTCACCACTACTCAAGAGGGTGCAGTCGGCTGAGAAACTGGCAGCAG
CACTTGCCGCCTCTGAGAAGAAGCTAGCCACTTCTCGCAAGCACAGCCTTGACCTGCCCCACTCTGAACTAAAGAAGGAACTGCCGCCCA
GGGAAGTGAGCCCTCTGGAGGTAGTTGGAGCCAGGAGTGTGCTGTCTGGCAAGGGGGCCCTGCCAGGGAAGGGGGTGCTGCAGCCTGCTC
CCTCACGGGCCCTAGGCACCCTCCGGCAGGACCGAGCCGAACGACGGGAGTCGCTGCAGAAGCAAGAAGCCATTCGTGAGGTGGACTCCT
CAGAGGACGACACCGAGGAAGGGCCTGAGAACAGCCAGGGTGCACAGGAGCTGAGCTTGGCACCTCACCCAGAAGTGAGCCAGAGTGTGG
CCCCTAAAGGAGCAGGAGAGAGTGGGGAAGAGGATCCTTTCCCGTCCAGAGACCCTAGGAGCCTGGGCCCAATGGTCCCAAGCCTATTGA
CAGGGATCACACTGGGGCCTCCCAGAATGGAAAGTCCCAGTGGTCCCCACAGGAGGCTCGGGAGCCCACAAGCCATTGAGGAGGCTGCCA
GCTCCTCCTCAGCAGGCCCCAACCTAGGTCAGTCTGGAGCCACAGACCCCATCCCTCCTGAAGGTTGCTGGAAGGCCCAGCACCTCCACA
CCCAGGCACTAACAGCACTTTCTCCCAGCACTTCGGGACTCACCCCCACCAGCAGTTGCTCTCCTCCCAGCTCCACCTCTGGGAAGCTGA
GCATGTGGTCCTGGAAATCCCTTATTGAGGGCCCAGACAGGGCATCCCCAAGCAGAAAGGCAACCATGGCAGGTGGGCTAGCCAACCTCC
AGGATTTGGAAAACACAACTCCAGCCCAGCCTAAGAACCTGTCTCCCAGGGAGCAGGGGAAGACACAGCCACCTAGTGCCCCCAGACTGG
CCCATCCATCTTATGAGGATCCCAGCCAGGGCTGGCTATGGGAGTCTGAGTGTGCACAAGCAGTGAAAGAGGATCCAGCCCTGAGCATCA
CCCAAGTGCCTGATGCCTCAGGTGACAGAAGGCAGGACGTTCCATGCCGAGGCTGCCCCCTCACCCAGAAGTCTGAGCCCAGCCTCAGGA
GGGGCCAAGAACCAGGGGGCCATCAAAAGCATCGGGATTTGGCATTGGTTCCAGATGAGCTTTTAAAGCAAACATAGCAGTTGTTTGCCA

>In-frame_HOMER1_ENST00000535690_chr5_78808593_-_MAST2_ENST00000372009_chr1_46348036_+_4384nt
GCAAGTTTTCATTGGGCAAAATGGGAAGGAGTTGAGCCTTCCAAGAAGAGGCAGCTTTTGTCGGACAAGTAACCGCAAGAGCTTGATTGT
GACCTCTAGCACATCACCTACACTACCACGGCCACACTCACCACTCCATGGCCACACAGGTAACAGTCCTTTGGACAGCCCCCGGAATTT
CTCTCCAAATGCACCTGCTCACTTTTCTTTTGTTCCTGCCCGTAGGACTGATGGGCGGCGCTGGTCTTTGGCCTCTTTGCCCTCTTCAGG
ATATGGAACTAACACTCCTAGCTCCACTGTCTCATCATCATGCTCCTCACAGGAAAAGCTGCATCAGTTGCCTTTCCAGCCTACAGCTGA
TGAGCTGCACTTTTTGACGAAGCATTTCAGCACAGAGAGCGTACCAGATGAGGAAGGACGGCAGTCCCCAGCCATGCGGCCTCGCTCCCG
GAGCCTCAGTCCCGGACGATCCCCAGTATCCTTTGACAGTGAAATAATAATGATGAATCATGTTTACAAAGAAAGATTCCCAAAGGCTCA
TGAGCGCTCAGAGAGCTCAGAAGTGGCTTTTGTGATGCAGCTGGTGAAAAAGCTGATGATTATCATTGCCCGCCCAGCACGTCTCCTGGA
ATGCCTGGAGTTTGACCCTGAAGAGTTCTACCACCTTTTAGAAGCAGCTGAGGGCCACGCCAAAGAGGGACAAGGGATTAAATGTGACAT
TCCCCGCTACATCGTTAGCCAGCTGGGCCTCACCCGGGATCCCCTAGAAGAAATGGCCCAGTTGAGCAGCTGTGACAGTCCTGACACTCC
AGAGACAGATGATTCTATTGAGGGCCATGGGGCATCTCTGCCATCTAAAAAGACACCCTCTGAAGAGGACTTCGAGACCATTAAGCTCAT
CAGCAATGGCGCCTATGGGGCTGTATTTCTGGTGCGGCACAAGTCCACCCGGCAGCGCTTTGCCATGAAGAAGATCAACAAGCAGAACCT
GATCCTACGGAACCAGATCCAGCAGGCCTTCGTGGAGCGTGACATACTGACTTTCGCTGAGAACCCCTTTGTGGTCAGCATGTTCTGCTC
CTTTGATACCAAGCGCCACTTGTGCATGGTGATGGAGTACGTTGAAGGGGGAGACTGTGCCACTCTGCTGAAGAATATTGGGGCCCTGCC
TGTGGACATGGTGCGTCTATACTTTGCGGAAACTGTGCTGGCCCTGGAGTACTTACACAACTATGGCATCGTGCACCGTGACCTCAAGCC
TGACAACCTCCTAATTACATCCATGGGGCACATCAAGCTCACGGACTTTGGACTGTCCAAAATTGGCCTCATGAGTCTGACAACGAACTT
GTATGAGGGTCATATTGAAAAGGATGCCCGGGAATTCCTGGACAAGCAGGTATGCGGGACCCCAGAATACATTGCGCCTGAGGTGATCCT
GCGCCAGGGCTATGGGAAGCCAGTGGACTGGTGGGCCATGGGCATTATCCTGTATGAGTTCCTGGTGGGCTGCGTCCCTTTTTTTGGAGA
TACTCCGGAGGAGCTCTTTGGGCAGGTGATCAGTGATGAGATTGTGTGGCCTGAGGGTGATGAGGCACTGCCCCCAGACGCCCAGGACCT
CACCTCCAAACTGCTCCACCAGAACCCTCTGGAGAGACTTGGCACAGGCAGTGCCTATGAGGTGAAGCAGCACCCATTCTTTACTGGTCT
GGACTGGACAGGACTTCTCCGCCAGAAGGCTGAATTTATTCCTCAGTTGGAGTCAGAGGATGATACTAGCTATTTTGACACCCGCTCAGA
GCGATACCACCACATGGACTCGGAGGATGAGGAAGAAGTGAGTGAGGATGGCTGCCTTGAGATCCGCCAGTTCTCTTCCTGCTCTCCAAG
GTTCAACAAGGTGTACAGCAGCATGGAGCGGCTCTCACTGCTCGAGGAGCGCCGGACACCACCCCCGACCAAGCGCAGCCTGAGTGAGGA
GAAGGAGGACCATTCAGATGGCCTGGCAGGGCTCAAAGGCCGAGACCGGAGCTGGGTGATTGGCTCCCCTGAGATATTACGGAAGCGGCT
GTCGGTGTCTGAGTCATCCCACACAGAGAGTGACTCAAGCCCTCCAATGACAGTGCGACGCCGCTGCTCAGGCCTCCTGGATGCGCCTCG
GTTCCCGGAGGGCCCTGAGGAGGCCAGCAGCACCCTCAGGAGGCAACCACAGGAGGGTATATGGGTCCTGACACCCCCATCTGGAGAGGG
GGTATCTGGGCCTGTCACTGAACACTCAGGGGAGCAGCGGCCAAAGCTGGATGAGGAAGCTGTTGGCCGGAGCAGTGGTTCCAGTCCAGC
TATGGAGACCCGAGGCCGTGGGACCTCACAGCTGGCTGAGGGAGCCACAGCCAAGGCCATCAGTGACCTGGCTGTGCGTAGGGCCCGCCA
CCGGCTGCTCTCTGGGGACTCAACAGAGAAGCGCACTGCTCGCCCTGTCAACAAAGTGATCAAGTCCGCCTCAGCCACAGCCCTCTCACT
