FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 16403

FusionGeneSummary for HLTF_WWTR1

check button Fusion gene summary
Fusion gene informationFusion gene name: HLTF_WWTR1
Fusion gene ID: 16403
HgeneTgene
Gene symbol

HLTF

WWTR1

Gene ID

6596

25937

Gene namehelicase like transcription factorWW domain containing transcription regulator 1
SynonymsHIP116|HIP116A|HLTF1|RNF80|SMARCA3|SNF2L3|ZBU1TAZ
Cytomap

3q24

3q25.1

Type of geneprotein-codingprotein-coding
Descriptionhelicase-like transcription factorDNA-binding protein/plasminogen activator inhibitor-1 regulatorRING finger protein 80RING-type E3 ubiquitin transferase HLTFSNF2-like 3SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfaWW domain-containing transcription regulator protein 1transcriptional co-activator with PDZ-binding motif
Modification date2018051920180522
UniProtAcc

Q14527

Q9GZV5

Ensembl transtripts involved in fusion geneENST00000465259, ENST00000310053, 
ENST00000392912, ENST00000494055, 
ENST00000481663, 
ENST00000465804, 
ENST00000360632, ENST00000467467, 
ENST00000474080, 
Fusion gene scores* DoF score2 X 2 X 2=86 X 4 X 6=144
# samples 27
** MAII scorelog2(2/8*10)=1.32192809488736log2(7/144*10)=-1.04064198449735
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: HLTF [Title/Abstract] AND WWTR1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Tumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Transcription factor involved fusion gene, inframe and retained DNA-binding domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneWWTR1

GO:0008284

positive regulation of cell proliferation

18227151

TgeneWWTR1

GO:0010718

positive regulation of epithelial to mesenchymal transition

18227151

TgeneWWTR1

GO:0017145

stem cell division

18568018

TgeneWWTR1

GO:0035329

hippo signaling

18227151|20412773

TgeneWWTR1

GO:0060390

regulation of SMAD protein signal transduction

18568018


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLIHCTCGA-PD-A5DF-01AHLTFchr3

148777505

-WWTR1chr3

149260324

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000465259ENST00000465804HLTFchr3

148777505

-WWTR1chr3

149260324

-
In-frameENST00000465259ENST00000360632HLTFchr3

148777505

-WWTR1chr3

149260324

-
In-frameENST00000465259ENST00000467467HLTFchr3

148777505

-WWTR1chr3

149260324

-
5CDS-intronENST00000465259ENST00000474080HLTFchr3

148777505

-WWTR1chr3

149260324

-
In-frameENST00000310053ENST00000465804HLTFchr3

148777505

-WWTR1chr3

149260324

-
In-frameENST00000310053ENST00000360632HLTFchr3

148777505

-WWTR1chr3

149260324

-
In-frameENST00000310053ENST00000467467HLTFchr3

148777505

-WWTR1chr3

149260324

-
5CDS-intronENST00000310053ENST00000474080HLTFchr3

148777505

-WWTR1chr3

149260324

-
In-frameENST00000392912ENST00000465804HLTFchr3

148777505

-WWTR1chr3

149260324

-
In-frameENST00000392912ENST00000360632HLTFchr3

148777505

-WWTR1chr3

149260324

-
In-frameENST00000392912ENST00000467467HLTFchr3

148777505

-WWTR1chr3

149260324

-
5CDS-intronENST00000392912ENST00000474080HLTFchr3

148777505

-WWTR1chr3

149260324

-
In-frameENST00000494055ENST00000465804HLTFchr3

148777505

-WWTR1chr3

149260324

-
In-frameENST00000494055ENST00000360632HLTFchr3

148777505

-WWTR1chr3

149260324

-
In-frameENST00000494055ENST00000467467HLTFchr3

148777505

-WWTR1chr3

149260324

-
5CDS-intronENST00000494055ENST00000474080HLTFchr3

148777505

-WWTR1chr3

149260324

-
intron-3CDSENST00000481663ENST00000465804HLTFchr3

148777505

-WWTR1chr3

149260324

-
intron-3CDSENST00000481663ENST00000360632HLTFchr3

148777505

-WWTR1chr3

149260324

-
intron-3CDSENST00000481663ENST00000467467HLTFchr3

148777505

-WWTR1chr3

149260324

-
intron-intronENST00000481663ENST00000474080HLTFchr3

148777505

-WWTR1chr3

149260324

-

Top

FusionProtFeatures for HLTF_WWTR1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
HLTF

Q14527

WWTR1

Q9GZV5

Has both helicase and E3 ubiquitin ligase activities.Possesses intrinsic ATP-dependent nucleosome-remodeling activity;This activity may be required for transcriptional activation orrepression of specific target promoters (By similarity). These mayinclude the SERPINE1 and HIV-1 promoters and the SV40 enhancer, towhich this protein can bind directly. Plays a role in error-freepostreplication repair (PRR) of damaged DNA and maintains genomicstability through acting as a ubiquitin ligase for 'Lys-63'-linkedpolyubiquitination of chromatin-bound PCNA. {ECO:0000250,ECO:0000269|PubMed:10391891, ECO:0000269|PubMed:18316726,ECO:0000269|PubMed:18719106, ECO:0000269|PubMed:7876228,ECO:0000269|PubMed:8672239, ECO:0000269|PubMed:9126292}. Transcriptional coactivator which acts as a downstreamregulatory target in the Hippo signaling pathway that plays apivotal role in organ size control and tumor suppression byrestricting proliferation and promoting apoptosis. The core ofthis pathway is composed of a kinase cascade wherein STK3/MST2 andSTK4/MST1, in complex with its regulatory protein SAV1,phosphorylates and activates LATS1/2 in complex with itsregulatory protein MOB1, which in turn phosphorylates andinactivates YAP1 oncoprotein and WWTR1/TAZ. WWTR1 enhances PAX8and NKX2-1/TTF1-dependent gene activation. Regulates the nuclearaccumulation of SMADS and has a key role in coupling them to thetranscriptional machinery such as the mediator complex. Regulatesembryonic stem-cell self-renewal, promotes cell proliferation andepithelial-mesenchymal transition. {ECO:0000269|PubMed:11118213,ECO:0000269|PubMed:18227151, ECO:0000269|PubMed:18568018,ECO:0000269|PubMed:19010321}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneHLTFchr3:148777505chr3:149260324ENST00000310053-132538_2874581010DNA binding.
HgeneHLTFchr3:148777505chr3:149260324ENST00000392912-132638_2874581161DNA binding.
HgeneHLTFchr3:148777505chr3:149260324ENST00000465259-132538_2874571009DNA binding.
HgeneHLTFchr3:148777505chr3:149260324ENST00000494055-132638_2874581040DNA binding.
HgeneHLTFchr3:148777505chr3:149260324ENST00000310053-1325294_3014581010Nucleotide bindingATP
HgeneHLTFchr3:148777505chr3:149260324ENST00000392912-1326294_3014581161Nucleotide bindingATP
HgeneHLTFchr3:148777505chr3:149260324ENST00000465259-1325294_3014571009Nucleotide bindingATP
HgeneHLTFchr3:148777505chr3:149260324ENST00000494055-1326294_3014581040Nucleotide bindingATP
TgeneWWTR1chr3:148777505chr3:149260324ENST00000360632-27225_259189401Coiled coilOntology_term=ECO:0000255
TgeneWWTR1chr3:148777505chr3:149260324ENST00000465804-38225_259189401Coiled coilOntology_term=ECO:0000255
TgeneWWTR1chr3:148777505chr3:149260324ENST00000467467-27225_259189401Coiled coilOntology_term=ECO:0000255
TgeneWWTR1chr3:148777505chr3:149260324ENST00000360632-27194_241189401Compositional biasNote=Gln-rich
TgeneWWTR1chr3:148777505chr3:149260324ENST00000465804-38194_241189401Compositional biasNote=Gln-rich
TgeneWWTR1chr3:148777505chr3:149260324ENST00000467467-27194_241189401Compositional biasNote=Gln-rich
TgeneWWTR1chr3:148777505chr3:149260324ENST00000360632-27394_400189401MotifNote=PDZ-binding
TgeneWWTR1chr3:148777505chr3:149260324ENST00000465804-38394_400189401MotifNote=PDZ-binding
TgeneWWTR1chr3:148777505chr3:149260324ENST00000467467-27394_400189401MotifNote=PDZ-binding

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneHLTFchr3:148777505chr3:149260324ENST00000310053-1325435_6064581010DomainHelicase ATP-binding
HgeneHLTFchr3:148777505chr3:149260324ENST00000310053-1325837_9964581010DomainHelicase C-terminal
HgeneHLTFchr3:148777505chr3:149260324ENST00000392912-1326435_6064581161DomainHelicase ATP-binding
HgeneHLTFchr3:148777505chr3:149260324ENST00000392912-1326837_9964581161DomainHelicase C-terminal
HgeneHLTFchr3:148777505chr3:149260324ENST00000465259-1325435_6064571009DomainHelicase ATP-binding
HgeneHLTFchr3:148777505chr3:149260324ENST00000465259-1325837_9964571009DomainHelicase C-terminal
HgeneHLTFchr3:148777505chr3:149260324ENST00000494055-1326435_6064581040DomainHelicase ATP-binding
HgeneHLTFchr3:148777505chr3:149260324ENST00000494055-1326837_9964581040DomainHelicase C-terminal
HgeneHLTFchr3:148777505chr3:149260324ENST00000310053-1325557_5604581010MotifNote=DEGH box
HgeneHLTFchr3:148777505chr3:149260324ENST00000392912-1326557_5604581161MotifNote=DEGH box
HgeneHLTFchr3:148777505chr3:149260324ENST00000465259-1325557_5604571009MotifNote=DEGH box
HgeneHLTFchr3:148777505chr3:149260324ENST00000494055-1326557_5604581040MotifNote=DEGH box
HgeneHLTFchr3:148777505chr3:149260324ENST00000310053-1325760_8014581010Zinc fingerRING-type
HgeneHLTFchr3:148777505chr3:149260324ENST00000392912-1326760_8014581161Zinc fingerRING-type
HgeneHLTFchr3:148777505chr3:149260324ENST00000465259-1325760_8014571009Zinc fingerRING-type
HgeneHLTFchr3:148777505chr3:149260324ENST00000494055-1326760_8014581040Zinc fingerRING-type
TgeneWWTR1chr3:148777505chr3:149260324ENST00000360632-27124_157189401DomainWW
TgeneWWTR1chr3:148777505chr3:149260324ENST00000465804-38124_157189401DomainWW
TgeneWWTR1chr3:148777505chr3:149260324ENST00000467467-27124_157189401DomainWW


Top

FusionGeneSequence for HLTF_WWTR1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_HLTF_ENST00000465259_chr3_148777505_-_WWTR1_ENST00000465804_chr3_149260324_-_669aa
MSWMFKRDPVWKYLQTVQTGVHGNFPRLSTPTFFPRFEFQDVIPPDDFLTSDEEVDSVLFGSLRGHVVGLRTYTGVVNNNEMVALQRDPN
NPTDKNAIKVNNVNGNQVGHLKKELAGALATIMDNKLAQIEGVVPFGANNAFTMPLHMTFWGKEENRKAVSDQLKKHGFKLGPAPKTLGF
NLESGWGSGRAGPSTSMPVHAAVQMTTEQLKTEFDKLFEDLKEDDKTHEMEPAEAIETPLLPHQKQALAWMVSRENSKELPPFWEQRNDL
YTNTITNFSEKDRPENVHGGILADDMGLGKTLTAIAVILTNFHDGRPLPIERVKKNLLKKETNVNDDSMKLGGNNTSEKADGLSKDASRC
SEQPSISDIKEKSKFRMSELSSSRPKRRKTAVQYIESSDSEEIETSELPQKMKGKLKNVQSETKGRAKGSSKVIEDVAFACALTSSVPTT
KKKMLKKVMNHQHQQQMAPSTLSQQNHPTQNPPAGLMSMPNALTTQQQQQQKLRLQRIQMERERIRMRQEELMRQEAALCRQLPMEAETL
APVQAAVNPPTMTPDMRSITNNSSDPFLNGGPTHSREQSTDSGLGLGCYSVPTTPEDFLSNVDEMDTGENAGQTPMNINPQQTRFPDFLD

>In-frame_HLTF_ENST00000465259_chr3_148777505_-_WWTR1_ENST00000360632_chr3_149260324_-_669aa
MSWMFKRDPVWKYLQTVQTGVHGNFPRLSTPTFFPRFEFQDVIPPDDFLTSDEEVDSVLFGSLRGHVVGLRTYTGVVNNNEMVALQRDPN
NPTDKNAIKVNNVNGNQVGHLKKELAGALATIMDNKLAQIEGVVPFGANNAFTMPLHMTFWGKEENRKAVSDQLKKHGFKLGPAPKTLGF
NLESGWGSGRAGPSTSMPVHAAVQMTTEQLKTEFDKLFEDLKEDDKTHEMEPAEAIETPLLPHQKQALAWMVSRENSKELPPFWEQRNDL
YTNTITNFSEKDRPENVHGGILADDMGLGKTLTAIAVILTNFHDGRPLPIERVKKNLLKKETNVNDDSMKLGGNNTSEKADGLSKDASRC
SEQPSISDIKEKSKFRMSELSSSRPKRRKTAVQYIESSDSEEIETSELPQKMKGKLKNVQSETKGRAKGSSKVIEDVAFACALTSSVPTT
KKKMLKKVMNHQHQQQMAPSTLSQQNHPTQNPPAGLMSMPNALTTQQQQQQKLRLQRIQMERERIRMRQEELMRQEAALCRQLPMEAETL
APVQAAVNPPTMTPDMRSITNNSSDPFLNGGPTHSREQSTDSGLGLGCYSVPTTPEDFLSNVDEMDTGENAGQTPMNINPQQTRFPDFLD

>In-frame_HLTF_ENST00000465259_chr3_148777505_-_WWTR1_ENST00000467467_chr3_149260324_-_669aa
MSWMFKRDPVWKYLQTVQTGVHGNFPRLSTPTFFPRFEFQDVIPPDDFLTSDEEVDSVLFGSLRGHVVGLRTYTGVVNNNEMVALQRDPN
NPTDKNAIKVNNVNGNQVGHLKKELAGALATIMDNKLAQIEGVVPFGANNAFTMPLHMTFWGKEENRKAVSDQLKKHGFKLGPAPKTLGF
NLESGWGSGRAGPSTSMPVHAAVQMTTEQLKTEFDKLFEDLKEDDKTHEMEPAEAIETPLLPHQKQALAWMVSRENSKELPPFWEQRNDL
YTNTITNFSEKDRPENVHGGILADDMGLGKTLTAIAVILTNFHDGRPLPIERVKKNLLKKETNVNDDSMKLGGNNTSEKADGLSKDASRC
SEQPSISDIKEKSKFRMSELSSSRPKRRKTAVQYIESSDSEEIETSELPQKMKGKLKNVQSETKGRAKGSSKVIEDVAFACALTSSVPTT
KKKMLKKVMNHQHQQQMAPSTLSQQNHPTQNPPAGLMSMPNALTTQQQQQQKLRLQRIQMERERIRMRQEELMRQEAALCRQLPMEAETL
APVQAAVNPPTMTPDMRSITNNSSDPFLNGGPTHSREQSTDSGLGLGCYSVPTTPEDFLSNVDEMDTGENAGQTPMNINPQQTRFPDFLD

>In-frame_HLTF_ENST00000310053_chr3_148777505_-_WWTR1_ENST00000465804_chr3_149260324_-_670aa
MSWMFKRDPVWKYLQTVQTGVHGNFPRLSTPTFFPRFEFQDVIPPDDFLTSDEEVDSVLFGSLRGHVVGLRTYTGVVNNNEMVALQRDPN
NPTDKNAIKVNNVNGNQVGHLKKELAGALATIMDNKLAQIEGVVPFGANNAFTMPLHMTFWGKEENRKAVSDQLKKHGFKLGPAPKTLGF
NLESGWGSGRAGPSTSMPVHAAVQMTTEQLKTEFDKLFEDLKEDDKTHEMEPAEAIETPLLPHQKQALAWMVSRENSKELPPFWEQRNDL
YTNTITNFSEKDRPENVHGGILADDMGLGKTLTAIAVILTNFHDGRPLPIERVKKNLLKKETNVNDDSMKLGGNNTSEKADGLSKDASRC
SEQPSISDIKEKSKFRMSELSSSRPKRRKTAVQYIESSDSEEIETSELPQKMKGKLKNVQSETKGRAKAGSSKVIEDVAFACALTSSVPT
TKKKMLKKVMNHQHQQQMAPSTLSQQNHPTQNPPAGLMSMPNALTTQQQQQQKLRLQRIQMERERIRMRQEELMRQEAALCRQLPMEAET
LAPVQAAVNPPTMTPDMRSITNNSSDPFLNGGPTHSREQSTDSGLGLGCYSVPTTPEDFLSNVDEMDTGENAGQTPMNINPQQTRFPDFL

