FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 16607

FusionGeneSummary for HNRNPL_ACTN4

check button Fusion gene summary
Fusion gene informationFusion gene name: HNRNPL_ACTN4
Fusion gene ID: 16607
HgeneTgene
Gene symbol

HNRNPL

ACTN4

Gene ID

3191

81

Gene nameheterogeneous nuclear ribonucleoprotein Lactinin alpha 4
SynonymsHNRPL|P/OKcl.14|hnRNP-LACTININ-4|FSGS|FSGS1
Cytomap

19q13.2

19q13.2

Type of geneprotein-codingprotein-coding
Descriptionheterogeneous nuclear ribonucleoprotein LhnRNP Lalpha-actinin-4focal segmental glomerulosclerosis 1non-muscle alpha-actinin 4
Modification date2018051920180522
UniProtAcc

P14866

O43707

Ensembl transtripts involved in fusion geneENST00000221419, ENST00000600873, 
ENST00000252699, ENST00000424234, 
ENST00000390009, ENST00000497637, 
Fusion gene scores* DoF score9 X 10 X 5=45019 X 14 X 7=1862
# samples 1020
** MAII scorelog2(10/450*10)=-2.16992500144231
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(20/1862*10)=-3.21878116778407
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: HNRNPL [Title/Abstract] AND ACTN4 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneACTN4

GO:0035357

peroxisome proliferator activated receptor signaling pathway

22351778

TgeneACTN4

GO:0048384

retinoic acid receptor signaling pathway

22351778

TgeneACTN4

GO:0051272

positive regulation of cellular component movement

9508771


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVOVTCGA-23-1107-01AHNRNPLchr19

39340340

-ACTN4chr19

39205109

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000221419ENST00000252699HNRNPLchr19