CCTCATTCCTTCGGAACACCACACCTGCTCCCCGTTGGCCAGCCCCATGTCCCCACATTCTCAGTCGTCCAACCCATCATCCCGGGACTC
TTCTCCATATGGCTTCACCCTGCGGGCCATTCGCGTCTACATGGGTGACTCCGATGTCTACACCGTGCACCATATGGTGTGGCACGTGGA
GGATGGAGGTCCGGCCAGTGAGGCAGGGCTTCGTCAAGGTGACCTCATCACCCATGTCAATGGGGAACCTGTGCATGGCCTGGTGCACAC
GGAGGTGGTAGAGCTGATCCTGAAGAGTGGAAACAAGGTGGCCATTTCAACAACTCCCCTGGAGAACACATCCATTAAAGTGGGGCCAGC
TCGGAAGGGCAGCTACAAGGCCAAGATGGCCCGAAGGAGCAAGAGGAGCCGCGGCAAGGATGGGCAAGAAAGCAGAAAAAGGAGCTCCCT
GTTCCGCAAGATCACCAAGCAAGCATCCCTGCTCCACACCAGCCGCAGCCTTTCTTCCCTTAACCGCTCCTTGTCATCAGGGGAGAGTGG
GCCAGGCTCTCCCACACACAGCCACAGCCTTTCCCCCCGATCTCCCACTCAAGGCTACCGGGTGACCCCCGATGCTGTGCATTCAGAACT
CTCACGGCCCAAGAGTGCGGAGCCACCCCGTTCACCACTACTCAAGAGGGTGCAGTCGGCTGAGAAACTGGCAGCAGCACTTGCCGCCTC
TGAGAAGAAGCTAGCCACTTCTCGCAAGCACAGCCTTGACCTGCCCCACTCTGAACTAAAGAAGGAACTGCCGCCCAGGGAAGTGAGCCC
TCTGGAGGTAGTTGGAGCCAGGAGTGTGCTGTCTGGCAAGGGGGCCCTGCCAGGGAAGGGGGTGCTGCAGCCTGCTCCCTCACGGGCCCT
AGGCACCCTCCGGCAGGACCGAGCCGAACGACGGGAGTCGCTGCAGAAGCAAGAAGCCATTCGTGAGGTGGACTCCTCAGAGGACGACAC
CGAGGAAGGGCCTGAGAACAGCCAGGGTGCACAGGAGCTGAGCTTGGCACCTCACCCAGAAGTGAGCCAGAGTGTGGCCCCTAAAGGAGC
AGGAGAGAGTGGGGAAGAGGATCCTTTCCCGTCCAGAGACCCTAGGAGCCTGGGCCCAATGGTCCCAAGCCTATTGACAGGGATCACACT
GGGGCCTCCCAGAATGGAAAGTCCCAGTGGTCCCCACAGGAGGCTCGGGAGCCCACAAGCCATTGAGGAGGCTGCCAGCTCCTCCTCAGC
AGGCCCCAACCTAGGTCAGTCTGGAGCCACAGACCCCATCCCTCCTGAAGGTTGCTGGAAGGCCCAGCACCTCCACACCCAGGCACTAAC
AGCACTTTCTCCCAGCACTTCGGGACTCACCCCCACCAGCAGTTGCTCTCCTCCCAGCTCCACCTCTGGGAAGCTGAGCATGTGGTCCTG
GAAATCCCTTATTGAGGGCCCAGACAGGGCATCCCCAAGCAGAAAGGCAACCATGGCAGGTGGGCTAGCCAACCTCCAGGATTTGGAAAA
CACAACTCCAGCCCAGCCTAAGAACCTGTCTCCCAGGGAGCAGGGGAAGACACAGCCACCTAGTGCCCCCAGACTGGCCCATCCATCTTA
TGAGGATCCCAGCCAGGGCTGGCTATGGGAGTCTGAGTGTGCACAAGCAGTGAAAGAGGATCCAGCCCTGAGCATCACCCAAGTGCCTGA
TGCCTCAGGTGACAGAAGGCAGGACGTTCCATGCCGAGGCTGCCCCCTCACCCAGAAGTCTGAGCCCAGCCTCAGGAGGGGCCAAGAACC

>In-frame_HOMER1_ENST00000535690_chr5_78808593_-_MAST2_ENST00000361297_chr1_46348036_+_5012nt
GCAAGTTTTCATTGGGCAAAATGGGAAGGAGTTGAGCCTTCCAAGAAGAGGCAGCTTTTGTCGGACAAGTAACCGCAAGAGCTTGATTGT
GACCTCTAGCACATCACCTACACTACCACGGCCACACTCACCACTCCATGGCCACACAGGTAACAGTCCTTTGGACAGCCCCCGGAATTT
CTCTCCAAATGCACCTGCTCACTTTTCTTTTGTTCCTGCCCGTAGGACTGATGGGCGGCGCTGGTCTTTGGCCTCTTTGCCCTCTTCAGG
ATATGGAACTAACACTCCTAGCTCCACTGTCTCATCATCATGCTCCTCACAGGAAAAGCTGCATCAGTTGCCTTTCCAGCCTACAGCTGA
TGAGCTGCACTTTTTGACGAAGCATTTCAGCACAGAGAGCGTACCAGATGAGGAAGGACGGCAGTCCCCAGCCATGCGGCCTCGCTCCCG
GAGCCTCAGTCCCGGACGATCCCCAGTATCCTTTGACAGTGAAATAATAATGATGAATCATGTTTACAAAGAAAGATTCCCAAAGGCCAC
CGCACAAATGGAAGAGCGACTAGCAGAGTTTATTTCCTCCAACACTCCAGACAGCGTGCTGCCCTTGGCAGATGGAGCCCTGAGCTTTAT
TCATCATCAGGTGATTGAGATGGCCCGAGACTGCCTGGATAAATCTCGGAGTGGCCTCATTACATCACAATACTTCTACGAACTTCAAGA
TAATTTGGAGAAACTTTTACAAGATGCTCATGAGCGCTCAGAGAGCTCAGAAGTGGCTTTTGTGATGCAGCTGGTGAAAAAGCTGATGAT
TATCATTGCCCGCCCAGCACGTCTCCTGGAATGCCTGGAGTTTGACCCTGAAGAGTTCTACCACCTTTTAGAAGCAGCTGAGGGCCACGC
CAAAGAGGGACAAGGGATTAAATGTGACATTCCCCGCTACATCGTTAGCCAGCTGGGCCTCACCCGGGATCCCCTAGAAGAAATGGCCCA
GTTGAGCAGCTGTGACAGTCCTGACACTCCAGAGACAGATGATTCTATTGAGGGCCATGGGGCATCTCTGCCATCTAAAAAGACACCCTC
TGAAGAGGACTTCGAGACCATTAAGCTCATCAGCAATGGCGCCTATGGGGCTGTATTTCTGGTGCGGCACAAGTCCACCCGGCAGCGCTT
TGCCATGAAGAAGATCAACAAGCAGAACCTGATCCTACGGAACCAGATCCAGCAGGCCTTCGTGGAGCGTGACATACTGACTTTCGCTGA
GAACCCCTTTGTGGTCAGCATGTTCTGCTCCTTTGATACCAAGCGCCACTTGTGCATGGTGATGGAGTACGTTGAAGGGGGAGACTGTGC
CACTCTGCTGAAGAATATTGGGGCCCTGCCTGTGGACATGGTGCGTCTATACTTTGCGGAAACTGTGCTGGCCCTGGAGTACTTACACAA
CTATGGCATCGTGCACCGTGACCTCAAGCCTGACAACCTCCTAATTACATCCATGGGGCACATCAAGCTCACGGACTTTGGACTGTCCAA
AATTGGCCTCATGAGTCTGACAACGAACTTGTATGAGGGTCATATTGAAAAGGATGCCCGGGAATTCCTGGACAAGCAGGTATGCGGGAC
CCCAGAATACATTGCGCCTGAGGTGATCCTGCGCCAGGGCTATGGGAAGCCAGTGGACTGGTGGGCCATGGGCATTATCCTGTATGAGTT
CCTGGTGGGCTGCGTCCCTTTTTTTGGAGATACTCCGGAGGAGCTCTTTGGGCAGGTGATCAGTGATGAGATTGTGTGGCCTGAGGGTGA
TGAGGCACTGCCCCCAGACGCCCAGGACCTCACCTCCAAACTGCTCCACCAGAACCCTCTGGAGAGACTTGGCACAGGCAGTGCCTATGA
GGTGAAGCAGCACCCATTCTTTACTGGTCTGGACTGGACAGGACTTCTCCGCCAGAAGGCTGAATTTATTCCTCAGTTGGAGTCAGAGGA