>In-frame_HLTF_ENST00000310053_chr3_148777505_-_WWTR1_ENST00000360632_chr3_149260324_-_670aa
MSWMFKRDPVWKYLQTVQTGVHGNFPRLSTPTFFPRFEFQDVIPPDDFLTSDEEVDSVLFGSLRGHVVGLRTYTGVVNNNEMVALQRDPN
NPTDKNAIKVNNVNGNQVGHLKKELAGALATIMDNKLAQIEGVVPFGANNAFTMPLHMTFWGKEENRKAVSDQLKKHGFKLGPAPKTLGF
NLESGWGSGRAGPSTSMPVHAAVQMTTEQLKTEFDKLFEDLKEDDKTHEMEPAEAIETPLLPHQKQALAWMVSRENSKELPPFWEQRNDL
YTNTITNFSEKDRPENVHGGILADDMGLGKTLTAIAVILTNFHDGRPLPIERVKKNLLKKETNVNDDSMKLGGNNTSEKADGLSKDASRC
SEQPSISDIKEKSKFRMSELSSSRPKRRKTAVQYIESSDSEEIETSELPQKMKGKLKNVQSETKGRAKAGSSKVIEDVAFACALTSSVPT
TKKKMLKKVMNHQHQQQMAPSTLSQQNHPTQNPPAGLMSMPNALTTQQQQQQKLRLQRIQMERERIRMRQEELMRQEAALCRQLPMEAET
LAPVQAAVNPPTMTPDMRSITNNSSDPFLNGGPTHSREQSTDSGLGLGCYSVPTTPEDFLSNVDEMDTGENAGQTPMNINPQQTRFPDFL

>In-frame_HLTF_ENST00000310053_chr3_148777505_-_WWTR1_ENST00000467467_chr3_149260324_-_670aa
MSWMFKRDPVWKYLQTVQTGVHGNFPRLSTPTFFPRFEFQDVIPPDDFLTSDEEVDSVLFGSLRGHVVGLRTYTGVVNNNEMVALQRDPN
NPTDKNAIKVNNVNGNQVGHLKKELAGALATIMDNKLAQIEGVVPFGANNAFTMPLHMTFWGKEENRKAVSDQLKKHGFKLGPAPKTLGF
NLESGWGSGRAGPSTSMPVHAAVQMTTEQLKTEFDKLFEDLKEDDKTHEMEPAEAIETPLLPHQKQALAWMVSRENSKELPPFWEQRNDL
YTNTITNFSEKDRPENVHGGILADDMGLGKTLTAIAVILTNFHDGRPLPIERVKKNLLKKETNVNDDSMKLGGNNTSEKADGLSKDASRC
SEQPSISDIKEKSKFRMSELSSSRPKRRKTAVQYIESSDSEEIETSELPQKMKGKLKNVQSETKGRAKAGSSKVIEDVAFACALTSSVPT
TKKKMLKKVMNHQHQQQMAPSTLSQQNHPTQNPPAGLMSMPNALTTQQQQQQKLRLQRIQMERERIRMRQEELMRQEAALCRQLPMEAET
LAPVQAAVNPPTMTPDMRSITNNSSDPFLNGGPTHSREQSTDSGLGLGCYSVPTTPEDFLSNVDEMDTGENAGQTPMNINPQQTRFPDFL

>In-frame_HLTF_ENST00000392912_chr3_148777505_-_WWTR1_ENST00000465804_chr3_149260324_-_670aa
MSWMFKRDPVWKYLQTVQTGVHGNFPRLSTPTFFPRFEFQDVIPPDDFLTSDEEVDSVLFGSLRGHVVGLRTYTGVVNNNEMVALQRDPN
NPTDKNAIKVNNVNGNQVGHLKKELAGALATIMDNKLAQIEGVVPFGANNAFTMPLHMTFWGKEENRKAVSDQLKKHGFKLGPAPKTLGF
NLESGWGSGRAGPSTSMPVHAAVQMTTEQLKTEFDKLFEDLKEDDKTHEMEPAEAIETPLLPHQKQALAWMVSRENSKELPPFWEQRNDL
YTNTITNFSEKDRPENVHGGILADDMGLGKTLTAIAVILTNFHDGRPLPIERVKKNLLKKETNVNDDSMKLGGNNTSEKADGLSKDASRC
SEQPSISDIKEKSKFRMSELSSSRPKRRKTAVQYIESSDSEEIETSELPQKMKGKLKNVQSETKGRAKAGSSKVIEDVAFACALTSSVPT
TKKKMLKKVMNHQHQQQMAPSTLSQQNHPTQNPPAGLMSMPNALTTQQQQQQKLRLQRIQMERERIRMRQEELMRQEAALCRQLPMEAET
LAPVQAAVNPPTMTPDMRSITNNSSDPFLNGGPTHSREQSTDSGLGLGCYSVPTTPEDFLSNVDEMDTGENAGQTPMNINPQQTRFPDFL

>In-frame_HLTF_ENST00000392912_chr3_148777505_-_WWTR1_ENST00000360632_chr3_149260324_-_670aa
MSWMFKRDPVWKYLQTVQTGVHGNFPRLSTPTFFPRFEFQDVIPPDDFLTSDEEVDSVLFGSLRGHVVGLRTYTGVVNNNEMVALQRDPN
NPTDKNAIKVNNVNGNQVGHLKKELAGALATIMDNKLAQIEGVVPFGANNAFTMPLHMTFWGKEENRKAVSDQLKKHGFKLGPAPKTLGF
NLESGWGSGRAGPSTSMPVHAAVQMTTEQLKTEFDKLFEDLKEDDKTHEMEPAEAIETPLLPHQKQALAWMVSRENSKELPPFWEQRNDL
YTNTITNFSEKDRPENVHGGILADDMGLGKTLTAIAVILTNFHDGRPLPIERVKKNLLKKETNVNDDSMKLGGNNTSEKADGLSKDASRC
SEQPSISDIKEKSKFRMSELSSSRPKRRKTAVQYIESSDSEEIETSELPQKMKGKLKNVQSETKGRAKAGSSKVIEDVAFACALTSSVPT
TKKKMLKKVMNHQHQQQMAPSTLSQQNHPTQNPPAGLMSMPNALTTQQQQQQKLRLQRIQMERERIRMRQEELMRQEAALCRQLPMEAET
LAPVQAAVNPPTMTPDMRSITNNSSDPFLNGGPTHSREQSTDSGLGLGCYSVPTTPEDFLSNVDEMDTGENAGQTPMNINPQQTRFPDFL

>In-frame_HLTF_ENST00000392912_chr3_148777505_-_WWTR1_ENST00000467467_chr3_149260324_-_670aa
MSWMFKRDPVWKYLQTVQTGVHGNFPRLSTPTFFPRFEFQDVIPPDDFLTSDEEVDSVLFGSLRGHVVGLRTYTGVVNNNEMVALQRDPN
NPTDKNAIKVNNVNGNQVGHLKKELAGALATIMDNKLAQIEGVVPFGANNAFTMPLHMTFWGKEENRKAVSDQLKKHGFKLGPAPKTLGF
NLESGWGSGRAGPSTSMPVHAAVQMTTEQLKTEFDKLFEDLKEDDKTHEMEPAEAIETPLLPHQKQALAWMVSRENSKELPPFWEQRNDL
YTNTITNFSEKDRPENVHGGILADDMGLGKTLTAIAVILTNFHDGRPLPIERVKKNLLKKETNVNDDSMKLGGNNTSEKADGLSKDASRC
SEQPSISDIKEKSKFRMSELSSSRPKRRKTAVQYIESSDSEEIETSELPQKMKGKLKNVQSETKGRAKAGSSKVIEDVAFACALTSSVPT
TKKKMLKKVMNHQHQQQMAPSTLSQQNHPTQNPPAGLMSMPNALTTQQQQQQKLRLQRIQMERERIRMRQEELMRQEAALCRQLPMEAET
LAPVQAAVNPPTMTPDMRSITNNSSDPFLNGGPTHSREQSTDSGLGLGCYSVPTTPEDFLSNVDEMDTGENAGQTPMNINPQQTRFPDFL

>In-frame_HLTF_ENST00000494055_chr3_148777505_-_WWTR1_ENST00000465804_chr3_149260324_-_670aa
MSWMFKRDPVWKYLQTVQTGVHGNFPRLSTPTFFPRFEFQDVIPPDDFLTSDEEVDSVLFGSLRGHVVGLRTYTGVVNNNEMVALQRDPN
NPTDKNAIKVNNVNGNQVGHLKKELAGALATIMDNKLAQIEGVVPFGANNAFTMPLHMTFWGKEENRKAVSDQLKKHGFKLGPAPKTLGF
NLESGWGSGRAGPSTSMPVHAAVQMTTEQLKTEFDKLFEDLKEDDKTHEMEPAEAIETPLLPHQKQALAWMVSRENSKELPPFWEQRNDL
YTNTITNFSEKDRPENVHGGILADDMGLGKTLTAIAVILTNFHDGRPLPIERVKKNLLKKETNVNDDSMKLGGNNTSEKADGLSKDASRC
SEQPSISDIKEKSKFRMSELSSSRPKRRKTAVQYIESSDSEEIETSELPQKMKGKLKNVQSETKGRAKAGSSKVIEDVAFACALTSSVPT
TKKKMLKKVMNHQHQQQMAPSTLSQQNHPTQNPPAGLMSMPNALTTQQQQQQKLRLQRIQMERERIRMRQEELMRQEAALCRQLPMEAET
LAPVQAAVNPPTMTPDMRSITNNSSDPFLNGGPTHSREQSTDSGLGLGCYSVPTTPEDFLSNVDEMDTGENAGQTPMNINPQQTRFPDFL

>In-frame_HLTF_ENST00000494055_chr3_148777505_-_WWTR1_ENST00000360632_chr3_149260324_-_670aa
MSWMFKRDPVWKYLQTVQTGVHGNFPRLSTPTFFPRFEFQDVIPPDDFLTSDEEVDSVLFGSLRGHVVGLRTYTGVVNNNEMVALQRDPN
NPTDKNAIKVNNVNGNQVGHLKKELAGALATIMDNKLAQIEGVVPFGANNAFTMPLHMTFWGKEENRKAVSDQLKKHGFKLGPAPKTLGF
NLESGWGSGRAGPSTSMPVHAAVQMTTEQLKTEFDKLFEDLKEDDKTHEMEPAEAIETPLLPHQKQALAWMVSRENSKELPPFWEQRNDL
YTNTITNFSEKDRPENVHGGILADDMGLGKTLTAIAVILTNFHDGRPLPIERVKKNLLKKETNVNDDSMKLGGNNTSEKADGLSKDASRC
SEQPSISDIKEKSKFRMSELSSSRPKRRKTAVQYIESSDSEEIETSELPQKMKGKLKNVQSETKGRAKAGSSKVIEDVAFACALTSSVPT
TKKKMLKKVMNHQHQQQMAPSTLSQQNHPTQNPPAGLMSMPNALTTQQQQQQKLRLQRIQMERERIRMRQEELMRQEAALCRQLPMEAET
LAPVQAAVNPPTMTPDMRSITNNSSDPFLNGGPTHSREQSTDSGLGLGCYSVPTTPEDFLSNVDEMDTGENAGQTPMNINPQQTRFPDFL

>In-frame_HLTF_ENST00000494055_chr3_148777505_-_WWTR1_ENST00000467467_chr3_149260324_-_670aa
MSWMFKRDPVWKYLQTVQTGVHGNFPRLSTPTFFPRFEFQDVIPPDDFLTSDEEVDSVLFGSLRGHVVGLRTYTGVVNNNEMVALQRDPN
NPTDKNAIKVNNVNGNQVGHLKKELAGALATIMDNKLAQIEGVVPFGANNAFTMPLHMTFWGKEENRKAVSDQLKKHGFKLGPAPKTLGF
NLESGWGSGRAGPSTSMPVHAAVQMTTEQLKTEFDKLFEDLKEDDKTHEMEPAEAIETPLLPHQKQALAWMVSRENSKELPPFWEQRNDL
YTNTITNFSEKDRPENVHGGILADDMGLGKTLTAIAVILTNFHDGRPLPIERVKKNLLKKETNVNDDSMKLGGNNTSEKADGLSKDASRC
SEQPSISDIKEKSKFRMSELSSSRPKRRKTAVQYIESSDSEEIETSELPQKMKGKLKNVQSETKGRAKAGSSKVIEDVAFACALTSSVPT
TKKKMLKKVMNHQHQQQMAPSTLSQQNHPTQNPPAGLMSMPNALTTQQQQQQKLRLQRIQMERERIRMRQEELMRQEAALCRQLPMEAET
LAPVQAAVNPPTMTPDMRSITNNSSDPFLNGGPTHSREQSTDSGLGLGCYSVPTTPEDFLSNVDEMDTGENAGQTPMNINPQQTRFPDFL


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_HLTF_ENST00000465259_chr3_148777505_-_WWTR1_ENST00000465804_chr3_149260324_-_2007nt
ATGTCCTGGATGTTCAAGAGGGATCCAGTTTGGAAGTACTTGCAGACTGTCCAGTATGGAGTTCATGGAAATTTTCCACGCCTCTCATAT
CCAACTTTCTTTCCACGTTTTGAATTCCAAGATGTTATCCCTCCAGATGACTTTCTAACTAGTGATGAAGAAGTAGATTCCGTTTTATTT
GGAAGTTTGAGAGGTCATGTGGTTGGACTACGCTATTACACGGGAGTAGTTAATAATAATGAAATGGTTGCATTACAACGAGATCCTAAT
AACCCTTATGATAAGAATGCAATTAAAGTAAACAATGTGAATGGAAATCAAGTTGGCCATTTAAAGAAAGAGCTTGCAGGTGCTTTGGCC
TATATCATGGACAACAAATTGGCACAAATTGAAGGGGTAGTTCCTTTTGGTGCAAACAATGCTTTTACCATGCCTCTGCATATGACTTTT
TGGGGAAAAGAAGAAAATAGAAAAGCGGTTTCAGATCAGTTGAAGAAACATGGATTTAAATTGGGTCCTGCACCAAAAACTTTAGGATTC
AATTTGGAAAGTGGTTGGGGCTCTGGAAGAGCTGGACCAAGCTATAGTATGCCAGTGCATGCTGCAGTACAGATGACAACTGAACAGCTT
AAAACAGAATTTGACAAATTGTTTGAAGATTTAAAAGAAGATGATAAAACCCATGAAATGGAACCAGCTGAGGCTATTGAAACACCACTG
CTTCCACATCAAAAACAAGCTCTAGCTTGGATGGTGTCACGGGAAAATAGCAAAGAACTTCCACCATTCTGGGAACAGCGAAATGACTTA
TACTATAACACAATAACAAATTTTTCTGAGAAGGACCGACCAGAAAATGTCCATGGAGGAATTTTAGCTGATGATATGGGTTTGGGTAAA
ACTCTTACGGCCATTGCAGTAATCCTTACCAACTTCCATGATGGCAGACCTCTTCCTATTGAAAGAGTTAAAAAGAATCTACTGAAGAAG
GAATATAATGTTAACGATGACTCTATGAAACTTGGAGGAAACAATACCAGTGAAAAGGCAGATGGACTAAGCAAAGACGCATCTAGATGT
AGTGAACAACCCAGTATTTCAGATATCAAGGAGAAGAGTAAGTTTCGCATGTCAGAATTGTCTAGCTCCCGCCCCAAAAGAAGAAAAACT
GCTGTCCAGTACATAGAAAGCAGTGATTCAGAGGAAATTGAAACAAGTGAATTGCCGCAGAAAATGAAAGGCAAACTGAAAAATGTACAG
TCTGAAACTAAAGGCAGGGCGAAAGGATCTTCTAAGGTTATAGAAGATGTGGCATTTGCATGTGCATTAACTTCATCTGTTCCTACAACA
AAAAAGAAAATGTTGAAAAAGGTGATGAATCACCAACACCAGCAGCAGATGGCCCCCAGTACCCTGAGCCAGCAGAACCACCCCACTCAG
AACCCACCCGCAGGGCTCATGAGTATGCCCAATGCGCTGACCACTCAGCAGCAGCAGCAGCAGAAACTGCGGCTTCAGAGAATCCAGATG
GAGAGAGAAAGGATTCGAATGCGCCAAGAGGAGCTCATGAGGCAGGAAGCTGCCCTCTGTCGACAGCTCCCCATGGAAGCTGAGACTCTT
GCCCCAGTTCAGGCTGCTGTCAACCCACCCACGATGACCCCAGACATGAGATCCATCACTAATAATAGCTCAGATCCTTTCCTCAATGGA
GGGCCATATCATTCGAGGGAGCAGAGCACTGACAGTGGCCTGGGGTTAGGGTGCTACAGTGTCCCCACAACTCCGGAGGACTTCCTCAGC
AATGTGGATGAGATGGATACAGGAGAAAACGCAGGACAAACACCCATGAACATCAATCCCCAACAGACCCGTTTCCCTGATTTCCTTGAC
TGTCTTCCAGGAACAAACGTTGACTTAGGAACTTTGGAATCTGAAGACCTGATCCCCCTCTTCAATGATGTAGAGTCTGCTCTGAACAAA