39340340

-ACTN4chr19

39205109

+
5CDS-intronENST00000221419ENST00000424234HNRNPLchr19

39340340

-ACTN4chr19

39205109

+
5CDS-intronENST00000221419ENST00000390009HNRNPLchr19

39340340

-ACTN4chr19

39205109

+
5CDS-intronENST00000221419ENST00000497637HNRNPLchr19

39340340

-ACTN4chr19

39205109

+
intron-3CDSENST00000600873ENST00000252699HNRNPLchr19

39340340

-ACTN4chr19

39205109

+
intron-intronENST00000600873ENST00000424234HNRNPLchr19

39340340

-ACTN4chr19

39205109

+
intron-intronENST00000600873ENST00000390009HNRNPLchr19

39340340

-ACTN4chr19

39205109

+
intron-intronENST00000600873ENST00000497637HNRNPLchr19

39340340

-ACTN4chr19

39205109

+

Top

FusionProtFeatures for HNRNPL_ACTN4


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
HNRNPL

P14866

ACTN4

O43707

Splicing factor binding to exonic or intronic sites andacting as either an activator or repressor of exon inclusion.Exhibits a binding preference for CA-rich elements(PubMed:11809897, PubMed:22570490, PubMed:24164894,PubMed:25623890, PubMed:26051023). Component of the heterogeneousnuclear ribonucleoprotein (hnRNP) complexes and associated withmost nascent transcripts (PubMed:2687284). Associates, togetherwith APEX1, to the negative calcium responsive element (nCaRE) B2of the APEX2 promoter (PubMed:11809897).{ECO:0000269|PubMed:11809897, ECO:0000269|PubMed:22570490,ECO:0000269|PubMed:25623890, ECO:0000269|PubMed:26051023,ECO:0000269|PubMed:2687284}. F-actin cross-linking protein which is thought to anchoractin to a variety of intracellular structures. This is a bundlingprotein (Probable). Probably involved in vesicular trafficking viaits association with the CART complex. The CART complex isnecessary for efficient transferrin receptor recycling but not forEGFR degradation (PubMed:15772161). Involved in tight junctionassembly in epithelial cells probably through interaction withMICALL2. Links MICALL2 to the actin cytoskeleton and recruits itto the tight junctions (By similarity). May also function as atranscriptional coactivator, stimulating transcription mediated bythe nuclear hormone receptors PPARG and RARA (PubMed:22351778).{ECO:0000250|UniProtKB:P57780, ECO:0000269|PubMed:15772161,ECO:0000269|PubMed:22351778, ECO:0000305|PubMed:9508771}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneHNRNPLchr19:39340340chr19:39205109ENST00000221419-11339_8989590Compositional biasNote=Gly-rich
TgeneACTN4chr19:39340340chr19:39205109ENST00000252699+721778_789273912Calcium binding1
TgeneACTN4chr19:39340340chr19:39205109ENST00000252699+721819_830273912Calcium binding2
TgeneACTN4chr19:39340340chr19:39205109ENST00000390009+014778_78954693Calcium binding1
TgeneACTN4chr19:39340340chr19:39205109ENST00000390009+014819_83054693Calcium binding2
TgeneACTN4chr19:39340340chr19:39205109ENST00000252699+721765_800273912DomainEF-hand 1
TgeneACTN4chr19:39340340chr19:39205109ENST00000252699+721806_841273912DomainEF-hand 2
TgeneACTN4chr19:39340340chr19:39205109ENST00000390009+014163_26954693DomainCalponin-homology (CH) 2
TgeneACTN4chr19:39340340chr19:39205109ENST00000390009+014765_80054693DomainEF-hand 1
TgeneACTN4chr19:39340340chr19:39205109ENST00000390009+014806_84154693DomainEF-hand 2
TgeneACTN4chr19:39340340chr19:39205109ENST00000390009+01484_8854693MotifLXXLL motif
TgeneACTN4chr19:39340340chr19:39205109ENST00000390009+014177_19254693RegionPolyphosphoinositide (PIP2)-binding
TgeneACTN4chr19:39340340chr19:39205109ENST00000252699+721293_403273912RepeatSpectrin 1
TgeneACTN4chr19:39340340chr19:39205109ENST00000252699+721413_518273912RepeatSpectrin 2
TgeneACTN4chr19:39340340chr19:39205109ENST00000252699+721528_639273912RepeatSpectrin 3
TgeneACTN4chr19:39340340chr19:39205109ENST00000252699+721649_752273912RepeatSpectrin 4
TgeneACTN4chr19:39340340chr19:39205109ENST00000390009+014293_40354693RepeatSpectrin 1
TgeneACTN4chr19:39340340chr19:39205109ENST00000390009+014413_51854693RepeatSpectrin 2
TgeneACTN4chr19:39340340chr19:39205109ENST00000390009+014528_63954693RepeatSpectrin 3
TgeneACTN4chr19:39340340chr19:39205109ENST00000390009+014649_75254693RepeatSpectrin 4