TGATACTAGCTATTTTGACACCCGCTCAGAGCGATACCACCACATGGACTCGGAGGATGAGGAAGAAGTGAGTGAGGATGGCTGCCTTGA
GATCCGCCAGTTCTCTTCCTGCTCTCCAAGGTTCAACAAGGTGTACAGCAGCATGGAGCGGCTCTCACTGCTCGAGGAGCGCCGGACACC
ACCCCCGACCAAGCGCAGCCTGAGTGAGGAGAAGGAGGACCATTCAGATGGCCTGGCAGGGCTCAAAGGCCGAGACCGGAGCTGGGTGAT
TGGCTCCCCTGAGATATTACGGAAGCGGCTGTCGGTGTCTGAGTCATCCCACACAGAGAGTGACTCAAGCCCTCCAATGACAGTGCGACG
CCGCTGCTCAGGCCTCCTGGATGCGCCTCGGTTCCCGGAGGGCCCTGAGGAGGCCAGCAGCACCCTCAGGAGGCAACCACAGGAGGGTAT
ATGGGTCCTGACACCCCCATCTGGAGAGGGGGTATCTGGGCCTGTCACTGAACACTCAGGGGAGCAGCGGCCAAAGCTGGATGAGGAAGC
TGTTGGCCGGAGCAGTGGTTCCAGTCCAGCTATGGAGACCCGAGGCCGTGGGACCTCACAGCTGGCTGAGGGAGCCACAGCCAAGGCCAT
CAGTGACCTGGCTGTGCGTAGGGCCCGCCACCGGCTGCTCTCTGGGGACTCAACAGAGAAGCGCACTGCTCGCCCTGTCAACAAAGTGAT
CAAGTCCGCCTCAGCCACAGCCCTCTCACTCCTCATTCCTTCGGAACACCACACCTGCTCCCCGTTGGCCAGCCCCATGTCCCCACATTC
TCAGTCGTCCAACCCATCATCCCGGGACTCTTCTCCAAGCAGGGACTTCTTGCCAGCCCTTGGCAGCATGAGGCCTCCCATCATCATCCA
CCGAGCTGGCAAGAAGTATGGCTTCACCCTGCGGGCCATTCGCGTCTACATGGGTGACTCCGATGTCTACACCGTGCACCATATGGTGTG
GCACGTGGAGGATGGAGGTCCGGCCAGTGAGGCAGGGCTTCGTCAAGGTGACCTCATCACCCATGTCAATGGGGAACCTGTGCATGGCCT
GGTGCACACGGAGGTGGTAGAGCTGATCCTGAAGAGTGGAAACAAGGTGGCCATTTCAACAACTCCCCTGGAGAACACATCCATTAAAGT
GGGGCCAGCTCGGAAGGGCAGCTACAAGGCCAAGATGGCCCGAAGGAGCAAGAGGAGCCGCGGCAAGGATGGGCAAGAAAGCAGAAAAAG
GAGCTCCCTGTTCCGCAAGATCACCAAGCAAGCATCCCTGCTCCACACCAGCCGCAGCCTTTCTTCCCTTAACCGCTCCTTGTCATCAGG
GGAGAGTGGGCCAGGCTCTCCCACACACAGCCACAGCCTTTCCCCCCGATCTCCCACTCAAGGCTACCGGGTGACCCCCGATGCTGTGCA
TTCAGTGGGAGGGAATTCATCACAGAGCAGCTCCCCCAGCTCCAGCGTGCCCAGTTCCCCAGCCGGCTCTGGGCACACACGGCCCAGCTC
CCTCCACGGTCTGGCACCCAAGCTCCAACGCCAGTACCGCTCTCCACGGCGCAAGTCAGCAGGCAGCATCCCACTGTCACCACTGGCCCA
CACCCCTTCTCCCCCACCCCCAACAGCTTCACCTCAGCGGTCCCCATCGCCCCTGTCTGGCCATGTAGCCCAGGCCTTTCCCACAAAGCT
TCACTTGTCACCTCCCCTGGGCAGGCAACTCTCACGGCCCAAGAGTGCGGAGCCACCCCGTTCACCACTACTCAAGAGGGTGCAGTCGGC
TGAGAAACTGGCAGCAGCACTTGCCGCCTCTGAGAAGAAGCTAGCCACTTCTCGCAAGCACAGCCTTGACCTGCCCCACTCTGAACTAAA
GAAGGAACTGCCGCCCAGGGAAGTGAGCCCTCTGGAGGTAGTTGGAGCCAGGAGTGTGCTGTCTGGCAAGGGGGCCCTGCCAGGGAAGGG
GGTGCTGCAGCCTGCTCCCTCACGGGCCCTAGGCACCCTCCGGCAGGACCGAGCCGAACGACGGGAGTCGCTGCAGAAGCAAGAAGCCAT
TCGTGAGGTGGACTCCTCAGAGGACGACACCGAGGAAGGGCCTGAGAACAGCCAGGGTGCACAGGAGCTGAGCTTGGCACCTCACCCAGA
AGTGAGCCAGAGTGTGGCCCCTAAAGGAGCAGGAGAGAGTGGGGAAGAGGATCCTTTCCCGTCCAGAGACCCTAGGAGCCTGGGCCCAAT
GGTCCCAAGCCTATTGACAGGGATCACACTGGGGCCTCCCAGAATGGAAAGTCCCAGTGGTCCCCACAGGAGGCTCGGGAGCCCACAAGC
CATTGAGGAGGCTGCCAGCTCCTCCTCAGCAGGCCCCAACCTAGGTCAGTCTGGAGCCACAGACCCCATCCCTCCTGAAGGTTGCTGGAA
GGCCCAGCACCTCCACACCCAGGCACTAACAGCACTTTCTCCCAGCACTTCGGGACTCACCCCCACCAGCAGTTGCTCTCCTCCCAGCTC
CACCTCTGGGAAGCTGAGCATGTGGTCCTGGAAATCCCTTATTGAGGGCCCAGACAGGGCATCCCCAAGCAGAAAGGCAACCATGGCAGG
TGGGCTAGCCAACCTCCAGGATTTGGAAAACACAACTCCAGCCCAGCCTAAGAACCTGTCTCCCAGGGAGCAGGGGAAGACACAGCCACC
TAGTGCCCCCAGACTGGCCCATCCATCTTATGAGGATCCCAGCCAGGGCTGGCTATGGGAGTCTGAGTGTGCACAAGCAGTGAAAGAGGA
TCCAGCCCTGAGCATCACCCAAGTGCCTGATGCCTCAGGTGACAGAAGGCAGGACGTTCCATGCCGAGGCTGCCCCCTCACCCAGAAGTC
TGAGCCCAGCCTCAGGAGGGGCCAAGAACCAGGGGGCCATCAAAAGCATCGGGATTTGGCATTGGTTCCAGATGAGCTTTTAAAGCAAAC

>In-frame_HOMER1_ENST00000508576_chr5_78808593_-_MAST2_ENST00000372009_chr1_46348036_+_4384nt
GCAAGTTTTCATTGGGCAAAATGGGAAGGAGTTGAGCCTTCCAAGAAGAGGCAGCTTTTGTCGGACAAGTAACCGCAAGAGCTTGATTGT
GACCTCTAGCACATCACCTACACTACCACGGCCACACTCACCACTCCATGGCCACACAGGTAACAGTCCTTTGGACAGCCCCCGGAATTT
CTCTCCAAATGCACCTGCTCACTTTTCTTTTGTTCCTGCCCGTAGGACTGATGGGCGGCGCTGGTCTTTGGCCTCTTTGCCCTCTTCAGG
ATATGGAACTAACACTCCTAGCTCCACTGTCTCATCATCATGCTCCTCACAGGAAAAGCTGCATCAGTTGCCTTTCCAGCCTACAGCTGA
TGAGCTGCACTTTTTGACGAAGCATTTCAGCACAGAGAGCGTACCAGATGAGGAAGGACGGCAGTCCCCAGCCATGCGGCCTCGCTCCCG
GAGCCTCAGTCCCGGACGATCCCCAGTATCCTTTGACAGTGAAATAATAATGATGAATCATGTTTACAAAGAAAGATTCCCAAAGGCTCA
TGAGCGCTCAGAGAGCTCAGAAGTGGCTTTTGTGATGCAGCTGGTGAAAAAGCTGATGATTATCATTGCCCGCCCAGCACGTCTCCTGGA
ATGCCTGGAGTTTGACCCTGAAGAGTTCTACCACCTTTTAGAAGCAGCTGAGGGCCACGCCAAAGAGGGACAAGGGATTAAATGTGACAT
TCCCCGCTACATCGTTAGCCAGCTGGGCCTCACCCGGGATCCCCTAGAAGAAATGGCCCAGTTGAGCAGCTGTGACAGTCCTGACACTCC