>In-frame_HLTF_ENST00000465259_chr3_148777505_-_WWTR1_ENST00000360632_chr3_149260324_-_2007nt
ATGTCCTGGATGTTCAAGAGGGATCCAGTTTGGAAGTACTTGCAGACTGTCCAGTATGGAGTTCATGGAAATTTTCCACGCCTCTCATAT
CCAACTTTCTTTCCACGTTTTGAATTCCAAGATGTTATCCCTCCAGATGACTTTCTAACTAGTGATGAAGAAGTAGATTCCGTTTTATTT
GGAAGTTTGAGAGGTCATGTGGTTGGACTACGCTATTACACGGGAGTAGTTAATAATAATGAAATGGTTGCATTACAACGAGATCCTAAT
AACCCTTATGATAAGAATGCAATTAAAGTAAACAATGTGAATGGAAATCAAGTTGGCCATTTAAAGAAAGAGCTTGCAGGTGCTTTGGCC
TATATCATGGACAACAAATTGGCACAAATTGAAGGGGTAGTTCCTTTTGGTGCAAACAATGCTTTTACCATGCCTCTGCATATGACTTTT
TGGGGAAAAGAAGAAAATAGAAAAGCGGTTTCAGATCAGTTGAAGAAACATGGATTTAAATTGGGTCCTGCACCAAAAACTTTAGGATTC
AATTTGGAAAGTGGTTGGGGCTCTGGAAGAGCTGGACCAAGCTATAGTATGCCAGTGCATGCTGCAGTACAGATGACAACTGAACAGCTT
AAAACAGAATTTGACAAATTGTTTGAAGATTTAAAAGAAGATGATAAAACCCATGAAATGGAACCAGCTGAGGCTATTGAAACACCACTG
CTTCCACATCAAAAACAAGCTCTAGCTTGGATGGTGTCACGGGAAAATAGCAAAGAACTTCCACCATTCTGGGAACAGCGAAATGACTTA
TACTATAACACAATAACAAATTTTTCTGAGAAGGACCGACCAGAAAATGTCCATGGAGGAATTTTAGCTGATGATATGGGTTTGGGTAAA
ACTCTTACGGCCATTGCAGTAATCCTTACCAACTTCCATGATGGCAGACCTCTTCCTATTGAAAGAGTTAAAAAGAATCTACTGAAGAAG
GAATATAATGTTAACGATGACTCTATGAAACTTGGAGGAAACAATACCAGTGAAAAGGCAGATGGACTAAGCAAAGACGCATCTAGATGT
AGTGAACAACCCAGTATTTCAGATATCAAGGAGAAGAGTAAGTTTCGCATGTCAGAATTGTCTAGCTCCCGCCCCAAAAGAAGAAAAACT
GCTGTCCAGTACATAGAAAGCAGTGATTCAGAGGAAATTGAAACAAGTGAATTGCCGCAGAAAATGAAAGGCAAACTGAAAAATGTACAG
TCTGAAACTAAAGGCAGGGCGAAAGGATCTTCTAAGGTTATAGAAGATGTGGCATTTGCATGTGCATTAACTTCATCTGTTCCTACAACA
AAAAAGAAAATGTTGAAAAAGGTGATGAATCACCAACACCAGCAGCAGATGGCCCCCAGTACCCTGAGCCAGCAGAACCACCCCACTCAG
AACCCACCCGCAGGGCTCATGAGTATGCCCAATGCGCTGACCACTCAGCAGCAGCAGCAGCAGAAACTGCGGCTTCAGAGAATCCAGATG
GAGAGAGAAAGGATTCGAATGCGCCAAGAGGAGCTCATGAGGCAGGAAGCTGCCCTCTGTCGACAGCTCCCCATGGAAGCTGAGACTCTT
GCCCCAGTTCAGGCTGCTGTCAACCCACCCACGATGACCCCAGACATGAGATCCATCACTAATAATAGCTCAGATCCTTTCCTCAATGGA
GGGCCATATCATTCGAGGGAGCAGAGCACTGACAGTGGCCTGGGGTTAGGGTGCTACAGTGTCCCCACAACTCCGGAGGACTTCCTCAGC
AATGTGGATGAGATGGATACAGGAGAAAACGCAGGACAAACACCCATGAACATCAATCCCCAACAGACCCGTTTCCCTGATTTCCTTGAC
TGTCTTCCAGGAACAAACGTTGACTTAGGAACTTTGGAATCTGAAGACCTGATCCCCCTCTTCAATGATGTAGAGTCTGCTCTGAACAAA

>In-frame_HLTF_ENST00000465259_chr3_148777505_-_WWTR1_ENST00000467467_chr3_149260324_-_2007nt
ATGTCCTGGATGTTCAAGAGGGATCCAGTTTGGAAGTACTTGCAGACTGTCCAGTATGGAGTTCATGGAAATTTTCCACGCCTCTCATAT
CCAACTTTCTTTCCACGTTTTGAATTCCAAGATGTTATCCCTCCAGATGACTTTCTAACTAGTGATGAAGAAGTAGATTCCGTTTTATTT
GGAAGTTTGAGAGGTCATGTGGTTGGACTACGCTATTACACGGGAGTAGTTAATAATAATGAAATGGTTGCATTACAACGAGATCCTAAT
AACCCTTATGATAAGAATGCAATTAAAGTAAACAATGTGAATGGAAATCAAGTTGGCCATTTAAAGAAAGAGCTTGCAGGTGCTTTGGCC
TATATCATGGACAACAAATTGGCACAAATTGAAGGGGTAGTTCCTTTTGGTGCAAACAATGCTTTTACCATGCCTCTGCATATGACTTTT
TGGGGAAAAGAAGAAAATAGAAAAGCGGTTTCAGATCAGTTGAAGAAACATGGATTTAAATTGGGTCCTGCACCAAAAACTTTAGGATTC
AATTTGGAAAGTGGTTGGGGCTCTGGAAGAGCTGGACCAAGCTATAGTATGCCAGTGCATGCTGCAGTACAGATGACAACTGAACAGCTT
AAAACAGAATTTGACAAATTGTTTGAAGATTTAAAAGAAGATGATAAAACCCATGAAATGGAACCAGCTGAGGCTATTGAAACACCACTG
CTTCCACATCAAAAACAAGCTCTAGCTTGGATGGTGTCACGGGAAAATAGCAAAGAACTTCCACCATTCTGGGAACAGCGAAATGACTTA
TACTATAACACAATAACAAATTTTTCTGAGAAGGACCGACCAGAAAATGTCCATGGAGGAATTTTAGCTGATGATATGGGTTTGGGTAAA
ACTCTTACGGCCATTGCAGTAATCCTTACCAACTTCCATGATGGCAGACCTCTTCCTATTGAAAGAGTTAAAAAGAATCTACTGAAGAAG
GAATATAATGTTAACGATGACTCTATGAAACTTGGAGGAAACAATACCAGTGAAAAGGCAGATGGACTAAGCAAAGACGCATCTAGATGT
AGTGAACAACCCAGTATTTCAGATATCAAGGAGAAGAGTAAGTTTCGCATGTCAGAATTGTCTAGCTCCCGCCCCAAAAGAAGAAAAACT
GCTGTCCAGTACATAGAAAGCAGTGATTCAGAGGAAATTGAAACAAGTGAATTGCCGCAGAAAATGAAAGGCAAACTGAAAAATGTACAG
TCTGAAACTAAAGGCAGGGCGAAAGGATCTTCTAAGGTTATAGAAGATGTGGCATTTGCATGTGCATTAACTTCATCTGTTCCTACAACA
AAAAAGAAAATGTTGAAAAAGGTGATGAATCACCAACACCAGCAGCAGATGGCCCCCAGTACCCTGAGCCAGCAGAACCACCCCACTCAG
AACCCACCCGCAGGGCTCATGAGTATGCCCAATGCGCTGACCACTCAGCAGCAGCAGCAGCAGAAACTGCGGCTTCAGAGAATCCAGATG
GAGAGAGAAAGGATTCGAATGCGCCAAGAGGAGCTCATGAGGCAGGAAGCTGCCCTCTGTCGACAGCTCCCCATGGAAGCTGAGACTCTT
GCCCCAGTTCAGGCTGCTGTCAACCCACCCACGATGACCCCAGACATGAGATCCATCACTAATAATAGCTCAGATCCTTTCCTCAATGGA
GGGCCATATCATTCGAGGGAGCAGAGCACTGACAGTGGCCTGGGGTTAGGGTGCTACAGTGTCCCCACAACTCCGGAGGACTTCCTCAGC
AATGTGGATGAGATGGATACAGGAGAAAACGCAGGACAAACACCCATGAACATCAATCCCCAACAGACCCGTTTCCCTGATTTCCTTGAC
TGTCTTCCAGGAACAAACGTTGACTTAGGAACTTTGGAATCTGAAGACCTGATCCCCCTCTTCAATGATGTAGAGTCTGCTCTGAACAAA

>In-frame_HLTF_ENST00000310053_chr3_148777505_-_WWTR1_ENST00000465804_chr3_149260324_-_2010nt
ATGTCCTGGATGTTCAAGAGGGATCCAGTTTGGAAGTACTTGCAGACTGTCCAGTATGGAGTTCATGGAAATTTTCCACGCCTCTCATAT
CCAACTTTCTTTCCACGTTTTGAATTCCAAGATGTTATCCCTCCAGATGACTTTCTAACTAGTGATGAAGAAGTAGATTCCGTTTTATTT
GGAAGTTTGAGAGGTCATGTGGTTGGACTACGCTATTACACGGGAGTAGTTAATAATAATGAAATGGTTGCATTACAACGAGATCCTAAT
AACCCTTATGATAAGAATGCAATTAAAGTAAACAATGTGAATGGAAATCAAGTTGGCCATTTAAAGAAAGAGCTTGCAGGTGCTTTGGCC
TATATCATGGACAACAAATTGGCACAAATTGAAGGGGTAGTTCCTTTTGGTGCAAACAATGCTTTTACCATGCCTCTGCATATGACTTTT
TGGGGAAAAGAAGAAAATAGAAAAGCGGTTTCAGATCAGTTGAAGAAACATGGATTTAAATTGGGTCCTGCACCAAAAACTTTAGGATTC
AATTTGGAAAGTGGTTGGGGCTCTGGAAGAGCTGGACCAAGCTATAGTATGCCAGTGCATGCTGCAGTACAGATGACAACTGAACAGCTT
AAAACAGAATTTGACAAATTGTTTGAAGATTTAAAAGAAGATGATAAAACCCATGAAATGGAACCAGCTGAGGCTATTGAAACACCACTG
CTTCCACATCAAAAACAAGCTCTAGCTTGGATGGTGTCACGGGAAAATAGCAAAGAACTTCCACCATTCTGGGAACAGCGAAATGACTTA
TACTATAACACAATAACAAATTTTTCTGAGAAGGACCGACCAGAAAATGTCCATGGAGGAATTTTAGCTGATGATATGGGTTTGGGTAAA
ACTCTTACGGCCATTGCAGTAATCCTTACCAACTTCCATGATGGCAGACCTCTTCCTATTGAAAGAGTTAAAAAGAATCTACTGAAGAAG
GAATATAATGTTAACGATGACTCTATGAAACTTGGAGGAAACAATACCAGTGAAAAGGCAGATGGACTAAGCAAAGACGCATCTAGATGT
AGTGAACAACCCAGTATTTCAGATATCAAGGAGAAGAGTAAGTTTCGCATGTCAGAATTGTCTAGCTCCCGCCCCAAAAGAAGAAAAACT
GCTGTCCAGTACATAGAAAGCAGTGATTCAGAGGAAATTGAAACAAGTGAATTGCCGCAGAAAATGAAAGGCAAACTGAAAAATGTACAG
TCTGAAACTAAAGGCAGGGCGAAAGCAGGATCTTCTAAGGTTATAGAAGATGTGGCATTTGCATGTGCATTAACTTCATCTGTTCCTACA
ACAAAAAAGAAAATGTTGAAAAAGGTGATGAATCACCAACACCAGCAGCAGATGGCCCCCAGTACCCTGAGCCAGCAGAACCACCCCACT
CAGAACCCACCCGCAGGGCTCATGAGTATGCCCAATGCGCTGACCACTCAGCAGCAGCAGCAGCAGAAACTGCGGCTTCAGAGAATCCAG
ATGGAGAGAGAAAGGATTCGAATGCGCCAAGAGGAGCTCATGAGGCAGGAAGCTGCCCTCTGTCGACAGCTCCCCATGGAAGCTGAGACT
CTTGCCCCAGTTCAGGCTGCTGTCAACCCACCCACGATGACCCCAGACATGAGATCCATCACTAATAATAGCTCAGATCCTTTCCTCAAT
GGAGGGCCATATCATTCGAGGGAGCAGAGCACTGACAGTGGCCTGGGGTTAGGGTGCTACAGTGTCCCCACAACTCCGGAGGACTTCCTC
AGCAATGTGGATGAGATGGATACAGGAGAAAACGCAGGACAAACACCCATGAACATCAATCCCCAACAGACCCGTTTCCCTGATTTCCTT
GACTGTCTTCCAGGAACAAACGTTGACTTAGGAACTTTGGAATCTGAAGACCTGATCCCCCTCTTCAATGATGTAGAGTCTGCTCTGAAC

>In-frame_HLTF_ENST00000310053_chr3_148777505_-_WWTR1_ENST00000360632_chr3_149260324_-_2010nt
ATGTCCTGGATGTTCAAGAGGGATCCAGTTTGGAAGTACTTGCAGACTGTCCAGTATGGAGTTCATGGAAATTTTCCACGCCTCTCATAT
CCAACTTTCTTTCCACGTTTTGAATTCCAAGATGTTATCCCTCCAGATGACTTTCTAACTAGTGATGAAGAAGTAGATTCCGTTTTATTT
GGAAGTTTGAGAGGTCATGTGGTTGGACTACGCTATTACACGGGAGTAGTTAATAATAATGAAATGGTTGCATTACAACGAGATCCTAAT
AACCCTTATGATAAGAATGCAATTAAAGTAAACAATGTGAATGGAAATCAAGTTGGCCATTTAAAGAAAGAGCTTGCAGGTGCTTTGGCC
TATATCATGGACAACAAATTGGCACAAATTGAAGGGGTAGTTCCTTTTGGTGCAAACAATGCTTTTACCATGCCTCTGCATATGACTTTT
TGGGGAAAAGAAGAAAATAGAAAAGCGGTTTCAGATCAGTTGAAGAAACATGGATTTAAATTGGGTCCTGCACCAAAAACTTTAGGATTC
AATTTGGAAAGTGGTTGGGGCTCTGGAAGAGCTGGACCAAGCTATAGTATGCCAGTGCATGCTGCAGTACAGATGACAACTGAACAGCTT
AAAACAGAATTTGACAAATTGTTTGAAGATTTAAAAGAAGATGATAAAACCCATGAAATGGAACCAGCTGAGGCTATTGAAACACCACTG
CTTCCACATCAAAAACAAGCTCTAGCTTGGATGGTGTCACGGGAAAATAGCAAAGAACTTCCACCATTCTGGGAACAGCGAAATGACTTA
TACTATAACACAATAACAAATTTTTCTGAGAAGGACCGACCAGAAAATGTCCATGGAGGAATTTTAGCTGATGATATGGGTTTGGGTAAA
ACTCTTACGGCCATTGCAGTAATCCTTACCAACTTCCATGATGGCAGACCTCTTCCTATTGAAAGAGTTAAAAAGAATCTACTGAAGAAG
GAATATAATGTTAACGATGACTCTATGAAACTTGGAGGAAACAATACCAGTGAAAAGGCAGATGGACTAAGCAAAGACGCATCTAGATGT
AGTGAACAACCCAGTATTTCAGATATCAAGGAGAAGAGTAAGTTTCGCATGTCAGAATTGTCTAGCTCCCGCCCCAAAAGAAGAAAAACT
GCTGTCCAGTACATAGAAAGCAGTGATTCAGAGGAAATTGAAACAAGTGAATTGCCGCAGAAAATGAAAGGCAAACTGAAAAATGTACAG
TCTGAAACTAAAGGCAGGGCGAAAGCAGGATCTTCTAAGGTTATAGAAGATGTGGCATTTGCATGTGCATTAACTTCATCTGTTCCTACA
ACAAAAAAGAAAATGTTGAAAAAGGTGATGAATCACCAACACCAGCAGCAGATGGCCCCCAGTACCCTGAGCCAGCAGAACCACCCCACT
CAGAACCCACCCGCAGGGCTCATGAGTATGCCCAATGCGCTGACCACTCAGCAGCAGCAGCAGCAGAAACTGCGGCTTCAGAGAATCCAG
ATGGAGAGAGAAAGGATTCGAATGCGCCAAGAGGAGCTCATGAGGCAGGAAGCTGCCCTCTGTCGACAGCTCCCCATGGAAGCTGAGACT
CTTGCCCCAGTTCAGGCTGCTGTCAACCCACCCACGATGACCCCAGACATGAGATCCATCACTAATAATAGCTCAGATCCTTTCCTCAAT
GGAGGGCCATATCATTCGAGGGAGCAGAGCACTGACAGTGGCCTGGGGTTAGGGTGCTACAGTGTCCCCACAACTCCGGAGGACTTCCTC
AGCAATGTGGATGAGATGGATACAGGAGAAAACGCAGGACAAACACCCATGAACATCAATCCCCAACAGACCCGTTTCCCTGATTTCCTT
GACTGTCTTCCAGGAACAAACGTTGACTTAGGAACTTTGGAATCTGAAGACCTGATCCCCCTCTTCAATGATGTAGAGTCTGCTCTGAAC