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneHNRNPLchr19:39340340chr19:39205109ENST00000221419-113335_38289590Compositional biasNote=Pro-rich
HgeneHNRNPLchr19:39340340chr19:39205109ENST00000600873-113335_382-59457Compositional biasNote=Pro-rich
HgeneHNRNPLchr19:39340340chr19:39205109ENST00000600873-11339_89-59457Compositional biasNote=Gly-rich
HgeneHNRNPLchr19:39340340chr19:39205109ENST00000221419-113102_17689590DomainRRM 1
HgeneHNRNPLchr19:39340340chr19:39205109ENST00000221419-113193_27089590DomainRRM 2
HgeneHNRNPLchr19:39340340chr19:39205109ENST00000221419-113382_47889590DomainRRM 3
HgeneHNRNPLchr19:39340340chr19:39205109ENST00000221419-113495_58389590DomainRRM 4
HgeneHNRNPLchr19:39340340chr19:39205109ENST00000600873-113102_176-59457DomainRRM 1
HgeneHNRNPLchr19:39340340chr19:39205109ENST00000600873-113193_270-59457DomainRRM 2
HgeneHNRNPLchr19:39340340chr19:39205109ENST00000600873-113382_478-59457DomainRRM 3
HgeneHNRNPLchr19:39340340chr19:39205109ENST00000600873-113495_583-59457DomainRRM 4
TgeneACTN4chr19:39340340chr19:39205109ENST00000252699+72119_26273912Compositional biasPoly-Gly
TgeneACTN4chr19:39340340chr19:39205109ENST00000390009+01419_2654693Compositional biasPoly-Gly
TgeneACTN4chr19:39340340chr19:39205109ENST00000252699+721163_269273912DomainCalponin-homology (CH) 2
TgeneACTN4chr19:39340340chr19:39205109ENST00000252699+72150_154273912DomainCalponin-homology (CH) 1
TgeneACTN4chr19:39340340chr19:39205109ENST00000390009+01450_15454693DomainCalponin-homology (CH) 1
TgeneACTN4chr19:39340340chr19:39205109ENST00000252699+72184_88273912MotifLXXLL motif
TgeneACTN4chr19:39340340chr19:39205109ENST00000252699+721177_192273912RegionPolyphosphoinositide (PIP2)-binding
TgeneACTN4chr19:39340340chr19:39205109ENST00000252699+7211_269273912RegionNote=Actin-binding
TgeneACTN4chr19:39340340chr19:39205109ENST00000390009+0141_26954693RegionNote=Actin-binding


Top

FusionGeneSequence for HNRNPL_ACTN4


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_HNRNPL_ENST00000221419_chr19_39340340_-_ACTN4_ENST00000252699_chr19_39205109_+_728aa
MSRRLLPRAEKRRRRLEQRQQPDEQRRRSGAMVKMAAAGGGGGGGRYYGGGSEGGRAPKRLKTDNAGDQHGGGGGGGGGAGAAGGGGGGA
ETAANRICKVLAVNQENEHLMEDYEKLASDLLEWIRRTIPWLEDRVPQKTIQEMQQKLEDFRDYRRVHKPPKVQEKCQLEINFNTLQTKL
RLSNRPAFMPSEGKMVSDINNGWQHLEQAEKGYEEWLLNEIRRLERLDHLAEKFRQKASIHEAWTDGKEAMLKHRDYETATLSDIKALIR
KHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSHNVNTRCQKICDQWDALGSLTHSRREALEKTEKQLEAIDQLHLEYAKRAAPFNNWM
ESAMEDLQDMFIVHTIEEIEGLISAHDQFKSTLPDADREREAILAIHKEAQRIAESNHIKLSGSNPYTTVTPQIINSKWEKVQQLVPKRD
HALLEEQSKQQSNEHLRRQFASQANVVGPWIQTKMEEIGRISIEMNGTLEDQLSHLKQTERSIVDYKPNLDLLEQQHQLIQEALIFDNKH
TNTTMEHIRVGWEQLLTTIARTINEVENQILTRDAKGISQEQMQEFRASFNHFDKDHGGALGPEEFKACLISLGYDVENDRQGEAEFNRI
MSLVDPNHSGLVTFQAFIDFMSRETTDTDTADQVIASFKVLAGDKNFITAEELRRELPPDQAEYCIARMAPYQGPDAVPGALDYKSFSTA