AGAGACAGATGATTCTATTGAGGGCCATGGGGCATCTCTGCCATCTAAAAAGACACCCTCTGAAGAGGACTTCGAGACCATTAAGCTCAT
CAGCAATGGCGCCTATGGGGCTGTATTTCTGGTGCGGCACAAGTCCACCCGGCAGCGCTTTGCCATGAAGAAGATCAACAAGCAGAACCT
GATCCTACGGAACCAGATCCAGCAGGCCTTCGTGGAGCGTGACATACTGACTTTCGCTGAGAACCCCTTTGTGGTCAGCATGTTCTGCTC
CTTTGATACCAAGCGCCACTTGTGCATGGTGATGGAGTACGTTGAAGGGGGAGACTGTGCCACTCTGCTGAAGAATATTGGGGCCCTGCC
TGTGGACATGGTGCGTCTATACTTTGCGGAAACTGTGCTGGCCCTGGAGTACTTACACAACTATGGCATCGTGCACCGTGACCTCAAGCC
TGACAACCTCCTAATTACATCCATGGGGCACATCAAGCTCACGGACTTTGGACTGTCCAAAATTGGCCTCATGAGTCTGACAACGAACTT
GTATGAGGGTCATATTGAAAAGGATGCCCGGGAATTCCTGGACAAGCAGGTATGCGGGACCCCAGAATACATTGCGCCTGAGGTGATCCT
GCGCCAGGGCTATGGGAAGCCAGTGGACTGGTGGGCCATGGGCATTATCCTGTATGAGTTCCTGGTGGGCTGCGTCCCTTTTTTTGGAGA
TACTCCGGAGGAGCTCTTTGGGCAGGTGATCAGTGATGAGATTGTGTGGCCTGAGGGTGATGAGGCACTGCCCCCAGACGCCCAGGACCT
CACCTCCAAACTGCTCCACCAGAACCCTCTGGAGAGACTTGGCACAGGCAGTGCCTATGAGGTGAAGCAGCACCCATTCTTTACTGGTCT
GGACTGGACAGGACTTCTCCGCCAGAAGGCTGAATTTATTCCTCAGTTGGAGTCAGAGGATGATACTAGCTATTTTGACACCCGCTCAGA
GCGATACCACCACATGGACTCGGAGGATGAGGAAGAAGTGAGTGAGGATGGCTGCCTTGAGATCCGCCAGTTCTCTTCCTGCTCTCCAAG
GTTCAACAAGGTGTACAGCAGCATGGAGCGGCTCTCACTGCTCGAGGAGCGCCGGACACCACCCCCGACCAAGCGCAGCCTGAGTGAGGA
GAAGGAGGACCATTCAGATGGCCTGGCAGGGCTCAAAGGCCGAGACCGGAGCTGGGTGATTGGCTCCCCTGAGATATTACGGAAGCGGCT
GTCGGTGTCTGAGTCATCCCACACAGAGAGTGACTCAAGCCCTCCAATGACAGTGCGACGCCGCTGCTCAGGCCTCCTGGATGCGCCTCG
GTTCCCGGAGGGCCCTGAGGAGGCCAGCAGCACCCTCAGGAGGCAACCACAGGAGGGTATATGGGTCCTGACACCCCCATCTGGAGAGGG
GGTATCTGGGCCTGTCACTGAACACTCAGGGGAGCAGCGGCCAAAGCTGGATGAGGAAGCTGTTGGCCGGAGCAGTGGTTCCAGTCCAGC
TATGGAGACCCGAGGCCGTGGGACCTCACAGCTGGCTGAGGGAGCCACAGCCAAGGCCATCAGTGACCTGGCTGTGCGTAGGGCCCGCCA
CCGGCTGCTCTCTGGGGACTCAACAGAGAAGCGCACTGCTCGCCCTGTCAACAAAGTGATCAAGTCCGCCTCAGCCACAGCCCTCTCACT
CCTCATTCCTTCGGAACACCACACCTGCTCCCCGTTGGCCAGCCCCATGTCCCCACATTCTCAGTCGTCCAACCCATCATCCCGGGACTC
TTCTCCATATGGCTTCACCCTGCGGGCCATTCGCGTCTACATGGGTGACTCCGATGTCTACACCGTGCACCATATGGTGTGGCACGTGGA
GGATGGAGGTCCGGCCAGTGAGGCAGGGCTTCGTCAAGGTGACCTCATCACCCATGTCAATGGGGAACCTGTGCATGGCCTGGTGCACAC
GGAGGTGGTAGAGCTGATCCTGAAGAGTGGAAACAAGGTGGCCATTTCAACAACTCCCCTGGAGAACACATCCATTAAAGTGGGGCCAGC
TCGGAAGGGCAGCTACAAGGCCAAGATGGCCCGAAGGAGCAAGAGGAGCCGCGGCAAGGATGGGCAAGAAAGCAGAAAAAGGAGCTCCCT
GTTCCGCAAGATCACCAAGCAAGCATCCCTGCTCCACACCAGCCGCAGCCTTTCTTCCCTTAACCGCTCCTTGTCATCAGGGGAGAGTGG
GCCAGGCTCTCCCACACACAGCCACAGCCTTTCCCCCCGATCTCCCACTCAAGGCTACCGGGTGACCCCCGATGCTGTGCATTCAGAACT
CTCACGGCCCAAGAGTGCGGAGCCACCCCGTTCACCACTACTCAAGAGGGTGCAGTCGGCTGAGAAACTGGCAGCAGCACTTGCCGCCTC
TGAGAAGAAGCTAGCCACTTCTCGCAAGCACAGCCTTGACCTGCCCCACTCTGAACTAAAGAAGGAACTGCCGCCCAGGGAAGTGAGCCC
TCTGGAGGTAGTTGGAGCCAGGAGTGTGCTGTCTGGCAAGGGGGCCCTGCCAGGGAAGGGGGTGCTGCAGCCTGCTCCCTCACGGGCCCT
AGGCACCCTCCGGCAGGACCGAGCCGAACGACGGGAGTCGCTGCAGAAGCAAGAAGCCATTCGTGAGGTGGACTCCTCAGAGGACGACAC
CGAGGAAGGGCCTGAGAACAGCCAGGGTGCACAGGAGCTGAGCTTGGCACCTCACCCAGAAGTGAGCCAGAGTGTGGCCCCTAAAGGAGC
AGGAGAGAGTGGGGAAGAGGATCCTTTCCCGTCCAGAGACCCTAGGAGCCTGGGCCCAATGGTCCCAAGCCTATTGACAGGGATCACACT
GGGGCCTCCCAGAATGGAAAGTCCCAGTGGTCCCCACAGGAGGCTCGGGAGCCCACAAGCCATTGAGGAGGCTGCCAGCTCCTCCTCAGC
AGGCCCCAACCTAGGTCAGTCTGGAGCCACAGACCCCATCCCTCCTGAAGGTTGCTGGAAGGCCCAGCACCTCCACACCCAGGCACTAAC
AGCACTTTCTCCCAGCACTTCGGGACTCACCCCCACCAGCAGTTGCTCTCCTCCCAGCTCCACCTCTGGGAAGCTGAGCATGTGGTCCTG
GAAATCCCTTATTGAGGGCCCAGACAGGGCATCCCCAAGCAGAAAGGCAACCATGGCAGGTGGGCTAGCCAACCTCCAGGATTTGGAAAA
CACAACTCCAGCCCAGCCTAAGAACCTGTCTCCCAGGGAGCAGGGGAAGACACAGCCACCTAGTGCCCCCAGACTGGCCCATCCATCTTA
TGAGGATCCCAGCCAGGGCTGGCTATGGGAGTCTGAGTGTGCACAAGCAGTGAAAGAGGATCCAGCCCTGAGCATCACCCAAGTGCCTGA
TGCCTCAGGTGACAGAAGGCAGGACGTTCCATGCCGAGGCTGCCCCCTCACCCAGAAGTCTGAGCCCAGCCTCAGGAGGGGCCAAGAACC

>In-frame_HOMER1_ENST00000508576_chr5_78808593_-_MAST2_ENST00000361297_chr1_46348036_+_5012nt
GCAAGTTTTCATTGGGCAAAATGGGAAGGAGTTGAGCCTTCCAAGAAGAGGCAGCTTTTGTCGGACAAGTAACCGCAAGAGCTTGATTGT
GACCTCTAGCACATCACCTACACTACCACGGCCACACTCACCACTCCATGGCCACACAGGTAACAGTCCTTTGGACAGCCCCCGGAATTT
CTCTCCAAATGCACCTGCTCACTTTTCTTTTGTTCCTGCCCGTAGGACTGATGGGCGGCGCTGGTCTTTGGCCTCTTTGCCCTCTTCAGG