>In-frame_HLTF_ENST00000310053_chr3_148777505_-_WWTR1_ENST00000467467_chr3_149260324_-_2010nt
ATGTCCTGGATGTTCAAGAGGGATCCAGTTTGGAAGTACTTGCAGACTGTCCAGTATGGAGTTCATGGAAATTTTCCACGCCTCTCATAT
CCAACTTTCTTTCCACGTTTTGAATTCCAAGATGTTATCCCTCCAGATGACTTTCTAACTAGTGATGAAGAAGTAGATTCCGTTTTATTT
GGAAGTTTGAGAGGTCATGTGGTTGGACTACGCTATTACACGGGAGTAGTTAATAATAATGAAATGGTTGCATTACAACGAGATCCTAAT
AACCCTTATGATAAGAATGCAATTAAAGTAAACAATGTGAATGGAAATCAAGTTGGCCATTTAAAGAAAGAGCTTGCAGGTGCTTTGGCC
TATATCATGGACAACAAATTGGCACAAATTGAAGGGGTAGTTCCTTTTGGTGCAAACAATGCTTTTACCATGCCTCTGCATATGACTTTT
TGGGGAAAAGAAGAAAATAGAAAAGCGGTTTCAGATCAGTTGAAGAAACATGGATTTAAATTGGGTCCTGCACCAAAAACTTTAGGATTC
AATTTGGAAAGTGGTTGGGGCTCTGGAAGAGCTGGACCAAGCTATAGTATGCCAGTGCATGCTGCAGTACAGATGACAACTGAACAGCTT
AAAACAGAATTTGACAAATTGTTTGAAGATTTAAAAGAAGATGATAAAACCCATGAAATGGAACCAGCTGAGGCTATTGAAACACCACTG
CTTCCACATCAAAAACAAGCTCTAGCTTGGATGGTGTCACGGGAAAATAGCAAAGAACTTCCACCATTCTGGGAACAGCGAAATGACTTA
TACTATAACACAATAACAAATTTTTCTGAGAAGGACCGACCAGAAAATGTCCATGGAGGAATTTTAGCTGATGATATGGGTTTGGGTAAA
ACTCTTACGGCCATTGCAGTAATCCTTACCAACTTCCATGATGGCAGACCTCTTCCTATTGAAAGAGTTAAAAAGAATCTACTGAAGAAG
GAATATAATGTTAACGATGACTCTATGAAACTTGGAGGAAACAATACCAGTGAAAAGGCAGATGGACTAAGCAAAGACGCATCTAGATGT
AGTGAACAACCCAGTATTTCAGATATCAAGGAGAAGAGTAAGTTTCGCATGTCAGAATTGTCTAGCTCCCGCCCCAAAAGAAGAAAAACT
GCTGTCCAGTACATAGAAAGCAGTGATTCAGAGGAAATTGAAACAAGTGAATTGCCGCAGAAAATGAAAGGCAAACTGAAAAATGTACAG
TCTGAAACTAAAGGCAGGGCGAAAGCAGGATCTTCTAAGGTTATAGAAGATGTGGCATTTGCATGTGCATTAACTTCATCTGTTCCTACA
ACAAAAAAGAAAATGTTGAAAAAGGTGATGAATCACCAACACCAGCAGCAGATGGCCCCCAGTACCCTGAGCCAGCAGAACCACCCCACT
CAGAACCCACCCGCAGGGCTCATGAGTATGCCCAATGCGCTGACCACTCAGCAGCAGCAGCAGCAGAAACTGCGGCTTCAGAGAATCCAG
ATGGAGAGAGAAAGGATTCGAATGCGCCAAGAGGAGCTCATGAGGCAGGAAGCTGCCCTCTGTCGACAGCTCCCCATGGAAGCTGAGACT
CTTGCCCCAGTTCAGGCTGCTGTCAACCCACCCACGATGACCCCAGACATGAGATCCATCACTAATAATAGCTCAGATCCTTTCCTCAAT
GGAGGGCCATATCATTCGAGGGAGCAGAGCACTGACAGTGGCCTGGGGTTAGGGTGCTACAGTGTCCCCACAACTCCGGAGGACTTCCTC
AGCAATGTGGATGAGATGGATACAGGAGAAAACGCAGGACAAACACCCATGAACATCAATCCCCAACAGACCCGTTTCCCTGATTTCCTT
GACTGTCTTCCAGGAACAAACGTTGACTTAGGAACTTTGGAATCTGAAGACCTGATCCCCCTCTTCAATGATGTAGAGTCTGCTCTGAAC

>In-frame_HLTF_ENST00000392912_chr3_148777505_-_WWTR1_ENST00000465804_chr3_149260324_-_2010nt
ATGTCCTGGATGTTCAAGAGGGATCCAGTTTGGAAGTACTTGCAGACTGTCCAGTATGGAGTTCATGGAAATTTTCCACGCCTCTCATAT
CCAACTTTCTTTCCACGTTTTGAATTCCAAGATGTTATCCCTCCAGATGACTTTCTAACTAGTGATGAAGAAGTAGATTCCGTTTTATTT
GGAAGTTTGAGAGGTCATGTGGTTGGACTACGCTATTACACGGGAGTAGTTAATAATAATGAAATGGTTGCATTACAACGAGATCCTAAT
AACCCTTATGATAAGAATGCAATTAAAGTAAACAATGTGAATGGAAATCAAGTTGGCCATTTAAAGAAAGAGCTTGCAGGTGCTTTGGCC
TATATCATGGACAACAAATTGGCACAAATTGAAGGGGTAGTTCCTTTTGGTGCAAACAATGCTTTTACCATGCCTCTGCATATGACTTTT
TGGGGAAAAGAAGAAAATAGAAAAGCGGTTTCAGATCAGTTGAAGAAACATGGATTTAAATTGGGTCCTGCACCAAAAACTTTAGGATTC
AATTTGGAAAGTGGTTGGGGCTCTGGAAGAGCTGGACCAAGCTATAGTATGCCAGTGCATGCTGCAGTACAGATGACAACTGAACAGCTT
AAAACAGAATTTGACAAATTGTTTGAAGATTTAAAAGAAGATGATAAAACCCATGAAATGGAACCAGCTGAGGCTATTGAAACACCACTG
CTTCCACATCAAAAACAAGCTCTAGCTTGGATGGTGTCACGGGAAAATAGCAAAGAACTTCCACCATTCTGGGAACAGCGAAATGACTTA
TACTATAACACAATAACAAATTTTTCTGAGAAGGACCGACCAGAAAATGTCCATGGAGGAATTTTAGCTGATGATATGGGTTTGGGTAAA
ACTCTTACGGCCATTGCAGTAATCCTTACCAACTTCCATGATGGCAGACCTCTTCCTATTGAAAGAGTTAAAAAGAATCTACTGAAGAAG
GAATATAATGTTAACGATGACTCTATGAAACTTGGAGGAAACAATACCAGTGAAAAGGCAGATGGACTAAGCAAAGACGCATCTAGATGT
AGTGAACAACCCAGTATTTCAGATATCAAGGAGAAGAGTAAGTTTCGCATGTCAGAATTGTCTAGCTCCCGCCCCAAAAGAAGAAAAACT
GCTGTCCAGTACATAGAAAGCAGTGATTCAGAGGAAATTGAAACAAGTGAATTGCCGCAGAAAATGAAAGGCAAACTGAAAAATGTACAG
TCTGAAACTAAAGGCAGGGCGAAAGCAGGATCTTCTAAGGTTATAGAAGATGTGGCATTTGCATGTGCATTAACTTCATCTGTTCCTACA
ACAAAAAAGAAAATGTTGAAAAAGGTGATGAATCACCAACACCAGCAGCAGATGGCCCCCAGTACCCTGAGCCAGCAGAACCACCCCACT
CAGAACCCACCCGCAGGGCTCATGAGTATGCCCAATGCGCTGACCACTCAGCAGCAGCAGCAGCAGAAACTGCGGCTTCAGAGAATCCAG
ATGGAGAGAGAAAGGATTCGAATGCGCCAAGAGGAGCTCATGAGGCAGGAAGCTGCCCTCTGTCGACAGCTCCCCATGGAAGCTGAGACT
CTTGCCCCAGTTCAGGCTGCTGTCAACCCACCCACGATGACCCCAGACATGAGATCCATCACTAATAATAGCTCAGATCCTTTCCTCAAT
GGAGGGCCATATCATTCGAGGGAGCAGAGCACTGACAGTGGCCTGGGGTTAGGGTGCTACAGTGTCCCCACAACTCCGGAGGACTTCCTC
AGCAATGTGGATGAGATGGATACAGGAGAAAACGCAGGACAAACACCCATGAACATCAATCCCCAACAGACCCGTTTCCCTGATTTCCTT
GACTGTCTTCCAGGAACAAACGTTGACTTAGGAACTTTGGAATCTGAAGACCTGATCCCCCTCTTCAATGATGTAGAGTCTGCTCTGAAC

>In-frame_HLTF_ENST00000392912_chr3_148777505_-_WWTR1_ENST00000360632_chr3_149260324_-_2010nt
ATGTCCTGGATGTTCAAGAGGGATCCAGTTTGGAAGTACTTGCAGACTGTCCAGTATGGAGTTCATGGAAATTTTCCACGCCTCTCATAT
CCAACTTTCTTTCCACGTTTTGAATTCCAAGATGTTATCCCTCCAGATGACTTTCTAACTAGTGATGAAGAAGTAGATTCCGTTTTATTT
GGAAGTTTGAGAGGTCATGTGGTTGGACTACGCTATTACACGGGAGTAGTTAATAATAATGAAATGGTTGCATTACAACGAGATCCTAAT
AACCCTTATGATAAGAATGCAATTAAAGTAAACAATGTGAATGGAAATCAAGTTGGCCATTTAAAGAAAGAGCTTGCAGGTGCTTTGGCC
TATATCATGGACAACAAATTGGCACAAATTGAAGGGGTAGTTCCTTTTGGTGCAAACAATGCTTTTACCATGCCTCTGCATATGACTTTT
TGGGGAAAAGAAGAAAATAGAAAAGCGGTTTCAGATCAGTTGAAGAAACATGGATTTAAATTGGGTCCTGCACCAAAAACTTTAGGATTC
AATTTGGAAAGTGGTTGGGGCTCTGGAAGAGCTGGACCAAGCTATAGTATGCCAGTGCATGCTGCAGTACAGATGACAACTGAACAGCTT
AAAACAGAATTTGACAAATTGTTTGAAGATTTAAAAGAAGATGATAAAACCCATGAAATGGAACCAGCTGAGGCTATTGAAACACCACTG
CTTCCACATCAAAAACAAGCTCTAGCTTGGATGGTGTCACGGGAAAATAGCAAAGAACTTCCACCATTCTGGGAACAGCGAAATGACTTA
TACTATAACACAATAACAAATTTTTCTGAGAAGGACCGACCAGAAAATGTCCATGGAGGAATTTTAGCTGATGATATGGGTTTGGGTAAA
ACTCTTACGGCCATTGCAGTAATCCTTACCAACTTCCATGATGGCAGACCTCTTCCTATTGAAAGAGTTAAAAAGAATCTACTGAAGAAG
GAATATAATGTTAACGATGACTCTATGAAACTTGGAGGAAACAATACCAGTGAAAAGGCAGATGGACTAAGCAAAGACGCATCTAGATGT
AGTGAACAACCCAGTATTTCAGATATCAAGGAGAAGAGTAAGTTTCGCATGTCAGAATTGTCTAGCTCCCGCCCCAAAAGAAGAAAAACT
GCTGTCCAGTACATAGAAAGCAGTGATTCAGAGGAAATTGAAACAAGTGAATTGCCGCAGAAAATGAAAGGCAAACTGAAAAATGTACAG
TCTGAAACTAAAGGCAGGGCGAAAGCAGGATCTTCTAAGGTTATAGAAGATGTGGCATTTGCATGTGCATTAACTTCATCTGTTCCTACA
ACAAAAAAGAAAATGTTGAAAAAGGTGATGAATCACCAACACCAGCAGCAGATGGCCCCCAGTACCCTGAGCCAGCAGAACCACCCCACT
CAGAACCCACCCGCAGGGCTCATGAGTATGCCCAATGCGCTGACCACTCAGCAGCAGCAGCAGCAGAAACTGCGGCTTCAGAGAATCCAG
ATGGAGAGAGAAAGGATTCGAATGCGCCAAGAGGAGCTCATGAGGCAGGAAGCTGCCCTCTGTCGACAGCTCCCCATGGAAGCTGAGACT
CTTGCCCCAGTTCAGGCTGCTGTCAACCCACCCACGATGACCCCAGACATGAGATCCATCACTAATAATAGCTCAGATCCTTTCCTCAAT
GGAGGGCCATATCATTCGAGGGAGCAGAGCACTGACAGTGGCCTGGGGTTAGGGTGCTACAGTGTCCCCACAACTCCGGAGGACTTCCTC
AGCAATGTGGATGAGATGGATACAGGAGAAAACGCAGGACAAACACCCATGAACATCAATCCCCAACAGACCCGTTTCCCTGATTTCCTT
GACTGTCTTCCAGGAACAAACGTTGACTTAGGAACTTTGGAATCTGAAGACCTGATCCCCCTCTTCAATGATGTAGAGTCTGCTCTGAAC

>In-frame_HLTF_ENST00000392912_chr3_148777505_-_WWTR1_ENST00000467467_chr3_149260324_-_2010nt
ATGTCCTGGATGTTCAAGAGGGATCCAGTTTGGAAGTACTTGCAGACTGTCCAGTATGGAGTTCATGGAAATTTTCCACGCCTCTCATAT
CCAACTTTCTTTCCACGTTTTGAATTCCAAGATGTTATCCCTCCAGATGACTTTCTAACTAGTGATGAAGAAGTAGATTCCGTTTTATTT
GGAAGTTTGAGAGGTCATGTGGTTGGACTACGCTATTACACGGGAGTAGTTAATAATAATGAAATGGTTGCATTACAACGAGATCCTAAT
AACCCTTATGATAAGAATGCAATTAAAGTAAACAATGTGAATGGAAATCAAGTTGGCCATTTAAAGAAAGAGCTTGCAGGTGCTTTGGCC
TATATCATGGACAACAAATTGGCACAAATTGAAGGGGTAGTTCCTTTTGGTGCAAACAATGCTTTTACCATGCCTCTGCATATGACTTTT
TGGGGAAAAGAAGAAAATAGAAAAGCGGTTTCAGATCAGTTGAAGAAACATGGATTTAAATTGGGTCCTGCACCAAAAACTTTAGGATTC
AATTTGGAAAGTGGTTGGGGCTCTGGAAGAGCTGGACCAAGCTATAGTATGCCAGTGCATGCTGCAGTACAGATGACAACTGAACAGCTT
AAAACAGAATTTGACAAATTGTTTGAAGATTTAAAAGAAGATGATAAAACCCATGAAATGGAACCAGCTGAGGCTATTGAAACACCACTG
CTTCCACATCAAAAACAAGCTCTAGCTTGGATGGTGTCACGGGAAAATAGCAAAGAACTTCCACCATTCTGGGAACAGCGAAATGACTTA
TACTATAACACAATAACAAATTTTTCTGAGAAGGACCGACCAGAAAATGTCCATGGAGGAATTTTAGCTGATGATATGGGTTTGGGTAAA
ACTCTTACGGCCATTGCAGTAATCCTTACCAACTTCCATGATGGCAGACCTCTTCCTATTGAAAGAGTTAAAAAGAATCTACTGAAGAAG
GAATATAATGTTAACGATGACTCTATGAAACTTGGAGGAAACAATACCAGTGAAAAGGCAGATGGACTAAGCAAAGACGCATCTAGATGT
AGTGAACAACCCAGTATTTCAGATATCAAGGAGAAGAGTAAGTTTCGCATGTCAGAATTGTCTAGCTCCCGCCCCAAAAGAAGAAAAACT
GCTGTCCAGTACATAGAAAGCAGTGATTCAGAGGAAATTGAAACAAGTGAATTGCCGCAGAAAATGAAAGGCAAACTGAAAAATGTACAG
TCTGAAACTAAAGGCAGGGCGAAAGCAGGATCTTCTAAGGTTATAGAAGATGTGGCATTTGCATGTGCATTAACTTCATCTGTTCCTACA
ACAAAAAAGAAAATGTTGAAAAAGGTGATGAATCACCAACACCAGCAGCAGATGGCCCCCAGTACCCTGAGCCAGCAGAACCACCCCACT
CAGAACCCACCCGCAGGGCTCATGAGTATGCCCAATGCGCTGACCACTCAGCAGCAGCAGCAGCAGAAACTGCGGCTTCAGAGAATCCAG
ATGGAGAGAGAAAGGATTCGAATGCGCCAAGAGGAGCTCATGAGGCAGGAAGCTGCCCTCTGTCGACAGCTCCCCATGGAAGCTGAGACT
CTTGCCCCAGTTCAGGCTGCTGTCAACCCACCCACGATGACCCCAGACATGAGATCCATCACTAATAATAGCTCAGATCCTTTCCTCAAT
GGAGGGCCATATCATTCGAGGGAGCAGAGCACTGACAGTGGCCTGGGGTTAGGGTGCTACAGTGTCCCCACAACTCCGGAGGACTTCCTC
AGCAATGTGGATGAGATGGATACAGGAGAAAACGCAGGACAAACACCCATGAACATCAATCCCCAACAGACCCGTTTCCCTGATTTCCTT
GACTGTCTTCCAGGAACAAACGTTGACTTAGGAACTTTGGAATCTGAAGACCTGATCCCCCTCTTCAATGATGTAGAGTCTGCTCTGAAC