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_HNRNPL_ENST00000221419_chr19_39340340_-_ACTN4_ENST00000252699_chr19_39205109_+_2184nt
ATGTCGCGGAGGCTGCTGCCCCGGGCGGAGAAGCGGCGTCGGCGGCTGGAGCAGAGGCAGCAGCCGGACGAGCAGCGGAGGCGGTCGGGA
GCGATGGTGAAGATGGCGGCGGCGGGCGGCGGAGGCGGCGGTGGCCGCTACTACGGCGGCGGCAGTGAGGGCGGCCGGGCCCCTAAGCGG
CTCAAGACTGACAACGCCGGCGACCAGCACGGAGGCGGCGGCGGTGGCGGTGGAGGAGCCGGGGCGGCGGGCGGCGGCGGCGGTGGGGCT
GAAACTGCCGCCAACCGGATCTGTAAGGTGCTGGCTGTCAACCAAGAGAACGAGCACCTGATGGAGGACTACGAGAAGCTGGCCAGCGAC
CTCCTGGAGTGGATCCGGCGCACCATCCCCTGGCTGGAGGACCGTGTGCCCCAAAAGACTATCCAGGAGATGCAGCAGAAGCTGGAGGAC
TTCCGCGACTACCGGCGTGTGCACAAGCCGCCCAAGGTGCAGGAGAAGTGCCAGCTGGAGATCAACTTCAACACGCTGCAGACCAAGCTG
CGCCTCAGCAACCGGCCCGCCTTCATGCCCTCCGAGGGCAAGATGGTCTCGGACATCAACAATGGCTGGCAGCACTTGGAGCAGGCTGAG
AAGGGCTACGAGGAGTGGCTGCTGAATGAGATCCGCAGGCTGGAGCGGCTCGACCACCTGGCAGAGAAGTTCCGGCAGAAGGCCTCCATC
CACGAGGCCTGGACTGACGGGAAGGAAGCCATGCTGAAGCACCGGGACTACGAGACGGCCACACTATCGGACATCAAAGCCCTCATTCGC
AAGCACGAGGCCTTCGAGAGCGACCTGGCTGCGCACCAGGACCGCGTGGAGCAGATCGCCGCCATTGCCCAGGAGCTCAACGAGCTGGAT
TACTACGACTCCCACAATGTCAACACCCGGTGCCAGAAGATCTGTGACCAGTGGGACGCCCTCGGCTCTCTGACACATAGTCGCAGGGAA
GCCCTGGAGAAAACAGAGAAGCAGCTGGAGGCCATCGACCAGCTGCACCTGGAATACGCCAAGCGCGCGGCCCCCTTCAACAACTGGATG
GAGAGCGCCATGGAGGACCTCCAGGACATGTTCATCGTCCATACCATCGAGGAGATTGAGGGCCTGATCTCAGCCCATGACCAGTTCAAG
TCCACCCTGCCGGACGCCGATAGGGAGCGCGAGGCCATCCTGGCCATCCACAAGGAGGCCCAGAGGATCGCTGAGAGCAACCACATCAAG
CTGTCGGGCAGCAACCCCTACACCACCGTCACCCCGCAAATCATCAACTCCAAGTGGGAGAAGGTGCAGCAGCTGGTGCCAAAACGGGAC
CATGCCCTCCTGGAGGAGCAGAGCAAGCAGCAGTCCAACGAGCACCTGCGCCGCCAGTTCGCCAGCCAGGCCAATGTTGTGGGGCCCTGG
ATCCAGACCAAGATGGAGGAGATCGGGCGCATCTCCATTGAGATGAACGGGACCCTGGAGGACCAGCTGAGCCACCTGAAGCAGTATGAA
CGCAGCATCGTGGACTACAAGCCCAACCTGGACCTGCTGGAGCAGCAGCACCAGCTCATCCAGGAGGCCCTCATCTTCGACAACAAGCAC
ACCAACTATACCATGGAGCACATCCGCGTGGGCTGGGAGCAGCTGCTCACCACCATTGCCCGCACCATCAACGAGGTGGAGAACCAGATC
CTCACCCGCGACGCCAAGGGCATCAGCCAGGAGCAGATGCAGGAGTTCCGGGCGTCCTTCAACCACTTCGACAAGGATCATGGCGGGGCG
CTGGGGCCCGAGGAGTTCAAGGCCTGCCTCATCAGCCTGGGCTACGACGTGGAGAACGACCGGCAGGGTGAGGCCGAGTTCAACCGCATC
ATGAGCCTGGTCGACCCCAACCATAGCGGCCTTGTGACCTTCCAAGCCTTCATCGACTTCATGTCGCGGGAGACCACCGACACGGACACG
GCTGACCAGGTCATCGCTTCCTTCAAGGTCTTAGCAGGGGACAAGAACTTCATCACAGCTGAGGAGCTGCGGAGAGAGCTGCCCCCCGAC
CAGGCCGAGTACTGCATCGCCCGCATGGCGCCATACCAGGGCCCTGACGCCGTGCCCGGTGCCCTCGACTACAAGTCCTTCTCCACGGCC