ATATGGAACTAACACTCCTAGCTCCACTGTCTCATCATCATGCTCCTCACAGGAAAAGCTGCATCAGTTGCCTTTCCAGCCTACAGCTGA
TGAGCTGCACTTTTTGACGAAGCATTTCAGCACAGAGAGCGTACCAGATGAGGAAGGACGGCAGTCCCCAGCCATGCGGCCTCGCTCCCG
GAGCCTCAGTCCCGGACGATCCCCAGTATCCTTTGACAGTGAAATAATAATGATGAATCATGTTTACAAAGAAAGATTCCCAAAGGCCAC
CGCACAAATGGAAGAGCGACTAGCAGAGTTTATTTCCTCCAACACTCCAGACAGCGTGCTGCCCTTGGCAGATGGAGCCCTGAGCTTTAT
TCATCATCAGGTGATTGAGATGGCCCGAGACTGCCTGGATAAATCTCGGAGTGGCCTCATTACATCACAATACTTCTACGAACTTCAAGA
TAATTTGGAGAAACTTTTACAAGATGCTCATGAGCGCTCAGAGAGCTCAGAAGTGGCTTTTGTGATGCAGCTGGTGAAAAAGCTGATGAT
TATCATTGCCCGCCCAGCACGTCTCCTGGAATGCCTGGAGTTTGACCCTGAAGAGTTCTACCACCTTTTAGAAGCAGCTGAGGGCCACGC
CAAAGAGGGACAAGGGATTAAATGTGACATTCCCCGCTACATCGTTAGCCAGCTGGGCCTCACCCGGGATCCCCTAGAAGAAATGGCCCA
GTTGAGCAGCTGTGACAGTCCTGACACTCCAGAGACAGATGATTCTATTGAGGGCCATGGGGCATCTCTGCCATCTAAAAAGACACCCTC
TGAAGAGGACTTCGAGACCATTAAGCTCATCAGCAATGGCGCCTATGGGGCTGTATTTCTGGTGCGGCACAAGTCCACCCGGCAGCGCTT
TGCCATGAAGAAGATCAACAAGCAGAACCTGATCCTACGGAACCAGATCCAGCAGGCCTTCGTGGAGCGTGACATACTGACTTTCGCTGA
GAACCCCTTTGTGGTCAGCATGTTCTGCTCCTTTGATACCAAGCGCCACTTGTGCATGGTGATGGAGTACGTTGAAGGGGGAGACTGTGC
CACTCTGCTGAAGAATATTGGGGCCCTGCCTGTGGACATGGTGCGTCTATACTTTGCGGAAACTGTGCTGGCCCTGGAGTACTTACACAA
CTATGGCATCGTGCACCGTGACCTCAAGCCTGACAACCTCCTAATTACATCCATGGGGCACATCAAGCTCACGGACTTTGGACTGTCCAA
AATTGGCCTCATGAGTCTGACAACGAACTTGTATGAGGGTCATATTGAAAAGGATGCCCGGGAATTCCTGGACAAGCAGGTATGCGGGAC
CCCAGAATACATTGCGCCTGAGGTGATCCTGCGCCAGGGCTATGGGAAGCCAGTGGACTGGTGGGCCATGGGCATTATCCTGTATGAGTT
CCTGGTGGGCTGCGTCCCTTTTTTTGGAGATACTCCGGAGGAGCTCTTTGGGCAGGTGATCAGTGATGAGATTGTGTGGCCTGAGGGTGA
TGAGGCACTGCCCCCAGACGCCCAGGACCTCACCTCCAAACTGCTCCACCAGAACCCTCTGGAGAGACTTGGCACAGGCAGTGCCTATGA
GGTGAAGCAGCACCCATTCTTTACTGGTCTGGACTGGACAGGACTTCTCCGCCAGAAGGCTGAATTTATTCCTCAGTTGGAGTCAGAGGA
TGATACTAGCTATTTTGACACCCGCTCAGAGCGATACCACCACATGGACTCGGAGGATGAGGAAGAAGTGAGTGAGGATGGCTGCCTTGA
GATCCGCCAGTTCTCTTCCTGCTCTCCAAGGTTCAACAAGGTGTACAGCAGCATGGAGCGGCTCTCACTGCTCGAGGAGCGCCGGACACC
ACCCCCGACCAAGCGCAGCCTGAGTGAGGAGAAGGAGGACCATTCAGATGGCCTGGCAGGGCTCAAAGGCCGAGACCGGAGCTGGGTGAT
TGGCTCCCCTGAGATATTACGGAAGCGGCTGTCGGTGTCTGAGTCATCCCACACAGAGAGTGACTCAAGCCCTCCAATGACAGTGCGACG
CCGCTGCTCAGGCCTCCTGGATGCGCCTCGGTTCCCGGAGGGCCCTGAGGAGGCCAGCAGCACCCTCAGGAGGCAACCACAGGAGGGTAT
ATGGGTCCTGACACCCCCATCTGGAGAGGGGGTATCTGGGCCTGTCACTGAACACTCAGGGGAGCAGCGGCCAAAGCTGGATGAGGAAGC
TGTTGGCCGGAGCAGTGGTTCCAGTCCAGCTATGGAGACCCGAGGCCGTGGGACCTCACAGCTGGCTGAGGGAGCCACAGCCAAGGCCAT
CAGTGACCTGGCTGTGCGTAGGGCCCGCCACCGGCTGCTCTCTGGGGACTCAACAGAGAAGCGCACTGCTCGCCCTGTCAACAAAGTGAT
CAAGTCCGCCTCAGCCACAGCCCTCTCACTCCTCATTCCTTCGGAACACCACACCTGCTCCCCGTTGGCCAGCCCCATGTCCCCACATTC
TCAGTCGTCCAACCCATCATCCCGGGACTCTTCTCCAAGCAGGGACTTCTTGCCAGCCCTTGGCAGCATGAGGCCTCCCATCATCATCCA
CCGAGCTGGCAAGAAGTATGGCTTCACCCTGCGGGCCATTCGCGTCTACATGGGTGACTCCGATGTCTACACCGTGCACCATATGGTGTG
GCACGTGGAGGATGGAGGTCCGGCCAGTGAGGCAGGGCTTCGTCAAGGTGACCTCATCACCCATGTCAATGGGGAACCTGTGCATGGCCT
GGTGCACACGGAGGTGGTAGAGCTGATCCTGAAGAGTGGAAACAAGGTGGCCATTTCAACAACTCCCCTGGAGAACACATCCATTAAAGT
GGGGCCAGCTCGGAAGGGCAGCTACAAGGCCAAGATGGCCCGAAGGAGCAAGAGGAGCCGCGGCAAGGATGGGCAAGAAAGCAGAAAAAG
GAGCTCCCTGTTCCGCAAGATCACCAAGCAAGCATCCCTGCTCCACACCAGCCGCAGCCTTTCTTCCCTTAACCGCTCCTTGTCATCAGG
GGAGAGTGGGCCAGGCTCTCCCACACACAGCCACAGCCTTTCCCCCCGATCTCCCACTCAAGGCTACCGGGTGACCCCCGATGCTGTGCA
TTCAGTGGGAGGGAATTCATCACAGAGCAGCTCCCCCAGCTCCAGCGTGCCCAGTTCCCCAGCCGGCTCTGGGCACACACGGCCCAGCTC
CCTCCACGGTCTGGCACCCAAGCTCCAACGCCAGTACCGCTCTCCACGGCGCAAGTCAGCAGGCAGCATCCCACTGTCACCACTGGCCCA
CACCCCTTCTCCCCCACCCCCAACAGCTTCACCTCAGCGGTCCCCATCGCCCCTGTCTGGCCATGTAGCCCAGGCCTTTCCCACAAAGCT
TCACTTGTCACCTCCCCTGGGCAGGCAACTCTCACGGCCCAAGAGTGCGGAGCCACCCCGTTCACCACTACTCAAGAGGGTGCAGTCGGC
TGAGAAACTGGCAGCAGCACTTGCCGCCTCTGAGAAGAAGCTAGCCACTTCTCGCAAGCACAGCCTTGACCTGCCCCACTCTGAACTAAA
GAAGGAACTGCCGCCCAGGGAAGTGAGCCCTCTGGAGGTAGTTGGAGCCAGGAGTGTGCTGTCTGGCAAGGGGGCCCTGCCAGGGAAGGG
GGTGCTGCAGCCTGCTCCCTCACGGGCCCTAGGCACCCTCCGGCAGGACCGAGCCGAACGACGGGAGTCGCTGCAGAAGCAAGAAGCCAT
TCGTGAGGTGGACTCCTCAGAGGACGACACCGAGGAAGGGCCTGAGAACAGCCAGGGTGCACAGGAGCTGAGCTTGGCACCTCACCCAGA