>In-frame_HLTF_ENST00000494055_chr3_148777505_-_WWTR1_ENST00000465804_chr3_149260324_-_2010nt
ATGTCCTGGATGTTCAAGAGGGATCCAGTTTGGAAGTACTTGCAGACTGTCCAGTATGGAGTTCATGGAAATTTTCCACGCCTCTCATAT
CCAACTTTCTTTCCACGTTTTGAATTCCAAGATGTTATCCCTCCAGATGACTTTCTAACTAGTGATGAAGAAGTAGATTCCGTTTTATTT
GGAAGTTTGAGAGGTCATGTGGTTGGACTACGCTATTACACGGGAGTAGTTAATAATAATGAAATGGTTGCATTACAACGAGATCCTAAT
AACCCTTATGATAAGAATGCAATTAAAGTAAACAATGTGAATGGAAATCAAGTTGGCCATTTAAAGAAAGAGCTTGCAGGTGCTTTGGCC
TATATCATGGACAACAAATTGGCACAAATTGAAGGGGTAGTTCCTTTTGGTGCAAACAATGCTTTTACCATGCCTCTGCATATGACTTTT
TGGGGAAAAGAAGAAAATAGAAAAGCGGTTTCAGATCAGTTGAAGAAACATGGATTTAAATTGGGTCCTGCACCAAAAACTTTAGGATTC
AATTTGGAAAGTGGTTGGGGCTCTGGAAGAGCTGGACCAAGCTATAGTATGCCAGTGCATGCTGCAGTACAGATGACAACTGAACAGCTT
AAAACAGAATTTGACAAATTGTTTGAAGATTTAAAAGAAGATGATAAAACCCATGAAATGGAACCAGCTGAGGCTATTGAAACACCACTG
CTTCCACATCAAAAACAAGCTCTAGCTTGGATGGTGTCACGGGAAAATAGCAAAGAACTTCCACCATTCTGGGAACAGCGAAATGACTTA
TACTATAACACAATAACAAATTTTTCTGAGAAGGACCGACCAGAAAATGTCCATGGAGGAATTTTAGCTGATGATATGGGTTTGGGTAAA
ACTCTTACGGCCATTGCAGTAATCCTTACCAACTTCCATGATGGCAGACCTCTTCCTATTGAAAGAGTTAAAAAGAATCTACTGAAGAAG
GAATATAATGTTAACGATGACTCTATGAAACTTGGAGGAAACAATACCAGTGAAAAGGCAGATGGACTAAGCAAAGACGCATCTAGATGT
AGTGAACAACCCAGTATTTCAGATATCAAGGAGAAGAGTAAGTTTCGCATGTCAGAATTGTCTAGCTCCCGCCCCAAAAGAAGAAAAACT
GCTGTCCAGTACATAGAAAGCAGTGATTCAGAGGAAATTGAAACAAGTGAATTGCCGCAGAAAATGAAAGGCAAACTGAAAAATGTACAG
TCTGAAACTAAAGGCAGGGCGAAAGCAGGATCTTCTAAGGTTATAGAAGATGTGGCATTTGCATGTGCATTAACTTCATCTGTTCCTACA
ACAAAAAAGAAAATGTTGAAAAAGGTGATGAATCACCAACACCAGCAGCAGATGGCCCCCAGTACCCTGAGCCAGCAGAACCACCCCACT
CAGAACCCACCCGCAGGGCTCATGAGTATGCCCAATGCGCTGACCACTCAGCAGCAGCAGCAGCAGAAACTGCGGCTTCAGAGAATCCAG
ATGGAGAGAGAAAGGATTCGAATGCGCCAAGAGGAGCTCATGAGGCAGGAAGCTGCCCTCTGTCGACAGCTCCCCATGGAAGCTGAGACT
CTTGCCCCAGTTCAGGCTGCTGTCAACCCACCCACGATGACCCCAGACATGAGATCCATCACTAATAATAGCTCAGATCCTTTCCTCAAT
GGAGGGCCATATCATTCGAGGGAGCAGAGCACTGACAGTGGCCTGGGGTTAGGGTGCTACAGTGTCCCCACAACTCCGGAGGACTTCCTC
AGCAATGTGGATGAGATGGATACAGGAGAAAACGCAGGACAAACACCCATGAACATCAATCCCCAACAGACCCGTTTCCCTGATTTCCTT
GACTGTCTTCCAGGAACAAACGTTGACTTAGGAACTTTGGAATCTGAAGACCTGATCCCCCTCTTCAATGATGTAGAGTCTGCTCTGAAC

>In-frame_HLTF_ENST00000494055_chr3_148777505_-_WWTR1_ENST00000360632_chr3_149260324_-_2010nt
ATGTCCTGGATGTTCAAGAGGGATCCAGTTTGGAAGTACTTGCAGACTGTCCAGTATGGAGTTCATGGAAATTTTCCACGCCTCTCATAT
CCAACTTTCTTTCCACGTTTTGAATTCCAAGATGTTATCCCTCCAGATGACTTTCTAACTAGTGATGAAGAAGTAGATTCCGTTTTATTT
GGAAGTTTGAGAGGTCATGTGGTTGGACTACGCTATTACACGGGAGTAGTTAATAATAATGAAATGGTTGCATTACAACGAGATCCTAAT
AACCCTTATGATAAGAATGCAATTAAAGTAAACAATGTGAATGGAAATCAAGTTGGCCATTTAAAGAAAGAGCTTGCAGGTGCTTTGGCC
TATATCATGGACAACAAATTGGCACAAATTGAAGGGGTAGTTCCTTTTGGTGCAAACAATGCTTTTACCATGCCTCTGCATATGACTTTT
TGGGGAAAAGAAGAAAATAGAAAAGCGGTTTCAGATCAGTTGAAGAAACATGGATTTAAATTGGGTCCTGCACCAAAAACTTTAGGATTC
AATTTGGAAAGTGGTTGGGGCTCTGGAAGAGCTGGACCAAGCTATAGTATGCCAGTGCATGCTGCAGTACAGATGACAACTGAACAGCTT
AAAACAGAATTTGACAAATTGTTTGAAGATTTAAAAGAAGATGATAAAACCCATGAAATGGAACCAGCTGAGGCTATTGAAACACCACTG
CTTCCACATCAAAAACAAGCTCTAGCTTGGATGGTGTCACGGGAAAATAGCAAAGAACTTCCACCATTCTGGGAACAGCGAAATGACTTA
TACTATAACACAATAACAAATTTTTCTGAGAAGGACCGACCAGAAAATGTCCATGGAGGAATTTTAGCTGATGATATGGGTTTGGGTAAA
ACTCTTACGGCCATTGCAGTAATCCTTACCAACTTCCATGATGGCAGACCTCTTCCTATTGAAAGAGTTAAAAAGAATCTACTGAAGAAG
GAATATAATGTTAACGATGACTCTATGAAACTTGGAGGAAACAATACCAGTGAAAAGGCAGATGGACTAAGCAAAGACGCATCTAGATGT
AGTGAACAACCCAGTATTTCAGATATCAAGGAGAAGAGTAAGTTTCGCATGTCAGAATTGTCTAGCTCCCGCCCCAAAAGAAGAAAAACT
GCTGTCCAGTACATAGAAAGCAGTGATTCAGAGGAAATTGAAACAAGTGAATTGCCGCAGAAAATGAAAGGCAAACTGAAAAATGTACAG
TCTGAAACTAAAGGCAGGGCGAAAGCAGGATCTTCTAAGGTTATAGAAGATGTGGCATTTGCATGTGCATTAACTTCATCTGTTCCTACA
ACAAAAAAGAAAATGTTGAAAAAGGTGATGAATCACCAACACCAGCAGCAGATGGCCCCCAGTACCCTGAGCCAGCAGAACCACCCCACT
CAGAACCCACCCGCAGGGCTCATGAGTATGCCCAATGCGCTGACCACTCAGCAGCAGCAGCAGCAGAAACTGCGGCTTCAGAGAATCCAG
ATGGAGAGAGAAAGGATTCGAATGCGCCAAGAGGAGCTCATGAGGCAGGAAGCTGCCCTCTGTCGACAGCTCCCCATGGAAGCTGAGACT
CTTGCCCCAGTTCAGGCTGCTGTCAACCCACCCACGATGACCCCAGACATGAGATCCATCACTAATAATAGCTCAGATCCTTTCCTCAAT
GGAGGGCCATATCATTCGAGGGAGCAGAGCACTGACAGTGGCCTGGGGTTAGGGTGCTACAGTGTCCCCACAACTCCGGAGGACTTCCTC
AGCAATGTGGATGAGATGGATACAGGAGAAAACGCAGGACAAACACCCATGAACATCAATCCCCAACAGACCCGTTTCCCTGATTTCCTT
GACTGTCTTCCAGGAACAAACGTTGACTTAGGAACTTTGGAATCTGAAGACCTGATCCCCCTCTTCAATGATGTAGAGTCTGCTCTGAAC

>In-frame_HLTF_ENST00000494055_chr3_148777505_-_WWTR1_ENST00000467467_chr3_149260324_-_2010nt
ATGTCCTGGATGTTCAAGAGGGATCCAGTTTGGAAGTACTTGCAGACTGTCCAGTATGGAGTTCATGGAAATTTTCCACGCCTCTCATAT
CCAACTTTCTTTCCACGTTTTGAATTCCAAGATGTTATCCCTCCAGATGACTTTCTAACTAGTGATGAAGAAGTAGATTCCGTTTTATTT
GGAAGTTTGAGAGGTCATGTGGTTGGACTACGCTATTACACGGGAGTAGTTAATAATAATGAAATGGTTGCATTACAACGAGATCCTAAT
AACCCTTATGATAAGAATGCAATTAAAGTAAACAATGTGAATGGAAATCAAGTTGGCCATTTAAAGAAAGAGCTTGCAGGTGCTTTGGCC
TATATCATGGACAACAAATTGGCACAAATTGAAGGGGTAGTTCCTTTTGGTGCAAACAATGCTTTTACCATGCCTCTGCATATGACTTTT
TGGGGAAAAGAAGAAAATAGAAAAGCGGTTTCAGATCAGTTGAAGAAACATGGATTTAAATTGGGTCCTGCACCAAAAACTTTAGGATTC
AATTTGGAAAGTGGTTGGGGCTCTGGAAGAGCTGGACCAAGCTATAGTATGCCAGTGCATGCTGCAGTACAGATGACAACTGAACAGCTT
AAAACAGAATTTGACAAATTGTTTGAAGATTTAAAAGAAGATGATAAAACCCATGAAATGGAACCAGCTGAGGCTATTGAAACACCACTG
CTTCCACATCAAAAACAAGCTCTAGCTTGGATGGTGTCACGGGAAAATAGCAAAGAACTTCCACCATTCTGGGAACAGCGAAATGACTTA
TACTATAACACAATAACAAATTTTTCTGAGAAGGACCGACCAGAAAATGTCCATGGAGGAATTTTAGCTGATGATATGGGTTTGGGTAAA
ACTCTTACGGCCATTGCAGTAATCCTTACCAACTTCCATGATGGCAGACCTCTTCCTATTGAAAGAGTTAAAAAGAATCTACTGAAGAAG
GAATATAATGTTAACGATGACTCTATGAAACTTGGAGGAAACAATACCAGTGAAAAGGCAGATGGACTAAGCAAAGACGCATCTAGATGT
AGTGAACAACCCAGTATTTCAGATATCAAGGAGAAGAGTAAGTTTCGCATGTCAGAATTGTCTAGCTCCCGCCCCAAAAGAAGAAAAACT
GCTGTCCAGTACATAGAAAGCAGTGATTCAGAGGAAATTGAAACAAGTGAATTGCCGCAGAAAATGAAAGGCAAACTGAAAAATGTACAG
TCTGAAACTAAAGGCAGGGCGAAAGCAGGATCTTCTAAGGTTATAGAAGATGTGGCATTTGCATGTGCATTAACTTCATCTGTTCCTACA
ACAAAAAAGAAAATGTTGAAAAAGGTGATGAATCACCAACACCAGCAGCAGATGGCCCCCAGTACCCTGAGCCAGCAGAACCACCCCACT
CAGAACCCACCCGCAGGGCTCATGAGTATGCCCAATGCGCTGACCACTCAGCAGCAGCAGCAGCAGAAACTGCGGCTTCAGAGAATCCAG
ATGGAGAGAGAAAGGATTCGAATGCGCCAAGAGGAGCTCATGAGGCAGGAAGCTGCCCTCTGTCGACAGCTCCCCATGGAAGCTGAGACT
CTTGCCCCAGTTCAGGCTGCTGTCAACCCACCCACGATGACCCCAGACATGAGATCCATCACTAATAATAGCTCAGATCCTTTCCTCAAT
GGAGGGCCATATCATTCGAGGGAGCAGAGCACTGACAGTGGCCTGGGGTTAGGGTGCTACAGTGTCCCCACAACTCCGGAGGACTTCCTC
AGCAATGTGGATGAGATGGATACAGGAGAAAACGCAGGACAAACACCCATGAACATCAATCCCCAACAGACCCGTTTCCCTGATTTCCTT
GACTGTCTTCCAGGAACAAACGTTGACTTAGGAACTTTGGAATCTGAAGACCTGATCCCCCTCTTCAATGATGTAGAGTCTGCTCTGAAC