* Fusion transcript sequences (Full-length transcript).
>In-frame_HNRNPL_ENST00000221419_chr19_39340340_-_ACTN4_ENST00000252699_chr19_39205109_+_4702nt
GGAGACCAATGAAAGTGGGAGGGAGGCGGAGATTCTTGGGAGGTTTAGAGCGCCGTTCCTATCAGGTGCTTTTAGGGAGGCCAGCAGCGC
CAGAAATCCGACCTATCAAATTGGATTTTATTTTAAGGCGGCGGGGTCGACGGAAAGACTGGCAGAAAGCGACCACCTATAAGGAGTGTC
TCAGACAAACAAGGGCGGGCCCTCCTGCAGAACGGCGTGGGCAATGTCCAATAAGCGCGCAAGGCGTGTGGCGGCCTACCCTCCCCCCGC
GGCGGGACCAGTGGCTCCCCCTATCGGGTGGGGGCGGCGGGTGACGGGCGTGTCCCTCCCCCAATGAGAGGCGGGGGGAGGCGGGTTCTG
CGCCGCCATGTCGCGGAGGCTGCTGCCCCGGGCGGAGAAGCGGCGTCGGCGGCTGGAGCAGAGGCAGCAGCCGGACGAGCAGCGGAGGCG
GTCGGGAGCGATGGTGAAGATGGCGGCGGCGGGCGGCGGAGGCGGCGGTGGCCGCTACTACGGCGGCGGCAGTGAGGGCGGCCGGGCCCC
TAAGCGGCTCAAGACTGACAACGCCGGCGACCAGCACGGAGGCGGCGGCGGTGGCGGTGGAGGAGCCGGGGCGGCGGGCGGCGGCGGCGG
TGGGGCTGAAACTGCCGCCAACCGGATCTGTAAGGTGCTGGCTGTCAACCAAGAGAACGAGCACCTGATGGAGGACTACGAGAAGCTGGC
CAGCGACCTCCTGGAGTGGATCCGGCGCACCATCCCCTGGCTGGAGGACCGTGTGCCCCAAAAGACTATCCAGGAGATGCAGCAGAAGCT
GGAGGACTTCCGCGACTACCGGCGTGTGCACAAGCCGCCCAAGGTGCAGGAGAAGTGCCAGCTGGAGATCAACTTCAACACGCTGCAGAC
CAAGCTGCGCCTCAGCAACCGGCCCGCCTTCATGCCCTCCGAGGGCAAGATGGTCTCGGACATCAACAATGGCTGGCAGCACTTGGAGCA
GGCTGAGAAGGGCTACGAGGAGTGGCTGCTGAATGAGATCCGCAGGCTGGAGCGGCTCGACCACCTGGCAGAGAAGTTCCGGCAGAAGGC
CTCCATCCACGAGGCCTGGACTGACGGGAAGGAAGCCATGCTGAAGCACCGGGACTACGAGACGGCCACACTATCGGACATCAAAGCCCT
CATTCGCAAGCACGAGGCCTTCGAGAGCGACCTGGCTGCGCACCAGGACCGCGTGGAGCAGATCGCCGCCATTGCCCAGGAGCTCAACGA
GCTGGATTACTACGACTCCCACAATGTCAACACCCGGTGCCAGAAGATCTGTGACCAGTGGGACGCCCTCGGCTCTCTGACACATAGTCG
CAGGGAAGCCCTGGAGAAAACAGAGAAGCAGCTGGAGGCCATCGACCAGCTGCACCTGGAATACGCCAAGCGCGCGGCCCCCTTCAACAA