AGTGAGCCAGAGTGTGGCCCCTAAAGGAGCAGGAGAGAGTGGGGAAGAGGATCCTTTCCCGTCCAGAGACCCTAGGAGCCTGGGCCCAAT
GGTCCCAAGCCTATTGACAGGGATCACACTGGGGCCTCCCAGAATGGAAAGTCCCAGTGGTCCCCACAGGAGGCTCGGGAGCCCACAAGC
CATTGAGGAGGCTGCCAGCTCCTCCTCAGCAGGCCCCAACCTAGGTCAGTCTGGAGCCACAGACCCCATCCCTCCTGAAGGTTGCTGGAA
GGCCCAGCACCTCCACACCCAGGCACTAACAGCACTTTCTCCCAGCACTTCGGGACTCACCCCCACCAGCAGTTGCTCTCCTCCCAGCTC
CACCTCTGGGAAGCTGAGCATGTGGTCCTGGAAATCCCTTATTGAGGGCCCAGACAGGGCATCCCCAAGCAGAAAGGCAACCATGGCAGG
TGGGCTAGCCAACCTCCAGGATTTGGAAAACACAACTCCAGCCCAGCCTAAGAACCTGTCTCCCAGGGAGCAGGGGAAGACACAGCCACC
TAGTGCCCCCAGACTGGCCCATCCATCTTATGAGGATCCCAGCCAGGGCTGGCTATGGGAGTCTGAGTGTGCACAAGCAGTGAAAGAGGA
TCCAGCCCTGAGCATCACCCAAGTGCCTGATGCCTCAGGTGACAGAAGGCAGGACGTTCCATGCCGAGGCTGCCCCCTCACCCAGAAGTC
TGAGCCCAGCCTCAGGAGGGGCCAAGAACCAGGGGGCCATCAAAAGCATCGGGATTTGGCATTGGTTCCAGATGAGCTTTTAAAGCAAAC

>In-frame_HOMER1_ENST00000282260_chr5_78808593_-_MAST2_ENST00000372009_chr1_46348036_+_4384nt
GCAAGTTTTCATTGGGCAAAATGGGAAGGAGTTGAGCCTTCCAAGAAGAGGCAGCTTTTGTCGGACAAGTAACCGCAAGAGCTTGATTGT
GACCTCTAGCACATCACCTACACTACCACGGCCACACTCACCACTCCATGGCCACACAGGTAACAGTCCTTTGGACAGCCCCCGGAATTT
CTCTCCAAATGCACCTGCTCACTTTTCTTTTGTTCCTGCCCGTAGGACTGATGGGCGGCGCTGGTCTTTGGCCTCTTTGCCCTCTTCAGG
ATATGGAACTAACACTCCTAGCTCCACTGTCTCATCATCATGCTCCTCACAGGAAAAGCTGCATCAGTTGCCTTTCCAGCCTACAGCTGA
TGAGCTGCACTTTTTGACGAAGCATTTCAGCACAGAGAGCGTACCAGATGAGGAAGGACGGCAGTCCCCAGCCATGCGGCCTCGCTCCCG
GAGCCTCAGTCCCGGACGATCCCCAGTATCCTTTGACAGTGAAATAATAATGATGAATCATGTTTACAAAGAAAGATTCCCAAAGGCTCA
TGAGCGCTCAGAGAGCTCAGAAGTGGCTTTTGTGATGCAGCTGGTGAAAAAGCTGATGATTATCATTGCCCGCCCAGCACGTCTCCTGGA
ATGCCTGGAGTTTGACCCTGAAGAGTTCTACCACCTTTTAGAAGCAGCTGAGGGCCACGCCAAAGAGGGACAAGGGATTAAATGTGACAT
TCCCCGCTACATCGTTAGCCAGCTGGGCCTCACCCGGGATCCCCTAGAAGAAATGGCCCAGTTGAGCAGCTGTGACAGTCCTGACACTCC
AGAGACAGATGATTCTATTGAGGGCCATGGGGCATCTCTGCCATCTAAAAAGACACCCTCTGAAGAGGACTTCGAGACCATTAAGCTCAT
CAGCAATGGCGCCTATGGGGCTGTATTTCTGGTGCGGCACAAGTCCACCCGGCAGCGCTTTGCCATGAAGAAGATCAACAAGCAGAACCT
GATCCTACGGAACCAGATCCAGCAGGCCTTCGTGGAGCGTGACATACTGACTTTCGCTGAGAACCCCTTTGTGGTCAGCATGTTCTGCTC
CTTTGATACCAAGCGCCACTTGTGCATGGTGATGGAGTACGTTGAAGGGGGAGACTGTGCCACTCTGCTGAAGAATATTGGGGCCCTGCC
TGTGGACATGGTGCGTCTATACTTTGCGGAAACTGTGCTGGCCCTGGAGTACTTACACAACTATGGCATCGTGCACCGTGACCTCAAGCC
TGACAACCTCCTAATTACATCCATGGGGCACATCAAGCTCACGGACTTTGGACTGTCCAAAATTGGCCTCATGAGTCTGACAACGAACTT
GTATGAGGGTCATATTGAAAAGGATGCCCGGGAATTCCTGGACAAGCAGGTATGCGGGACCCCAGAATACATTGCGCCTGAGGTGATCCT
GCGCCAGGGCTATGGGAAGCCAGTGGACTGGTGGGCCATGGGCATTATCCTGTATGAGTTCCTGGTGGGCTGCGTCCCTTTTTTTGGAGA
TACTCCGGAGGAGCTCTTTGGGCAGGTGATCAGTGATGAGATTGTGTGGCCTGAGGGTGATGAGGCACTGCCCCCAGACGCCCAGGACCT
CACCTCCAAACTGCTCCACCAGAACCCTCTGGAGAGACTTGGCACAGGCAGTGCCTATGAGGTGAAGCAGCACCCATTCTTTACTGGTCT
GGACTGGACAGGACTTCTCCGCCAGAAGGCTGAATTTATTCCTCAGTTGGAGTCAGAGGATGATACTAGCTATTTTGACACCCGCTCAGA
GCGATACCACCACATGGACTCGGAGGATGAGGAAGAAGTGAGTGAGGATGGCTGCCTTGAGATCCGCCAGTTCTCTTCCTGCTCTCCAAG
GTTCAACAAGGTGTACAGCAGCATGGAGCGGCTCTCACTGCTCGAGGAGCGCCGGACACCACCCCCGACCAAGCGCAGCCTGAGTGAGGA
GAAGGAGGACCATTCAGATGGCCTGGCAGGGCTCAAAGGCCGAGACCGGAGCTGGGTGATTGGCTCCCCTGAGATATTACGGAAGCGGCT
GTCGGTGTCTGAGTCATCCCACACAGAGAGTGACTCAAGCCCTCCAATGACAGTGCGACGCCGCTGCTCAGGCCTCCTGGATGCGCCTCG
GTTCCCGGAGGGCCCTGAGGAGGCCAGCAGCACCCTCAGGAGGCAACCACAGGAGGGTATATGGGTCCTGACACCCCCATCTGGAGAGGG
GGTATCTGGGCCTGTCACTGAACACTCAGGGGAGCAGCGGCCAAAGCTGGATGAGGAAGCTGTTGGCCGGAGCAGTGGTTCCAGTCCAGC
TATGGAGACCCGAGGCCGTGGGACCTCACAGCTGGCTGAGGGAGCCACAGCCAAGGCCATCAGTGACCTGGCTGTGCGTAGGGCCCGCCA
CCGGCTGCTCTCTGGGGACTCAACAGAGAAGCGCACTGCTCGCCCTGTCAACAAAGTGATCAAGTCCGCCTCAGCCACAGCCCTCTCACT
CCTCATTCCTTCGGAACACCACACCTGCTCCCCGTTGGCCAGCCCCATGTCCCCACATTCTCAGTCGTCCAACCCATCATCCCGGGACTC
TTCTCCATATGGCTTCACCCTGCGGGCCATTCGCGTCTACATGGGTGACTCCGATGTCTACACCGTGCACCATATGGTGTGGCACGTGGA
GGATGGAGGTCCGGCCAGTGAGGCAGGGCTTCGTCAAGGTGACCTCATCACCCATGTCAATGGGGAACCTGTGCATGGCCTGGTGCACAC
GGAGGTGGTAGAGCTGATCCTGAAGAGTGGAAACAAGGTGGCCATTTCAACAACTCCCCTGGAGAACACATCCATTAAAGTGGGGCCAGC