* Fusion transcript sequences (Full-length transcript).
>In-frame_HLTF_ENST00000465259_chr3_148777505_-_WWTR1_ENST00000465804_chr3_149260324_-_5763nt
GAAGGAGACGGCGTCGACGTCTGACTGGACTCGCGGCGACTTACCTTTCAGTCGTGCGCTCCTGATCCGGCGCTCGGAATTTGTCCCCGG
CTTCAGGGCTGCGGGGCCTGGAAGGAGGCGTATCGAGGCGGCTCGAAAACGATCCAGGGGAGCCGAGGCGCTCCTCTTGTCATCCCACTC
AGCGCCATGTCCTGGATGTTCAAGAGGGATCCAGTTTGGAAGTACTTGCAGACTGTCCAGTATGGAGTTCATGGAAATTTTCCACGCCTC
TCATATCCAACTTTCTTTCCACGTTTTGAATTCCAAGATGTTATCCCTCCAGATGACTTTCTAACTAGTGATGAAGAAGTAGATTCCGTT
TTATTTGGAAGTTTGAGAGGTCATGTGGTTGGACTACGCTATTACACGGGAGTAGTTAATAATAATGAAATGGTTGCATTACAACGAGAT
CCTAATAACCCTTATGATAAGAATGCAATTAAAGTAAACAATGTGAATGGAAATCAAGTTGGCCATTTAAAGAAAGAGCTTGCAGGTGCT
TTGGCCTATATCATGGACAACAAATTGGCACAAATTGAAGGGGTAGTTCCTTTTGGTGCAAACAATGCTTTTACCATGCCTCTGCATATG
ACTTTTTGGGGAAAAGAAGAAAATAGAAAAGCGGTTTCAGATCAGTTGAAGAAACATGGATTTAAATTGGGTCCTGCACCAAAAACTTTA
GGATTCAATTTGGAAAGTGGTTGGGGCTCTGGAAGAGCTGGACCAAGCTATAGTATGCCAGTGCATGCTGCAGTACAGATGACAACTGAA
CAGCTTAAAACAGAATTTGACAAATTGTTTGAAGATTTAAAAGAAGATGATAAAACCCATGAAATGGAACCAGCTGAGGCTATTGAAACA
CCACTGCTTCCACATCAAAAACAAGCTCTAGCTTGGATGGTGTCACGGGAAAATAGCAAAGAACTTCCACCATTCTGGGAACAGCGAAAT
GACTTATACTATAACACAATAACAAATTTTTCTGAGAAGGACCGACCAGAAAATGTCCATGGAGGAATTTTAGCTGATGATATGGGTTTG
GGTAAAACTCTTACGGCCATTGCAGTAATCCTTACCAACTTCCATGATGGCAGACCTCTTCCTATTGAAAGAGTTAAAAAGAATCTACTG
AAGAAGGAATATAATGTTAACGATGACTCTATGAAACTTGGAGGAAACAATACCAGTGAAAAGGCAGATGGACTAAGCAAAGACGCATCT
AGATGTAGTGAACAACCCAGTATTTCAGATATCAAGGAGAAGAGTAAGTTTCGCATGTCAGAATTGTCTAGCTCCCGCCCCAAAAGAAGA
AAAACTGCTGTCCAGTACATAGAAAGCAGTGATTCAGAGGAAATTGAAACAAGTGAATTGCCGCAGAAAATGAAAGGCAAACTGAAAAAT
GTACAGTCTGAAACTAAAGGCAGGGCGAAAGGATCTTCTAAGGTTATAGAAGATGTGGCATTTGCATGTGCATTAACTTCATCTGTTCCT
ACAACAAAAAAGAAAATGTTGAAAAAGGTGATGAATCACCAACACCAGCAGCAGATGGCCCCCAGTACCCTGAGCCAGCAGAACCACCCC
ACTCAGAACCCACCCGCAGGGCTCATGAGTATGCCCAATGCGCTGACCACTCAGCAGCAGCAGCAGCAGAAACTGCGGCTTCAGAGAATC
CAGATGGAGAGAGAAAGGATTCGAATGCGCCAAGAGGAGCTCATGAGGCAGGAAGCTGCCCTCTGTCGACAGCTCCCCATGGAAGCTGAG
ACTCTTGCCCCAGTTCAGGCTGCTGTCAACCCACCCACGATGACCCCAGACATGAGATCCATCACTAATAATAGCTCAGATCCTTTCCTC
AATGGAGGGCCATATCATTCGAGGGAGCAGAGCACTGACAGTGGCCTGGGGTTAGGGTGCTACAGTGTCCCCACAACTCCGGAGGACTTC
CTCAGCAATGTGGATGAGATGGATACAGGAGAAAACGCAGGACAAACACCCATGAACATCAATCCCCAACAGACCCGTTTCCCTGATTTC
CTTGACTGTCTTCCAGGAACAAACGTTGACTTAGGAACTTTGGAATCTGAAGACCTGATCCCCCTCTTCAATGATGTAGAGTCTGCTCTG
AACAAAAGTGAGCCCTTTCTAACCTGGCTGTAATCACTACCATTGTAACTTGGATGTAGCCATGACCTTACATTTCCTGGGCCTCTTGGA
AAAAGTGATGGAGCAGAGCAAGTCTGCAGGTGCACCACTTCCCGCCTCCATGACTCGTGCTCCCTCCTTTTTATGTTGCCAGTTTAATCA
TTGCCTGGTTTTGATTGAGAGTAACTTAAGTTAAACATAAATAAATATTCTATTTTCATTTTCTGCAAGCCTGCGTTCTTGTGACAGATT
ATACAGAATTGTGTCTGCAGGATTGATTATGCAGAATACTTTTCTCTTTCTTCTCTGCTGCCCCATGGCTAAGCTTTATGGGTGTTAATT
GAAATTTATACACCAATTGATTTTAAACCATAAAAAGCTGACCACAGGCAGTTACTTCTGAGGGCATCTTGGTCCAGGAAATGTGCACAA
AATTCGACCTGATTTACAGTTTCAAAAACTGTATTGATGACAGTAGTACCAAATGCTTTAAAAACTATTTAACTTGAGCTTTAAAAATCA
TTGTATGGATAGTAAAATTCTACTGTATGGAATACAATGTAATTTTGAATCCATGCTGGCTCTGATGGCTCTTATTAGTCTGTATTTATA
AAGGCACACAGTCCTATTGTAGCTTATCTTTCGTTATTTTACTGCAGAGCATCTAGACAACTTAGTCCCTCCAGCGGGAAAGTAGCAGCA
GCAGCATTAGTCACAGGTCTTACACTACAGATCTTGTGAAAGAGACCAGTTTGGTACTAATTATGAGCATTTTATTCAAACAAAAGTTTT
TGAAATATTACAACTGGGGATTTAAAAAATTGCAGCTTAGAATCTGATGGTTTTTTTTTTTCTTGATGTTGTTTGTTTGTTTTTGAGATC
GAGTTTTGCTCTTGTTGTCCAGGCTGGAATGCAATGGCACAATCTCGGCTCACTGCAACCTCTGCCTTCTGGGTTCAAGCGATTCTCCTG
CCTTAGCCTCCCGAGTAGCTGGGATTACAGGCACCTGCCACCACGTCCGGCTAATTTTTTGTATTTTGAGTAGAGACGGGGTTTCACCAT
AATGGTCAGGCTGTTCTCAAACTCCTGATCTCAGGTGATCCACCCATCTCGGCCTCCCAAAGTGCTGGGATTACTGGCGTGAGCCACCGC
ACCCGGCCTTGATGTTTATTTTATAAAGCACTGTAATTTTGTAGCTGATGACAAAAGGCAGCCAAATGTTTTTGATAAATCAGTGGCAAC
TGTATTTTTGTCTTTTGAAATAACTCTGAAAACATCAGGACAACATAGATTTCAACCTGATAGCACACCACACACAGTGAGCTGTTGCTT
TTTAAATTCTGAAGCCTTGTCAGGTTTGCTTCCTAGATTTCAAGTGTTTAAAATAATTCTATCTATGAAACTGAAGGATGAAGCAGATCT
CTGACTGACATGTAAAAAAAAATGCCCTTTGAGGGTGTATGGTGGAGATAAATGTTTCTGAATTCAGTAAAATTGATTCCTAAGTATATT
ATCCTAATCCTGTTTGCTACAGTTGGTATAAAAAGGCATGAAATATGTATTCAATACCTCTTATGTAACCAAAACCATTTTTAATTAGCT
TTTAAGGACTGAGAGAGCATCATGTTCAACTGGCATGCAGTCTGCCTGCATTGCCAATGAAGTCCTCAACTGTTTAATATTTTGAACTAA
TATTATTTATAATCTATGAATTTAATCTTTTTTGAAAGACTTTAATAATTTGAGTCTCTGAGAGGATACTTTCAATTTCCATGGGGGACT
TATTTGTTGGGGATCTTAAATAAGATTCCTTTTGATCTACCGGAATATACATGTACAGAGTACATTGGATCATGTTGGAAAGAAGGCAAG
TGAAAAGGTCAGAGATGAAGTAGCAAAGTTATGGAATATCGTGGAAAGGATACTAGTTGTGAAATGGAAAGAGACAAGTTATAGTACCCC
AAAAGCAAAACAAGCAGGAGATGCAAGAGATGCCCCAAAAGGACAAAGCAACAATTTTCTGTTGCCACCTTTATACCGGAAGACTCTGTT
GTAGAAGAAAAGAAGGCTTTGGTGCACCTTATGTGGGAGGAGGAGGGGCAGGGCATGCTGATGCTGAGCGTACAGGCAGACAAGAGCGTA
GCCTGCTGTTGCCTCCATCACTATGAAATGACTTATTTTACCTGAAGGACCCATGGTTTATGTTCCTCTAATTCCTTTCACTCTCCCTAA
GCCCTCTGAGAGAGATGAAGATAGATGATTTTATTGCTACTAAATTGAAGGGAGCACTATTTCTTTTTGTCTTTTGTTAGCAAAAAATTG
CAAAAAGAATTGTACATTCTTGCTAAAAATAAATAAATAAATAAAAAATTAAAAAAACAAGGGACCTAACAAAACTCAGCAGTGTTACTG
TATTTTTAAAAAATATTTTTATAGACTCATTTTCAGGTTATTAAATGTAAGAGAAACAGATACCCCTCTTTTTTAAAGTAGGTAAATCAT
TGATGATTTATATTACCAATTTTTAGAAGTAATTTTCTAGTAAGCTTGTGGCATCAGAAAATACTAGAAGATTTTTTTAGTTAAATTAGT
TAGAACATTTATGAATGAATATAATAAATATTTTTTCAGAATAAAATATGGACCCTTTGTGTTTACTAATAGATAAAGCCAGATATAATT
TTTTGTTTTTAAGGCCACAAAATATGGCCTTTGTTAAAGAACACTAAAGTTAGAAATCTAAAGTTAGAGCAACTTTTTAATGGCTATTTC
CTATTATTGTAAGTGTTAAAACCCCTGCAGAATTCTTGATAAGGTGCTATTTATACTATATTTCTTATTATAAGATAACTGTCTTTAGTC
TTCTTAGTACTAGTCTTTTTAGTACTAAATCAATCAGTAAACATCATCATTTCACCCCAAAATTTTGTCACAGAAAAGGCGTATCAAATG
AAAAATAATTTCAGAGATCTTTCTTTCAAGATATTTTTTCCTGATAAAATACATTGTCTTGAAGTAAATACATTGTCAAAACCTAATTGC
AATTCTGTTAAATCTAAGTAATTTTTAGACAGTGTTTCACCGTATTATTTAGGATGTGAAATGCCATTTCTTTCACTGATTACACCATAT
ACAGGAAACAGGTAAAACAGTGAAAACTTTATTGTGCTGGTTGATGCCAACTTGGTTGAAAAGCTCTCTGCAGAAGAAGTGATCTAGACT
GACAGAAGTGTTGCTAATTACAAGTTGTGTTCTCATGACGTAATTAGAAAGTAACTTCTCAAAGTACAACTTTTATGAAAAAAATAAGCT
GTTAAAAAAAGGAAATCGTAGGTTAATTTAATTGGGAAAATGGGCAATTGACAGAGACCATTTTCCTAACACATATATGTGCTAGTACTT
TAACTTTTTAAAATTTTACTTCTACGTTTTGTAATATAAAAATTTCTATTTTAAGTTTAGAATGTTATACGTACCGAAAGTATGCAGCCA
AATCGATCAGATCAAACCATTTTACCTGGAGTTTGGTACTGGTTTTTACTTCTCTGAATCTGTATAAGAAAAATAAAGACAATTGAACTT

>In-frame_HLTF_ENST00000465259_chr3_148777505_-_WWTR1_ENST00000360632_chr3_149260324_-_2753nt
GAAGGAGACGGCGTCGACGTCTGACTGGACTCGCGGCGACTTACCTTTCAGTCGTGCGCTCCTGATCCGGCGCTCGGAATTTGTCCCCGG
CTTCAGGGCTGCGGGGCCTGGAAGGAGGCGTATCGAGGCGGCTCGAAAACGATCCAGGGGAGCCGAGGCGCTCCTCTTGTCATCCCACTC
AGCGCCATGTCCTGGATGTTCAAGAGGGATCCAGTTTGGAAGTACTTGCAGACTGTCCAGTATGGAGTTCATGGAAATTTTCCACGCCTC
TCATATCCAACTTTCTTTCCACGTTTTGAATTCCAAGATGTTATCCCTCCAGATGACTTTCTAACTAGTGATGAAGAAGTAGATTCCGTT
TTATTTGGAAGTTTGAGAGGTCATGTGGTTGGACTACGCTATTACACGGGAGTAGTTAATAATAATGAAATGGTTGCATTACAACGAGAT
CCTAATAACCCTTATGATAAGAATGCAATTAAAGTAAACAATGTGAATGGAAATCAAGTTGGCCATTTAAAGAAAGAGCTTGCAGGTGCT
TTGGCCTATATCATGGACAACAAATTGGCACAAATTGAAGGGGTAGTTCCTTTTGGTGCAAACAATGCTTTTACCATGCCTCTGCATATG
ACTTTTTGGGGAAAAGAAGAAAATAGAAAAGCGGTTTCAGATCAGTTGAAGAAACATGGATTTAAATTGGGTCCTGCACCAAAAACTTTA
GGATTCAATTTGGAAAGTGGTTGGGGCTCTGGAAGAGCTGGACCAAGCTATAGTATGCCAGTGCATGCTGCAGTACAGATGACAACTGAA
CAGCTTAAAACAGAATTTGACAAATTGTTTGAAGATTTAAAAGAAGATGATAAAACCCATGAAATGGAACCAGCTGAGGCTATTGAAACA
CCACTGCTTCCACATCAAAAACAAGCTCTAGCTTGGATGGTGTCACGGGAAAATAGCAAAGAACTTCCACCATTCTGGGAACAGCGAAAT
GACTTATACTATAACACAATAACAAATTTTTCTGAGAAGGACCGACCAGAAAATGTCCATGGAGGAATTTTAGCTGATGATATGGGTTTG
GGTAAAACTCTTACGGCCATTGCAGTAATCCTTACCAACTTCCATGATGGCAGACCTCTTCCTATTGAAAGAGTTAAAAAGAATCTACTG
AAGAAGGAATATAATGTTAACGATGACTCTATGAAACTTGGAGGAAACAATACCAGTGAAAAGGCAGATGGACTAAGCAAAGACGCATCT
AGATGTAGTGAACAACCCAGTATTTCAGATATCAAGGAGAAGAGTAAGTTTCGCATGTCAGAATTGTCTAGCTCCCGCCCCAAAAGAAGA
AAAACTGCTGTCCAGTACATAGAAAGCAGTGATTCAGAGGAAATTGAAACAAGTGAATTGCCGCAGAAAATGAAAGGCAAACTGAAAAAT
GTACAGTCTGAAACTAAAGGCAGGGCGAAAGGATCTTCTAAGGTTATAGAAGATGTGGCATTTGCATGTGCATTAACTTCATCTGTTCCT
ACAACAAAAAAGAAAATGTTGAAAAAGGTGATGAATCACCAACACCAGCAGCAGATGGCCCCCAGTACCCTGAGCCAGCAGAACCACCCC
ACTCAGAACCCACCCGCAGGGCTCATGAGTATGCCCAATGCGCTGACCACTCAGCAGCAGCAGCAGCAGAAACTGCGGCTTCAGAGAATC
CAGATGGAGAGAGAAAGGATTCGAATGCGCCAAGAGGAGCTCATGAGGCAGGAAGCTGCCCTCTGTCGACAGCTCCCCATGGAAGCTGAG
ACTCTTGCCCCAGTTCAGGCTGCTGTCAACCCACCCACGATGACCCCAGACATGAGATCCATCACTAATAATAGCTCAGATCCTTTCCTC
AATGGAGGGCCATATCATTCGAGGGAGCAGAGCACTGACAGTGGCCTGGGGTTAGGGTGCTACAGTGTCCCCACAACTCCGGAGGACTTC
CTCAGCAATGTGGATGAGATGGATACAGGAGAAAACGCAGGACAAACACCCATGAACATCAATCCCCAACAGACCCGTTTCCCTGATTTC
CTTGACTGTCTTCCAGGAACAAACGTTGACTTAGGAACTTTGGAATCTGAAGACCTGATCCCCCTCTTCAATGATGTAGAGTCTGCTCTG
AACAAAAGTGAGCCCTTTCTAACCTGGCTGTAATCACTACCATTGTAACTTGGATGTAGCCATGACCTTACATTTCCTGGGCCTCTTGGA
AAAAGTGATGGAGCAGAGCAAGTCTGCAGGTGCACCACTTCCCGCCTCCATGACTCGTGCTCCCTCCTTTTTATGTTGCCAGTTTAATCA
TTGCCTGGTTTTGATTGAGAGTAACTTAAGTTAAACATAAATAAATATTCTATTTTCATTTTCTGCAAGCCTGCGTTCTTGTGACAGATT
ATACAGAATTGTGTCTGCAGGATTGATTATGCAGAATACTTTTCTCTTTCTTCTCTGCTGCCCCATGGCTAAGCTTTATGGGTGTTAATT
GAAATTTATACACCAATTGATTTTAAACCATAAAAAGCTGACCACAGGCAGTTACTTCTGAGGGCATCTTGGTCCAGGAAATGTGCACAA
AATTCGACCTGATTTACAGTTTCAAAAACTGTATTGATGACAGTAGTACCAAATGCTTTAAAAACTATTTAACTTGAGCTTTAAAAATCA