CTGGATGGAGAGCGCCATGGAGGACCTCCAGGACATGTTCATCGTCCATACCATCGAGGAGATTGAGGGCCTGATCTCAGCCCATGACCA
GTTCAAGTCCACCCTGCCGGACGCCGATAGGGAGCGCGAGGCCATCCTGGCCATCCACAAGGAGGCCCAGAGGATCGCTGAGAGCAACCA
CATCAAGCTGTCGGGCAGCAACCCCTACACCACCGTCACCCCGCAAATCATCAACTCCAAGTGGGAGAAGGTGCAGCAGCTGGTGCCAAA
ACGGGACCATGCCCTCCTGGAGGAGCAGAGCAAGCAGCAGTCCAACGAGCACCTGCGCCGCCAGTTCGCCAGCCAGGCCAATGTTGTGGG
GCCCTGGATCCAGACCAAGATGGAGGAGATCGGGCGCATCTCCATTGAGATGAACGGGACCCTGGAGGACCAGCTGAGCCACCTGAAGCA
GTATGAACGCAGCATCGTGGACTACAAGCCCAACCTGGACCTGCTGGAGCAGCAGCACCAGCTCATCCAGGAGGCCCTCATCTTCGACAA
CAAGCACACCAACTATACCATGGAGCACATCCGCGTGGGCTGGGAGCAGCTGCTCACCACCATTGCCCGCACCATCAACGAGGTGGAGAA
CCAGATCCTCACCCGCGACGCCAAGGGCATCAGCCAGGAGCAGATGCAGGAGTTCCGGGCGTCCTTCAACCACTTCGACAAGGATCATGG
CGGGGCGCTGGGGCCCGAGGAGTTCAAGGCCTGCCTCATCAGCCTGGGCTACGACGTGGAGAACGACCGGCAGGGTGAGGCCGAGTTCAA
CCGCATCATGAGCCTGGTCGACCCCAACCATAGCGGCCTTGTGACCTTCCAAGCCTTCATCGACTTCATGTCGCGGGAGACCACCGACAC
GGACACGGCTGACCAGGTCATCGCTTCCTTCAAGGTCTTAGCAGGGGACAAGAACTTCATCACAGCTGAGGAGCTGCGGAGAGAGCTGCC
CCCCGACCAGGCCGAGTACTGCATCGCCCGCATGGCGCCATACCAGGGCCCTGACGCCGTGCCCGGTGCCCTCGACTACAAGTCCTTCTC
CACGGCCTTGTATGGCGAGAGCGACCTGTGAGGCCCCAGAGACCTGACCCAACACCCCCGACGGCCTCCAGGAGGGGCCTGGGCAGCCCC
ACAGTCCCATTCCTCCACTCTGTATCTATGCAAAGCACTCTCTGCAGTCCTCCGGGGTGGGTGGGTGGGCAGGGAGGGGCTGGGGCAGGC
TCTCTCCTCTCTCTCTTTGTGGGTTGGCCAGGAGGTTCCCCCGACCAGGTTGGGGAGACTTGGGGCCAGCGCTTCTGGTCTGGTAAATAT
GTATGATGTGTTGTGCTTTTTTAACCAAGGAGGGGCCAGTGGATTCCCACAGCACAACCGGTCCCTTCCATGCCCTGGGATGCCTCACCA
CACCCAGGTCTCTTCCTTTGCTCTGAGGTCCCTTCAAGGCCTCCCCAATCCAGGCCAAAGCCCCATGTGCCTTGTCCAGGAACTGCCTGG
GCCATGCGAGGGGCCAGCAGAGGGCGCCACCACCACCTGACGGCTGGGGACCCACCCAGCCCCTCTCCCCTCTCTGCTCCAGACTCACTT