TCGGAAGGGCAGCTACAAGGCCAAGATGGCCCGAAGGAGCAAGAGGAGCCGCGGCAAGGATGGGCAAGAAAGCAGAAAAAGGAGCTCCCT
GTTCCGCAAGATCACCAAGCAAGCATCCCTGCTCCACACCAGCCGCAGCCTTTCTTCCCTTAACCGCTCCTTGTCATCAGGGGAGAGTGG
GCCAGGCTCTCCCACACACAGCCACAGCCTTTCCCCCCGATCTCCCACTCAAGGCTACCGGGTGACCCCCGATGCTGTGCATTCAGAACT
CTCACGGCCCAAGAGTGCGGAGCCACCCCGTTCACCACTACTCAAGAGGGTGCAGTCGGCTGAGAAACTGGCAGCAGCACTTGCCGCCTC
TGAGAAGAAGCTAGCCACTTCTCGCAAGCACAGCCTTGACCTGCCCCACTCTGAACTAAAGAAGGAACTGCCGCCCAGGGAAGTGAGCCC
TCTGGAGGTAGTTGGAGCCAGGAGTGTGCTGTCTGGCAAGGGGGCCCTGCCAGGGAAGGGGGTGCTGCAGCCTGCTCCCTCACGGGCCCT
AGGCACCCTCCGGCAGGACCGAGCCGAACGACGGGAGTCGCTGCAGAAGCAAGAAGCCATTCGTGAGGTGGACTCCTCAGAGGACGACAC
CGAGGAAGGGCCTGAGAACAGCCAGGGTGCACAGGAGCTGAGCTTGGCACCTCACCCAGAAGTGAGCCAGAGTGTGGCCCCTAAAGGAGC
AGGAGAGAGTGGGGAAGAGGATCCTTTCCCGTCCAGAGACCCTAGGAGCCTGGGCCCAATGGTCCCAAGCCTATTGACAGGGATCACACT
GGGGCCTCCCAGAATGGAAAGTCCCAGTGGTCCCCACAGGAGGCTCGGGAGCCCACAAGCCATTGAGGAGGCTGCCAGCTCCTCCTCAGC
AGGCCCCAACCTAGGTCAGTCTGGAGCCACAGACCCCATCCCTCCTGAAGGTTGCTGGAAGGCCCAGCACCTCCACACCCAGGCACTAAC
AGCACTTTCTCCCAGCACTTCGGGACTCACCCCCACCAGCAGTTGCTCTCCTCCCAGCTCCACCTCTGGGAAGCTGAGCATGTGGTCCTG
GAAATCCCTTATTGAGGGCCCAGACAGGGCATCCCCAAGCAGAAAGGCAACCATGGCAGGTGGGCTAGCCAACCTCCAGGATTTGGAAAA
CACAACTCCAGCCCAGCCTAAGAACCTGTCTCCCAGGGAGCAGGGGAAGACACAGCCACCTAGTGCCCCCAGACTGGCCCATCCATCTTA
TGAGGATCCCAGCCAGGGCTGGCTATGGGAGTCTGAGTGTGCACAAGCAGTGAAAGAGGATCCAGCCCTGAGCATCACCCAAGTGCCTGA
TGCCTCAGGTGACAGAAGGCAGGACGTTCCATGCCGAGGCTGCCCCCTCACCCAGAAGTCTGAGCCCAGCCTCAGGAGGGGCCAAGAACC

>In-frame_HOMER1_ENST00000282260_chr5_78808593_-_MAST2_ENST00000361297_chr1_46348036_+_5012nt
GCAAGTTTTCATTGGGCAAAATGGGAAGGAGTTGAGCCTTCCAAGAAGAGGCAGCTTTTGTCGGACAAGTAACCGCAAGAGCTTGATTGT
GACCTCTAGCACATCACCTACACTACCACGGCCACACTCACCACTCCATGGCCACACAGGTAACAGTCCTTTGGACAGCCCCCGGAATTT
CTCTCCAAATGCACCTGCTCACTTTTCTTTTGTTCCTGCCCGTAGGACTGATGGGCGGCGCTGGTCTTTGGCCTCTTTGCCCTCTTCAGG
ATATGGAACTAACACTCCTAGCTCCACTGTCTCATCATCATGCTCCTCACAGGAAAAGCTGCATCAGTTGCCTTTCCAGCCTACAGCTGA
TGAGCTGCACTTTTTGACGAAGCATTTCAGCACAGAGAGCGTACCAGATGAGGAAGGACGGCAGTCCCCAGCCATGCGGCCTCGCTCCCG
GAGCCTCAGTCCCGGACGATCCCCAGTATCCTTTGACAGTGAAATAATAATGATGAATCATGTTTACAAAGAAAGATTCCCAAAGGCCAC
CGCACAAATGGAAGAGCGACTAGCAGAGTTTATTTCCTCCAACACTCCAGACAGCGTGCTGCCCTTGGCAGATGGAGCCCTGAGCTTTAT
TCATCATCAGGTGATTGAGATGGCCCGAGACTGCCTGGATAAATCTCGGAGTGGCCTCATTACATCACAATACTTCTACGAACTTCAAGA
TAATTTGGAGAAACTTTTACAAGATGCTCATGAGCGCTCAGAGAGCTCAGAAGTGGCTTTTGTGATGCAGCTGGTGAAAAAGCTGATGAT
TATCATTGCCCGCCCAGCACGTCTCCTGGAATGCCTGGAGTTTGACCCTGAAGAGTTCTACCACCTTTTAGAAGCAGCTGAGGGCCACGC
CAAAGAGGGACAAGGGATTAAATGTGACATTCCCCGCTACATCGTTAGCCAGCTGGGCCTCACCCGGGATCCCCTAGAAGAAATGGCCCA
GTTGAGCAGCTGTGACAGTCCTGACACTCCAGAGACAGATGATTCTATTGAGGGCCATGGGGCATCTCTGCCATCTAAAAAGACACCCTC
TGAAGAGGACTTCGAGACCATTAAGCTCATCAGCAATGGCGCCTATGGGGCTGTATTTCTGGTGCGGCACAAGTCCACCCGGCAGCGCTT
TGCCATGAAGAAGATCAACAAGCAGAACCTGATCCTACGGAACCAGATCCAGCAGGCCTTCGTGGAGCGTGACATACTGACTTTCGCTGA
GAACCCCTTTGTGGTCAGCATGTTCTGCTCCTTTGATACCAAGCGCCACTTGTGCATGGTGATGGAGTACGTTGAAGGGGGAGACTGTGC
CACTCTGCTGAAGAATATTGGGGCCCTGCCTGTGGACATGGTGCGTCTATACTTTGCGGAAACTGTGCTGGCCCTGGAGTACTTACACAA
CTATGGCATCGTGCACCGTGACCTCAAGCCTGACAACCTCCTAATTACATCCATGGGGCACATCAAGCTCACGGACTTTGGACTGTCCAA
AATTGGCCTCATGAGTCTGACAACGAACTTGTATGAGGGTCATATTGAAAAGGATGCCCGGGAATTCCTGGACAAGCAGGTATGCGGGAC
CCCAGAATACATTGCGCCTGAGGTGATCCTGCGCCAGGGCTATGGGAAGCCAGTGGACTGGTGGGCCATGGGCATTATCCTGTATGAGTT
CCTGGTGGGCTGCGTCCCTTTTTTTGGAGATACTCCGGAGGAGCTCTTTGGGCAGGTGATCAGTGATGAGATTGTGTGGCCTGAGGGTGA
TGAGGCACTGCCCCCAGACGCCCAGGACCTCACCTCCAAACTGCTCCACCAGAACCCTCTGGAGAGACTTGGCACAGGCAGTGCCTATGA
GGTGAAGCAGCACCCATTCTTTACTGGTCTGGACTGGACAGGACTTCTCCGCCAGAAGGCTGAATTTATTCCTCAGTTGGAGTCAGAGGA
TGATACTAGCTATTTTGACACCCGCTCAGAGCGATACCACCACATGGACTCGGAGGATGAGGAAGAAGTGAGTGAGGATGGCTGCCTTGA
GATCCGCCAGTTCTCTTCCTGCTCTCCAAGGTTCAACAAGGTGTACAGCAGCATGGAGCGGCTCTCACTGCTCGAGGAGCGCCGGACACC
ACCCCCGACCAAGCGCAGCCTGAGTGAGGAGAAGGAGGACCATTCAGATGGCCTGGCAGGGCTCAAAGGCCGAGACCGGAGCTGGGTGAT
TGGCTCCCCTGAGATATTACGGAAGCGGCTGTCGGTGTCTGAGTCATCCCACACAGAGAGTGACTCAAGCCCTCCAATGACAGTGCGACG