>In-frame_HLTF_ENST00000465259_chr3_148777505_-_WWTR1_ENST00000467467_chr3_149260324_-_2388nt
GAAGGAGACGGCGTCGACGTCTGACTGGACTCGCGGCGACTTACCTTTCAGTCGTGCGCTCCTGATCCGGCGCTCGGAATTTGTCCCCGG
CTTCAGGGCTGCGGGGCCTGGAAGGAGGCGTATCGAGGCGGCTCGAAAACGATCCAGGGGAGCCGAGGCGCTCCTCTTGTCATCCCACTC
AGCGCCATGTCCTGGATGTTCAAGAGGGATCCAGTTTGGAAGTACTTGCAGACTGTCCAGTATGGAGTTCATGGAAATTTTCCACGCCTC
TCATATCCAACTTTCTTTCCACGTTTTGAATTCCAAGATGTTATCCCTCCAGATGACTTTCTAACTAGTGATGAAGAAGTAGATTCCGTT
TTATTTGGAAGTTTGAGAGGTCATGTGGTTGGACTACGCTATTACACGGGAGTAGTTAATAATAATGAAATGGTTGCATTACAACGAGAT
CCTAATAACCCTTATGATAAGAATGCAATTAAAGTAAACAATGTGAATGGAAATCAAGTTGGCCATTTAAAGAAAGAGCTTGCAGGTGCT
TTGGCCTATATCATGGACAACAAATTGGCACAAATTGAAGGGGTAGTTCCTTTTGGTGCAAACAATGCTTTTACCATGCCTCTGCATATG
ACTTTTTGGGGAAAAGAAGAAAATAGAAAAGCGGTTTCAGATCAGTTGAAGAAACATGGATTTAAATTGGGTCCTGCACCAAAAACTTTA
GGATTCAATTTGGAAAGTGGTTGGGGCTCTGGAAGAGCTGGACCAAGCTATAGTATGCCAGTGCATGCTGCAGTACAGATGACAACTGAA
CAGCTTAAAACAGAATTTGACAAATTGTTTGAAGATTTAAAAGAAGATGATAAAACCCATGAAATGGAACCAGCTGAGGCTATTGAAACA
CCACTGCTTCCACATCAAAAACAAGCTCTAGCTTGGATGGTGTCACGGGAAAATAGCAAAGAACTTCCACCATTCTGGGAACAGCGAAAT
GACTTATACTATAACACAATAACAAATTTTTCTGAGAAGGACCGACCAGAAAATGTCCATGGAGGAATTTTAGCTGATGATATGGGTTTG
GGTAAAACTCTTACGGCCATTGCAGTAATCCTTACCAACTTCCATGATGGCAGACCTCTTCCTATTGAAAGAGTTAAAAAGAATCTACTG
AAGAAGGAATATAATGTTAACGATGACTCTATGAAACTTGGAGGAAACAATACCAGTGAAAAGGCAGATGGACTAAGCAAAGACGCATCT
AGATGTAGTGAACAACCCAGTATTTCAGATATCAAGGAGAAGAGTAAGTTTCGCATGTCAGAATTGTCTAGCTCCCGCCCCAAAAGAAGA
AAAACTGCTGTCCAGTACATAGAAAGCAGTGATTCAGAGGAAATTGAAACAAGTGAATTGCCGCAGAAAATGAAAGGCAAACTGAAAAAT
GTACAGTCTGAAACTAAAGGCAGGGCGAAAGGATCTTCTAAGGTTATAGAAGATGTGGCATTTGCATGTGCATTAACTTCATCTGTTCCT
ACAACAAAAAAGAAAATGTTGAAAAAGGTGATGAATCACCAACACCAGCAGCAGATGGCCCCCAGTACCCTGAGCCAGCAGAACCACCCC
ACTCAGAACCCACCCGCAGGGCTCATGAGTATGCCCAATGCGCTGACCACTCAGCAGCAGCAGCAGCAGAAACTGCGGCTTCAGAGAATC
CAGATGGAGAGAGAAAGGATTCGAATGCGCCAAGAGGAGCTCATGAGGCAGGAAGCTGCCCTCTGTCGACAGCTCCCCATGGAAGCTGAG
ACTCTTGCCCCAGTTCAGGCTGCTGTCAACCCACCCACGATGACCCCAGACATGAGATCCATCACTAATAATAGCTCAGATCCTTTCCTC
AATGGAGGGCCATATCATTCGAGGGAGCAGAGCACTGACAGTGGCCTGGGGTTAGGGTGCTACAGTGTCCCCACAACTCCGGAGGACTTC
CTCAGCAATGTGGATGAGATGGATACAGGAGAAAACGCAGGACAAACACCCATGAACATCAATCCCCAACAGACCCGTTTCCCTGATTTC
CTTGACTGTCTTCCAGGAACAAACGTTGACTTAGGAACTTTGGAATCTGAAGACCTGATCCCCCTCTTCAATGATGTAGAGTCTGCTCTG
AACAAAAGTGAGCCCTTTCTAACCTGGCTGTAATCACTACCATTGTAACTTGGATGTAGCCATGACCTTACATTTCCTGGGCCTCTTGGA
AAAAGTGATGGAGCAGAGCAAGTCTGCAGGTGCACCACTTCCCGCCTCCATGACTCGTGCTCCCTCCTTTTTATGTTGCCAGTTTAATCA

>In-frame_HLTF_ENST00000310053_chr3_148777505_-_WWTR1_ENST00000465804_chr3_149260324_-_5774nt
TTGTTGCAGAAGGAGACGGCGTCGACGTCTGACTGGACTCGCGGCGACTTACCTTTCAGTCGTGCGCTCCTGATCCGGCGCTCGGAATTT
GTCCCCGGCTTCAGGGCTGCGGGGCCTGGAAGGAGGCGTATCGAGGCGGCTCGAAAACGATCCAGGGGAGCCGAGGCGCTCCTCTTGTCA
TCCCACTCAGCGCCATGTCCTGGATGTTCAAGAGGGATCCAGTTTGGAAGTACTTGCAGACTGTCCAGTATGGAGTTCATGGAAATTTTC
CACGCCTCTCATATCCAACTTTCTTTCCACGTTTTGAATTCCAAGATGTTATCCCTCCAGATGACTTTCTAACTAGTGATGAAGAAGTAG
ATTCCGTTTTATTTGGAAGTTTGAGAGGTCATGTGGTTGGACTACGCTATTACACGGGAGTAGTTAATAATAATGAAATGGTTGCATTAC
AACGAGATCCTAATAACCCTTATGATAAGAATGCAATTAAAGTAAACAATGTGAATGGAAATCAAGTTGGCCATTTAAAGAAAGAGCTTG
CAGGTGCTTTGGCCTATATCATGGACAACAAATTGGCACAAATTGAAGGGGTAGTTCCTTTTGGTGCAAACAATGCTTTTACCATGCCTC
TGCATATGACTTTTTGGGGAAAAGAAGAAAATAGAAAAGCGGTTTCAGATCAGTTGAAGAAACATGGATTTAAATTGGGTCCTGCACCAA
AAACTTTAGGATTCAATTTGGAAAGTGGTTGGGGCTCTGGAAGAGCTGGACCAAGCTATAGTATGCCAGTGCATGCTGCAGTACAGATGA
CAACTGAACAGCTTAAAACAGAATTTGACAAATTGTTTGAAGATTTAAAAGAAGATGATAAAACCCATGAAATGGAACCAGCTGAGGCTA
TTGAAACACCACTGCTTCCACATCAAAAACAAGCTCTAGCTTGGATGGTGTCACGGGAAAATAGCAAAGAACTTCCACCATTCTGGGAAC
AGCGAAATGACTTATACTATAACACAATAACAAATTTTTCTGAGAAGGACCGACCAGAAAATGTCCATGGAGGAATTTTAGCTGATGATA
TGGGTTTGGGTAAAACTCTTACGGCCATTGCAGTAATCCTTACCAACTTCCATGATGGCAGACCTCTTCCTATTGAAAGAGTTAAAAAGA
ATCTACTGAAGAAGGAATATAATGTTAACGATGACTCTATGAAACTTGGAGGAAACAATACCAGTGAAAAGGCAGATGGACTAAGCAAAG
ACGCATCTAGATGTAGTGAACAACCCAGTATTTCAGATATCAAGGAGAAGAGTAAGTTTCGCATGTCAGAATTGTCTAGCTCCCGCCCCA
AAAGAAGAAAAACTGCTGTCCAGTACATAGAAAGCAGTGATTCAGAGGAAATTGAAACAAGTGAATTGCCGCAGAAAATGAAAGGCAAAC
TGAAAAATGTACAGTCTGAAACTAAAGGCAGGGCGAAAGCAGGATCTTCTAAGGTTATAGAAGATGTGGCATTTGCATGTGCATTAACTT
CATCTGTTCCTACAACAAAAAAGAAAATGTTGAAAAAGGTGATGAATCACCAACACCAGCAGCAGATGGCCCCCAGTACCCTGAGCCAGC
AGAACCACCCCACTCAGAACCCACCCGCAGGGCTCATGAGTATGCCCAATGCGCTGACCACTCAGCAGCAGCAGCAGCAGAAACTGCGGC
TTCAGAGAATCCAGATGGAGAGAGAAAGGATTCGAATGCGCCAAGAGGAGCTCATGAGGCAGGAAGCTGCCCTCTGTCGACAGCTCCCCA
TGGAAGCTGAGACTCTTGCCCCAGTTCAGGCTGCTGTCAACCCACCCACGATGACCCCAGACATGAGATCCATCACTAATAATAGCTCAG
ATCCTTTCCTCAATGGAGGGCCATATCATTCGAGGGAGCAGAGCACTGACAGTGGCCTGGGGTTAGGGTGCTACAGTGTCCCCACAACTC
CGGAGGACTTCCTCAGCAATGTGGATGAGATGGATACAGGAGAAAACGCAGGACAAACACCCATGAACATCAATCCCCAACAGACCCGTT
TCCCTGATTTCCTTGACTGTCTTCCAGGAACAAACGTTGACTTAGGAACTTTGGAATCTGAAGACCTGATCCCCCTCTTCAATGATGTAG
AGTCTGCTCTGAACAAAAGTGAGCCCTTTCTAACCTGGCTGTAATCACTACCATTGTAACTTGGATGTAGCCATGACCTTACATTTCCTG
GGCCTCTTGGAAAAAGTGATGGAGCAGAGCAAGTCTGCAGGTGCACCACTTCCCGCCTCCATGACTCGTGCTCCCTCCTTTTTATGTTGC
CAGTTTAATCATTGCCTGGTTTTGATTGAGAGTAACTTAAGTTAAACATAAATAAATATTCTATTTTCATTTTCTGCAAGCCTGCGTTCT
TGTGACAGATTATACAGAATTGTGTCTGCAGGATTGATTATGCAGAATACTTTTCTCTTTCTTCTCTGCTGCCCCATGGCTAAGCTTTAT
GGGTGTTAATTGAAATTTATACACCAATTGATTTTAAACCATAAAAAGCTGACCACAGGCAGTTACTTCTGAGGGCATCTTGGTCCAGGA
AATGTGCACAAAATTCGACCTGATTTACAGTTTCAAAAACTGTATTGATGACAGTAGTACCAAATGCTTTAAAAACTATTTAACTTGAGC
TTTAAAAATCATTGTATGGATAGTAAAATTCTACTGTATGGAATACAATGTAATTTTGAATCCATGCTGGCTCTGATGGCTCTTATTAGT
CTGTATTTATAAAGGCACACAGTCCTATTGTAGCTTATCTTTCGTTATTTTACTGCAGAGCATCTAGACAACTTAGTCCCTCCAGCGGGA
AAGTAGCAGCAGCAGCATTAGTCACAGGTCTTACACTACAGATCTTGTGAAAGAGACCAGTTTGGTACTAATTATGAGCATTTTATTCAA
ACAAAAGTTTTTGAAATATTACAACTGGGGATTTAAAAAATTGCAGCTTAGAATCTGATGGTTTTTTTTTTTCTTGATGTTGTTTGTTTG
TTTTTGAGATCGAGTTTTGCTCTTGTTGTCCAGGCTGGAATGCAATGGCACAATCTCGGCTCACTGCAACCTCTGCCTTCTGGGTTCAAG
CGATTCTCCTGCCTTAGCCTCCCGAGTAGCTGGGATTACAGGCACCTGCCACCACGTCCGGCTAATTTTTTGTATTTTGAGTAGAGACGG
GGTTTCACCATAATGGTCAGGCTGTTCTCAAACTCCTGATCTCAGGTGATCCACCCATCTCGGCCTCCCAAAGTGCTGGGATTACTGGCG
TGAGCCACCGCACCCGGCCTTGATGTTTATTTTATAAAGCACTGTAATTTTGTAGCTGATGACAAAAGGCAGCCAAATGTTTTTGATAAA
TCAGTGGCAACTGTATTTTTGTCTTTTGAAATAACTCTGAAAACATCAGGACAACATAGATTTCAACCTGATAGCACACCACACACAGTG
AGCTGTTGCTTTTTAAATTCTGAAGCCTTGTCAGGTTTGCTTCCTAGATTTCAAGTGTTTAAAATAATTCTATCTATGAAACTGAAGGAT
GAAGCAGATCTCTGACTGACATGTAAAAAAAAATGCCCTTTGAGGGTGTATGGTGGAGATAAATGTTTCTGAATTCAGTAAAATTGATTC
CTAAGTATATTATCCTAATCCTGTTTGCTACAGTTGGTATAAAAAGGCATGAAATATGTATTCAATACCTCTTATGTAACCAAAACCATT
TTTAATTAGCTTTTAAGGACTGAGAGAGCATCATGTTCAACTGGCATGCAGTCTGCCTGCATTGCCAATGAAGTCCTCAACTGTTTAATA
TTTTGAACTAATATTATTTATAATCTATGAATTTAATCTTTTTTGAAAGACTTTAATAATTTGAGTCTCTGAGAGGATACTTTCAATTTC
CATGGGGGACTTATTTGTTGGGGATCTTAAATAAGATTCCTTTTGATCTACCGGAATATACATGTACAGAGTACATTGGATCATGTTGGA
AAGAAGGCAAGTGAAAAGGTCAGAGATGAAGTAGCAAAGTTATGGAATATCGTGGAAAGGATACTAGTTGTGAAATGGAAAGAGACAAGT
TATAGTACCCCAAAAGCAAAACAAGCAGGAGATGCAAGAGATGCCCCAAAAGGACAAAGCAACAATTTTCTGTTGCCACCTTTATACCGG
AAGACTCTGTTGTAGAAGAAAAGAAGGCTTTGGTGCACCTTATGTGGGAGGAGGAGGGGCAGGGCATGCTGATGCTGAGCGTACAGGCAG
ACAAGAGCGTAGCCTGCTGTTGCCTCCATCACTATGAAATGACTTATTTTACCTGAAGGACCCATGGTTTATGTTCCTCTAATTCCTTTC
ACTCTCCCTAAGCCCTCTGAGAGAGATGAAGATAGATGATTTTATTGCTACTAAATTGAAGGGAGCACTATTTCTTTTTGTCTTTTGTTA
GCAAAAAATTGCAAAAAGAATTGTACATTCTTGCTAAAAATAAATAAATAAATAAAAAATTAAAAAAACAAGGGACCTAACAAAACTCAG
CAGTGTTACTGTATTTTTAAAAAATATTTTTATAGACTCATTTTCAGGTTATTAAATGTAAGAGAAACAGATACCCCTCTTTTTTAAAGT
AGGTAAATCATTGATGATTTATATTACCAATTTTTAGAAGTAATTTTCTAGTAAGCTTGTGGCATCAGAAAATACTAGAAGATTTTTTTA
GTTAAATTAGTTAGAACATTTATGAATGAATATAATAAATATTTTTTCAGAATAAAATATGGACCCTTTGTGTTTACTAATAGATAAAGC
CAGATATAATTTTTTGTTTTTAAGGCCACAAAATATGGCCTTTGTTAAAGAACACTAAAGTTAGAAATCTAAAGTTAGAGCAACTTTTTA
ATGGCTATTTCCTATTATTGTAAGTGTTAAAACCCCTGCAGAATTCTTGATAAGGTGCTATTTATACTATATTTCTTATTATAAGATAAC
TGTCTTTAGTCTTCTTAGTACTAGTCTTTTTAGTACTAAATCAATCAGTAAACATCATCATTTCACCCCAAAATTTTGTCACAGAAAAGG
CGTATCAAATGAAAAATAATTTCAGAGATCTTTCTTTCAAGATATTTTTTCCTGATAAAATACATTGTCTTGAAGTAAATACATTGTCAA
AACCTAATTGCAATTCTGTTAAATCTAAGTAATTTTTAGACAGTGTTTCACCGTATTATTTAGGATGTGAAATGCCATTTCTTTCACTGA
TTACACCATATACAGGAAACAGGTAAAACAGTGAAAACTTTATTGTGCTGGTTGATGCCAACTTGGTTGAAAAGCTCTCTGCAGAAGAAG
TGATCTAGACTGACAGAAGTGTTGCTAATTACAAGTTGTGTTCTCATGACGTAATTAGAAAGTAACTTCTCAAAGTACAACTTTTATGAA
AAAAATAAGCTGTTAAAAAAAGGAAATCGTAGGTTAATTTAATTGGGAAAATGGGCAATTGACAGAGACCATTTTCCTAACACATATATG
TGCTAGTACTTTAACTTTTTAAAATTTTACTTCTACGTTTTGTAATATAAAAATTTCTATTTTAAGTTTAGAATGTTATACGTACCGAAA
GTATGCAGCCAAATCGATCAGATCAAACCATTTTACCTGGAGTTTGGTACTGGTTTTTACTTCTCTGAATCTGTATAAGAAAAATAAAGA