GCCATTGCCAGGAGATGGCCCCAACAAGCACCCCGCTTTTGCAGCAGAGGAGCTGAGTTGGCAGACCGGGCCCCCCTGAACCGCACCCCA
TCCCACCAGCCCCGGCCTTGCTTTGTCTGGCCTCACGTGTCTCAGATTTTCTAAGAACCAAAAAAAAAAAAGGAAAAAAAACACAAAACA
ACAAAAACCAAAAAAAAAAAAAATCACAAAAACAAAAAAACTATAAAAAAGAAAGAATTAAAAACTTTCAGAGAATTACTATTTACTTTA
TTAACTTACGGATTTATTATATAAATATATATTCACCTAGCAACATATCTCTGCCGTCTCTCCTGCTCTCATAATGAAGACATAGCCGAT
TCTCTGCCCGGGCCCCTTGCTGATGCTCCTCCGGGTCTGCGTCGGGCGTGGGTCTCTGGGGACCCTCCAGAGGTGGAGGTGGGCTGATGG
CCTGGCTGCCTGGTGGTTGATGGTTTTGCTCCCCCTACCTTTTTTTTTTGAGTTTATTCTGATTGATTTTTTTTCTTGGTTTCTGGATAA
ACCACCCTCTGGGGACAGGATAATAAAACATGTAATATTTTTAAGAAGGATTCCTGCAGCATCATCTTTTTTTATTTCTCCTGTGTCTGT
CCTCCACCTTCTAGGAGAGCCAGGGCAGAGCTAGCACTGTCTTAAGCTGTCAACGTGGACTAGCTCGTGTCATCTGCTCGAGAAGGGCTG
TCGCTGTTCTTGTTTCTGAGTGAGGAGTACGCAGGCCAGAGTGGTCACCCGGCCGTGAGCAGTGAGGGCCAGAGACTAGCCCCAGACAGG
TGGATGCCAGAGAGAGTGGCACCCATGCCAGGCAAGGCCTAGGGAGGTGGTCTTGCTCAGCAACCCTGCCCTGAGCAGCAGGTGCGCCCA
TCCGGAGATCCTAGGAGAAGGTGGCCACCTCCATCCACTAAGGAAGAGAAGGAAGACAGTGGCTTGAGGCAGGGAGCTCGCAGGACAGAG
CCTGAGCCACCCTGTCCCTCCCACCTGGCTCACCTGTCTGTGGGTCAGGCAGATGACCCCCTCACCCCCATCCAGGTGCTGGCTGCAGTG
GCCTGTGCAGAGAGGGGCAGGGTGAGTGCCCACCAGTCCCCGTACCCCTTCCCCCCATGCCCCACCATGCCGGGGTGGTACTCACAGAAG
ATGCAGGTGAGGTGGGCCACACAGGACACGAACCGCTCGAAGTCCACACGCAGACGGCTATCCCGGTAGCGGCTGGTGAGGGTCTGGGTC
AGCTGGTTGTTCAGGTGGAAGCCTAGGGGGAGGCTGCTTCTGAGCCCAGTGGCCCACAGGGAACCCACCTTGGCATTGCATCCCCACCCC
ACCTCCTCAGGGAGGACATGAATGCCACAGGGTGTCACACCCCAACTCTGCCCCATCCCGGCAGGGTGAGTACAGGCTGATCCCTTCAAT
CCTCTGGGCCTGTTTCCTCATCCATCAAACGGACTAAGACAGCCCCGACCCCATAGGGTGTGTGAAGACAGAACGCTCAGGACAGCGTCT
GACACGTGACTCGATGTGTGGGTACTGTTACTCCTTAAATCCTGTGGGGCTTTCTCCTTGCCAGTGGGCACTGGAGGATATTTCTGTGCA