CCGCTGCTCAGGCCTCCTGGATGCGCCTCGGTTCCCGGAGGGCCCTGAGGAGGCCAGCAGCACCCTCAGGAGGCAACCACAGGAGGGTAT
ATGGGTCCTGACACCCCCATCTGGAGAGGGGGTATCTGGGCCTGTCACTGAACACTCAGGGGAGCAGCGGCCAAAGCTGGATGAGGAAGC
TGTTGGCCGGAGCAGTGGTTCCAGTCCAGCTATGGAGACCCGAGGCCGTGGGACCTCACAGCTGGCTGAGGGAGCCACAGCCAAGGCCAT
CAGTGACCTGGCTGTGCGTAGGGCCCGCCACCGGCTGCTCTCTGGGGACTCAACAGAGAAGCGCACTGCTCGCCCTGTCAACAAAGTGAT
CAAGTCCGCCTCAGCCACAGCCCTCTCACTCCTCATTCCTTCGGAACACCACACCTGCTCCCCGTTGGCCAGCCCCATGTCCCCACATTC
TCAGTCGTCCAACCCATCATCCCGGGACTCTTCTCCAAGCAGGGACTTCTTGCCAGCCCTTGGCAGCATGAGGCCTCCCATCATCATCCA
CCGAGCTGGCAAGAAGTATGGCTTCACCCTGCGGGCCATTCGCGTCTACATGGGTGACTCCGATGTCTACACCGTGCACCATATGGTGTG
GCACGTGGAGGATGGAGGTCCGGCCAGTGAGGCAGGGCTTCGTCAAGGTGACCTCATCACCCATGTCAATGGGGAACCTGTGCATGGCCT
GGTGCACACGGAGGTGGTAGAGCTGATCCTGAAGAGTGGAAACAAGGTGGCCATTTCAACAACTCCCCTGGAGAACACATCCATTAAAGT
GGGGCCAGCTCGGAAGGGCAGCTACAAGGCCAAGATGGCCCGAAGGAGCAAGAGGAGCCGCGGCAAGGATGGGCAAGAAAGCAGAAAAAG
GAGCTCCCTGTTCCGCAAGATCACCAAGCAAGCATCCCTGCTCCACACCAGCCGCAGCCTTTCTTCCCTTAACCGCTCCTTGTCATCAGG
GGAGAGTGGGCCAGGCTCTCCCACACACAGCCACAGCCTTTCCCCCCGATCTCCCACTCAAGGCTACCGGGTGACCCCCGATGCTGTGCA
TTCAGTGGGAGGGAATTCATCACAGAGCAGCTCCCCCAGCTCCAGCGTGCCCAGTTCCCCAGCCGGCTCTGGGCACACACGGCCCAGCTC
CCTCCACGGTCTGGCACCCAAGCTCCAACGCCAGTACCGCTCTCCACGGCGCAAGTCAGCAGGCAGCATCCCACTGTCACCACTGGCCCA
CACCCCTTCTCCCCCACCCCCAACAGCTTCACCTCAGCGGTCCCCATCGCCCCTGTCTGGCCATGTAGCCCAGGCCTTTCCCACAAAGCT
TCACTTGTCACCTCCCCTGGGCAGGCAACTCTCACGGCCCAAGAGTGCGGAGCCACCCCGTTCACCACTACTCAAGAGGGTGCAGTCGGC
TGAGAAACTGGCAGCAGCACTTGCCGCCTCTGAGAAGAAGCTAGCCACTTCTCGCAAGCACAGCCTTGACCTGCCCCACTCTGAACTAAA
GAAGGAACTGCCGCCCAGGGAAGTGAGCCCTCTGGAGGTAGTTGGAGCCAGGAGTGTGCTGTCTGGCAAGGGGGCCCTGCCAGGGAAGGG
GGTGCTGCAGCCTGCTCCCTCACGGGCCCTAGGCACCCTCCGGCAGGACCGAGCCGAACGACGGGAGTCGCTGCAGAAGCAAGAAGCCAT
TCGTGAGGTGGACTCCTCAGAGGACGACACCGAGGAAGGGCCTGAGAACAGCCAGGGTGCACAGGAGCTGAGCTTGGCACCTCACCCAGA
AGTGAGCCAGAGTGTGGCCCCTAAAGGAGCAGGAGAGAGTGGGGAAGAGGATCCTTTCCCGTCCAGAGACCCTAGGAGCCTGGGCCCAAT
GGTCCCAAGCCTATTGACAGGGATCACACTGGGGCCTCCCAGAATGGAAAGTCCCAGTGGTCCCCACAGGAGGCTCGGGAGCCCACAAGC
CATTGAGGAGGCTGCCAGCTCCTCCTCAGCAGGCCCCAACCTAGGTCAGTCTGGAGCCACAGACCCCATCCCTCCTGAAGGTTGCTGGAA
GGCCCAGCACCTCCACACCCAGGCACTAACAGCACTTTCTCCCAGCACTTCGGGACTCACCCCCACCAGCAGTTGCTCTCCTCCCAGCTC
CACCTCTGGGAAGCTGAGCATGTGGTCCTGGAAATCCCTTATTGAGGGCCCAGACAGGGCATCCCCAAGCAGAAAGGCAACCATGGCAGG
TGGGCTAGCCAACCTCCAGGATTTGGAAAACACAACTCCAGCCCAGCCTAAGAACCTGTCTCCCAGGGAGCAGGGGAAGACACAGCCACC
TAGTGCCCCCAGACTGGCCCATCCATCTTATGAGGATCCCAGCCAGGGCTGGCTATGGGAGTCTGAGTGTGCACAAGCAGTGAAAGAGGA
TCCAGCCCTGAGCATCACCCAAGTGCCTGATGCCTCAGGTGACAGAAGGCAGGACGTTCCATGCCGAGGCTGCCCCCTCACCCAGAAGTC
TGAGCCCAGCCTCAGGAGGGGCCAAGAACCAGGGGGCCATCAAAAGCATCGGGATTTGGCATTGGTTCCAGATGAGCTTTTAAAGCAAAC


Top

FusionGenePPI for HOMER1_MAST2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
HOMER1ABI3, C1orf116, AGAP2, TRPC1, TRPC2, TRPC5, RYR2, RYR1, PARK2, HOMER3, C19orf57, CSPP1, TPM1, HOMER2, ACTB, SPTBN4, KIF5C, TP53BP2, EEF1A2, TRAF5, FBXO28, IFT57, GRAMD3, AIMP1, GRM1, GRM5, MED4, DBN1, MIS18A, NUP54, EMILIN1, KIF2B, SYCE3, FRYL, TCP10L, COLEC12, ACTBL2, CEP72, KIF5B, DBNL, HOMER1MAST2CDHR2, GCN1L1, TRAF6, TRAF2, SNTB2, SH3GL2, TK1, SMN1, STK36, RASSF1, LATS1, APP, HSP90AA1, YWHAE, SUMO2, YWHAB, FBXW11, BTRC, SRPK2, GAN, EGFR


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for HOMER1_MAST2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for HOMER1_MAST2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneHOMER1C0036341Schizophrenia4PSYGENET
HgeneHOMER1C0011570Mental Depression3PSYGENET
HgeneHOMER1C0011581Depressive disorder3PSYGENET
HgeneHOMER1C0236736Cocaine-Related Disorders2CTD_human
HgeneHOMER1C0001973Alcoholic Intoxication, Chronic1PSYGENET
HgeneHOMER1C0013386Dyskinesia, Drug-Induced1CTD_human
HgeneHOMER1C0018524Hallucinations1CTD_human
HgeneHOMER1C0041696Unipolar Depression1PSYGENET
HgeneHOMER1C0041755Adverse reaction to drug1CTD_human
HgeneHOMER1C0237123Alcohol or Other Drugs use1PSYGENET
HgeneHOMER1C1269683Major Depressive Disorder1PSYGENET