Top

FusionGenePPI for HNRNPL_ACTN4


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
HNRNPLPTBP1, PUF60, DOCK4, EIF2B1, YWHAZ, CSE1L, FGFR3, HMG20B, PCBP2, HNRNPK, HNRNPL, HNRNPA2B1, APEX1, KHDRBS2, HNRNPA1, SRRM2, TOPORS, UBC, HDAC5, TOP1, VHL, SMARCAD1, MBNL1, ELAVL1, ISG15, CUL3, CUL1, COPS5, CAND1, HNRNPR, HNRNPA3, HNRNPA0, HNRNPD, HNRNPH1, HNRNPM, EEF1A1, SFPQ, HNRNPDL, ATP6V1F, NPLOC4, LPP, MPV17, HSPA5, DYNC1H1, GCN1L1, EEF2, PLEC, LSM14A, MAGOH, EIF4A3, FN1, VCAM1, CSNK2A1, TP63, IFIT2, IFIT3, DAB2, IL7R, UBL4A, ITGA4, HMGA1, FBXO6, ITCH, NEDD4, ILF3, VEGFA, RPA1, RPA2, RPA3, IVNS1ABP, TRIM68, TP53, FUS, HIST3H3, CUL7, OBSL1, CCDC8, EED, RNF2, UNK, ACTR3, DHX15, DPH5, EIF4H, ABCC1, DDX17, LGALS1, HSPA9, HSPBP1, MRPL41, NAA50, NARS, NHP2L1, PDHA1, SF1, SYNCRIP, TUFM, YWHAE, NTRK1, SCARNA22, HIST1H3E, HNRNPU, MATR3, FOXE1, CRY1, MCM2, U2AF2, CRBN, SSU72, ELAVL2, APOBEC3D, CYLD, TRIM25, BRCA1, LMNAACTN4MYOZ2, MYOZ1, PDLIM1, USP6NL, SLC9A3R2, COL17A1, TRIM3, MAGI1, GSN, CAMK2A, CAMK2B, INO80, UBTF, STAT1, HDAC7, MEF2A, UCHL5, TJP1, ATXN7, HDAC5, VDR, ESR1, PSMA3, ELAVL1, SIRT7, SLC2A4, ISG15, COIL, SACS, HGS, UBASH3B, SHC1, NOS3, ACTN2, ACTN1, FMNL1, TRAF3IP1, FN1, VCAM1, CDH1, ITGA4, SVIL, CD81, IGSF8, ICAM1, TXN, RPS27, POT1, KPNA2, MAPK7, CDKN2A, VCP, SF3A3, GNB2, HUWE1, ACTN3, BMP7, ALK, CUL7, OBSL1, CCDC8, EGFR, LUZP4, RARA, HSPB1, AHNAK, ALDOA, ALDOC, IDH3A, MYH15, MYH2, MYH7B, NCAPG2, PSMA6, PSMB5, PUS7, TPM2, TSG101, CKB, CYC1, ECSIT, MCFD2, PSMB8, TPM1, TPM3, TPM4, NTRK1, CAPZA2, DBN1, FLNA, MYH9, MYO1C, PPP1CB, IQGAP1, PDLIM7, SYNPO, MAPRE1, SIN3B, MYEF2, LIMA1, ANLN, MYO5C, MYO19, MYO18A, CTNNB1, MCM2, NFYA, CDC73, DDIAS, SSH1, NCL, DLD, DNM1L, PDHA1, SOD1, TRIM25, TES


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
TgeneACTN4chr19:39340340chr19:39205109ENST00000390009+014108_12654693VCL


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
TgeneACTN4chr19:39340340chr19:39205109ENST00000252699+721108_126273912VCL
TgeneACTN4chr19:39340340chr19:39205109ENST00000252699+72112_26273912VCL
TgeneACTN4chr19:39340340chr19:39205109ENST00000252699+72140_61273912VCL
TgeneACTN4chr19:39340340chr19:39205109ENST00000390009+01412_2654693VCL
TgeneACTN4chr19:39340340chr19:39205109ENST00000390009+01440_6154693VCL


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for HNRNPL_ACTN4


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for HNRNPL_ACTN4


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneHNRNPLC0038356Stomach Neoplasms1CTD_human
HgeneHNRNPLC1458155Mammary Neoplasms1CTD_human
TgeneACTN4C0333497Segmental glomerulosclerosis3UNIPROT
TgeneACTN4C0024667Animal Mammary Neoplasms1CTD_human
TgeneACTN4C0024668Mammary Neoplasms, Experimental1CTD_human