>In-frame_HLTF_ENST00000310053_chr3_148777505_-_WWTR1_ENST00000360632_chr3_149260324_-_2764nt
TTGTTGCAGAAGGAGACGGCGTCGACGTCTGACTGGACTCGCGGCGACTTACCTTTCAGTCGTGCGCTCCTGATCCGGCGCTCGGAATTT
GTCCCCGGCTTCAGGGCTGCGGGGCCTGGAAGGAGGCGTATCGAGGCGGCTCGAAAACGATCCAGGGGAGCCGAGGCGCTCCTCTTGTCA
TCCCACTCAGCGCCATGTCCTGGATGTTCAAGAGGGATCCAGTTTGGAAGTACTTGCAGACTGTCCAGTATGGAGTTCATGGAAATTTTC
CACGCCTCTCATATCCAACTTTCTTTCCACGTTTTGAATTCCAAGATGTTATCCCTCCAGATGACTTTCTAACTAGTGATGAAGAAGTAG
ATTCCGTTTTATTTGGAAGTTTGAGAGGTCATGTGGTTGGACTACGCTATTACACGGGAGTAGTTAATAATAATGAAATGGTTGCATTAC
AACGAGATCCTAATAACCCTTATGATAAGAATGCAATTAAAGTAAACAATGTGAATGGAAATCAAGTTGGCCATTTAAAGAAAGAGCTTG
CAGGTGCTTTGGCCTATATCATGGACAACAAATTGGCACAAATTGAAGGGGTAGTTCCTTTTGGTGCAAACAATGCTTTTACCATGCCTC
TGCATATGACTTTTTGGGGAAAAGAAGAAAATAGAAAAGCGGTTTCAGATCAGTTGAAGAAACATGGATTTAAATTGGGTCCTGCACCAA
AAACTTTAGGATTCAATTTGGAAAGTGGTTGGGGCTCTGGAAGAGCTGGACCAAGCTATAGTATGCCAGTGCATGCTGCAGTACAGATGA
CAACTGAACAGCTTAAAACAGAATTTGACAAATTGTTTGAAGATTTAAAAGAAGATGATAAAACCCATGAAATGGAACCAGCTGAGGCTA
TTGAAACACCACTGCTTCCACATCAAAAACAAGCTCTAGCTTGGATGGTGTCACGGGAAAATAGCAAAGAACTTCCACCATTCTGGGAAC
AGCGAAATGACTTATACTATAACACAATAACAAATTTTTCTGAGAAGGACCGACCAGAAAATGTCCATGGAGGAATTTTAGCTGATGATA
TGGGTTTGGGTAAAACTCTTACGGCCATTGCAGTAATCCTTACCAACTTCCATGATGGCAGACCTCTTCCTATTGAAAGAGTTAAAAAGA
ATCTACTGAAGAAGGAATATAATGTTAACGATGACTCTATGAAACTTGGAGGAAACAATACCAGTGAAAAGGCAGATGGACTAAGCAAAG
ACGCATCTAGATGTAGTGAACAACCCAGTATTTCAGATATCAAGGAGAAGAGTAAGTTTCGCATGTCAGAATTGTCTAGCTCCCGCCCCA
AAAGAAGAAAAACTGCTGTCCAGTACATAGAAAGCAGTGATTCAGAGGAAATTGAAACAAGTGAATTGCCGCAGAAAATGAAAGGCAAAC
TGAAAAATGTACAGTCTGAAACTAAAGGCAGGGCGAAAGCAGGATCTTCTAAGGTTATAGAAGATGTGGCATTTGCATGTGCATTAACTT
CATCTGTTCCTACAACAAAAAAGAAAATGTTGAAAAAGGTGATGAATCACCAACACCAGCAGCAGATGGCCCCCAGTACCCTGAGCCAGC
AGAACCACCCCACTCAGAACCCACCCGCAGGGCTCATGAGTATGCCCAATGCGCTGACCACTCAGCAGCAGCAGCAGCAGAAACTGCGGC
TTCAGAGAATCCAGATGGAGAGAGAAAGGATTCGAATGCGCCAAGAGGAGCTCATGAGGCAGGAAGCTGCCCTCTGTCGACAGCTCCCCA
TGGAAGCTGAGACTCTTGCCCCAGTTCAGGCTGCTGTCAACCCACCCACGATGACCCCAGACATGAGATCCATCACTAATAATAGCTCAG
ATCCTTTCCTCAATGGAGGGCCATATCATTCGAGGGAGCAGAGCACTGACAGTGGCCTGGGGTTAGGGTGCTACAGTGTCCCCACAACTC
CGGAGGACTTCCTCAGCAATGTGGATGAGATGGATACAGGAGAAAACGCAGGACAAACACCCATGAACATCAATCCCCAACAGACCCGTT
TCCCTGATTTCCTTGACTGTCTTCCAGGAACAAACGTTGACTTAGGAACTTTGGAATCTGAAGACCTGATCCCCCTCTTCAATGATGTAG
AGTCTGCTCTGAACAAAAGTGAGCCCTTTCTAACCTGGCTGTAATCACTACCATTGTAACTTGGATGTAGCCATGACCTTACATTTCCTG
GGCCTCTTGGAAAAAGTGATGGAGCAGAGCAAGTCTGCAGGTGCACCACTTCCCGCCTCCATGACTCGTGCTCCCTCCTTTTTATGTTGC
CAGTTTAATCATTGCCTGGTTTTGATTGAGAGTAACTTAAGTTAAACATAAATAAATATTCTATTTTCATTTTCTGCAAGCCTGCGTTCT
TGTGACAGATTATACAGAATTGTGTCTGCAGGATTGATTATGCAGAATACTTTTCTCTTTCTTCTCTGCTGCCCCATGGCTAAGCTTTAT
GGGTGTTAATTGAAATTTATACACCAATTGATTTTAAACCATAAAAAGCTGACCACAGGCAGTTACTTCTGAGGGCATCTTGGTCCAGGA
AATGTGCACAAAATTCGACCTGATTTACAGTTTCAAAAACTGTATTGATGACAGTAGTACCAAATGCTTTAAAAACTATTTAACTTGAGC

>In-frame_HLTF_ENST00000310053_chr3_148777505_-_WWTR1_ENST00000467467_chr3_149260324_-_2399nt
TTGTTGCAGAAGGAGACGGCGTCGACGTCTGACTGGACTCGCGGCGACTTACCTTTCAGTCGTGCGCTCCTGATCCGGCGCTCGGAATTT
GTCCCCGGCTTCAGGGCTGCGGGGCCTGGAAGGAGGCGTATCGAGGCGGCTCGAAAACGATCCAGGGGAGCCGAGGCGCTCCTCTTGTCA
TCCCACTCAGCGCCATGTCCTGGATGTTCAAGAGGGATCCAGTTTGGAAGTACTTGCAGACTGTCCAGTATGGAGTTCATGGAAATTTTC
CACGCCTCTCATATCCAACTTTCTTTCCACGTTTTGAATTCCAAGATGTTATCCCTCCAGATGACTTTCTAACTAGTGATGAAGAAGTAG
ATTCCGTTTTATTTGGAAGTTTGAGAGGTCATGTGGTTGGACTACGCTATTACACGGGAGTAGTTAATAATAATGAAATGGTTGCATTAC
AACGAGATCCTAATAACCCTTATGATAAGAATGCAATTAAAGTAAACAATGTGAATGGAAATCAAGTTGGCCATTTAAAGAAAGAGCTTG
CAGGTGCTTTGGCCTATATCATGGACAACAAATTGGCACAAATTGAAGGGGTAGTTCCTTTTGGTGCAAACAATGCTTTTACCATGCCTC
TGCATATGACTTTTTGGGGAAAAGAAGAAAATAGAAAAGCGGTTTCAGATCAGTTGAAGAAACATGGATTTAAATTGGGTCCTGCACCAA
AAACTTTAGGATTCAATTTGGAAAGTGGTTGGGGCTCTGGAAGAGCTGGACCAAGCTATAGTATGCCAGTGCATGCTGCAGTACAGATGA
CAACTGAACAGCTTAAAACAGAATTTGACAAATTGTTTGAAGATTTAAAAGAAGATGATAAAACCCATGAAATGGAACCAGCTGAGGCTA
TTGAAACACCACTGCTTCCACATCAAAAACAAGCTCTAGCTTGGATGGTGTCACGGGAAAATAGCAAAGAACTTCCACCATTCTGGGAAC
AGCGAAATGACTTATACTATAACACAATAACAAATTTTTCTGAGAAGGACCGACCAGAAAATGTCCATGGAGGAATTTTAGCTGATGATA
TGGGTTTGGGTAAAACTCTTACGGCCATTGCAGTAATCCTTACCAACTTCCATGATGGCAGACCTCTTCCTATTGAAAGAGTTAAAAAGA
ATCTACTGAAGAAGGAATATAATGTTAACGATGACTCTATGAAACTTGGAGGAAACAATACCAGTGAAAAGGCAGATGGACTAAGCAAAG
ACGCATCTAGATGTAGTGAACAACCCAGTATTTCAGATATCAAGGAGAAGAGTAAGTTTCGCATGTCAGAATTGTCTAGCTCCCGCCCCA
AAAGAAGAAAAACTGCTGTCCAGTACATAGAAAGCAGTGATTCAGAGGAAATTGAAACAAGTGAATTGCCGCAGAAAATGAAAGGCAAAC
TGAAAAATGTACAGTCTGAAACTAAAGGCAGGGCGAAAGCAGGATCTTCTAAGGTTATAGAAGATGTGGCATTTGCATGTGCATTAACTT
CATCTGTTCCTACAACAAAAAAGAAAATGTTGAAAAAGGTGATGAATCACCAACACCAGCAGCAGATGGCCCCCAGTACCCTGAGCCAGC
AGAACCACCCCACTCAGAACCCACCCGCAGGGCTCATGAGTATGCCCAATGCGCTGACCACTCAGCAGCAGCAGCAGCAGAAACTGCGGC
TTCAGAGAATCCAGATGGAGAGAGAAAGGATTCGAATGCGCCAAGAGGAGCTCATGAGGCAGGAAGCTGCCCTCTGTCGACAGCTCCCCA
TGGAAGCTGAGACTCTTGCCCCAGTTCAGGCTGCTGTCAACCCACCCACGATGACCCCAGACATGAGATCCATCACTAATAATAGCTCAG
ATCCTTTCCTCAATGGAGGGCCATATCATTCGAGGGAGCAGAGCACTGACAGTGGCCTGGGGTTAGGGTGCTACAGTGTCCCCACAACTC
CGGAGGACTTCCTCAGCAATGTGGATGAGATGGATACAGGAGAAAACGCAGGACAAACACCCATGAACATCAATCCCCAACAGACCCGTT
TCCCTGATTTCCTTGACTGTCTTCCAGGAACAAACGTTGACTTAGGAACTTTGGAATCTGAAGACCTGATCCCCCTCTTCAATGATGTAG
AGTCTGCTCTGAACAAAAGTGAGCCCTTTCTAACCTGGCTGTAATCACTACCATTGTAACTTGGATGTAGCCATGACCTTACATTTCCTG
GGCCTCTTGGAAAAAGTGATGGAGCAGAGCAAGTCTGCAGGTGCACCACTTCCCGCCTCCATGACTCGTGCTCCCTCCTTTTTATGTTGC

>In-frame_HLTF_ENST00000392912_chr3_148777505_-_WWTR1_ENST00000465804_chr3_149260324_-_5748nt
GTCTGACTGGACTCGCGGCGACTTACCTTTCAGTCGTGCGCTCCTGATCCGGCGCTCGGAATTTGTCCCCGGCTTCAGGGCTGCGGGGCC
TGGAAGGAGGCGTATCGAGGCGGCTCGAAAACGATCCAGGGGAGCCGAGGCGCTCCTCTTGTCATCCCACTCAGCGCCATGTCCTGGATG
TTCAAGAGGGATCCAGTTTGGAAGTACTTGCAGACTGTCCAGTATGGAGTTCATGGAAATTTTCCACGCCTCTCATATCCAACTTTCTTT
CCACGTTTTGAATTCCAAGATGTTATCCCTCCAGATGACTTTCTAACTAGTGATGAAGAAGTAGATTCCGTTTTATTTGGAAGTTTGAGA
GGTCATGTGGTTGGACTACGCTATTACACGGGAGTAGTTAATAATAATGAAATGGTTGCATTACAACGAGATCCTAATAACCCTTATGAT
AAGAATGCAATTAAAGTAAACAATGTGAATGGAAATCAAGTTGGCCATTTAAAGAAAGAGCTTGCAGGTGCTTTGGCCTATATCATGGAC
AACAAATTGGCACAAATTGAAGGGGTAGTTCCTTTTGGTGCAAACAATGCTTTTACCATGCCTCTGCATATGACTTTTTGGGGAAAAGAA
GAAAATAGAAAAGCGGTTTCAGATCAGTTGAAGAAACATGGATTTAAATTGGGTCCTGCACCAAAAACTTTAGGATTCAATTTGGAAAGT
GGTTGGGGCTCTGGAAGAGCTGGACCAAGCTATAGTATGCCAGTGCATGCTGCAGTACAGATGACAACTGAACAGCTTAAAACAGAATTT
GACAAATTGTTTGAAGATTTAAAAGAAGATGATAAAACCCATGAAATGGAACCAGCTGAGGCTATTGAAACACCACTGCTTCCACATCAA
AAACAAGCTCTAGCTTGGATGGTGTCACGGGAAAATAGCAAAGAACTTCCACCATTCTGGGAACAGCGAAATGACTTATACTATAACACA
ATAACAAATTTTTCTGAGAAGGACCGACCAGAAAATGTCCATGGAGGAATTTTAGCTGATGATATGGGTTTGGGTAAAACTCTTACGGCC
ATTGCAGTAATCCTTACCAACTTCCATGATGGCAGACCTCTTCCTATTGAAAGAGTTAAAAAGAATCTACTGAAGAAGGAATATAATGTT
AACGATGACTCTATGAAACTTGGAGGAAACAATACCAGTGAAAAGGCAGATGGACTAAGCAAAGACGCATCTAGATGTAGTGAACAACCC
AGTATTTCAGATATCAAGGAGAAGAGTAAGTTTCGCATGTCAGAATTGTCTAGCTCCCGCCCCAAAAGAAGAAAAACTGCTGTCCAGTAC
ATAGAAAGCAGTGATTCAGAGGAAATTGAAACAAGTGAATTGCCGCAGAAAATGAAAGGCAAACTGAAAAATGTACAGTCTGAAACTAAA
GGCAGGGCGAAAGCAGGATCTTCTAAGGTTATAGAAGATGTGGCATTTGCATGTGCATTAACTTCATCTGTTCCTACAACAAAAAAGAAA
ATGTTGAAAAAGGTGATGAATCACCAACACCAGCAGCAGATGGCCCCCAGTACCCTGAGCCAGCAGAACCACCCCACTCAGAACCCACCC
GCAGGGCTCATGAGTATGCCCAATGCGCTGACCACTCAGCAGCAGCAGCAGCAGAAACTGCGGCTTCAGAGAATCCAGATGGAGAGAGAA
AGGATTCGAATGCGCCAAGAGGAGCTCATGAGGCAGGAAGCTGCCCTCTGTCGACAGCTCCCCATGGAAGCTGAGACTCTTGCCCCAGTT
CAGGCTGCTGTCAACCCACCCACGATGACCCCAGACATGAGATCCATCACTAATAATAGCTCAGATCCTTTCCTCAATGGAGGGCCATAT
CATTCGAGGGAGCAGAGCACTGACAGTGGCCTGGGGTTAGGGTGCTACAGTGTCCCCACAACTCCGGAGGACTTCCTCAGCAATGTGGAT
GAGATGGATACAGGAGAAAACGCAGGACAAACACCCATGAACATCAATCCCCAACAGACCCGTTTCCCTGATTTCCTTGACTGTCTTCCA
GGAACAAACGTTGACTTAGGAACTTTGGAATCTGAAGACCTGATCCCCCTCTTCAATGATGTAGAGTCTGCTCTGAACAAAAGTGAGCCC
TTTCTAACCTGGCTGTAATCACTACCATTGTAACTTGGATGTAGCCATGACCTTACATTTCCTGGGCCTCTTGGAAAAAGTGATGGAGCA
GAGCAAGTCTGCAGGTGCACCACTTCCCGCCTCCATGACTCGTGCTCCCTCCTTTTTATGTTGCCAGTTTAATCATTGCCTGGTTTTGAT
TGAGAGTAACTTAAGTTAAACATAAATAAATATTCTATTTTCATTTTCTGCAAGCCTGCGTTCTTGTGACAGATTATACAGAATTGTGTC
TGCAGGATTGATTATGCAGAATACTTTTCTCTTTCTTCTCTGCTGCCCCATGGCTAAGCTTTATGGGTGTTAATTGAAATTTATACACCA
ATTGATTTTAAACCATAAAAAGCTGACCACAGGCAGTTACTTCTGAGGGCATCTTGGTCCAGGAAATGTGCACAAAATTCGACCTGATTT
ACAGTTTCAAAAACTGTATTGATGACAGTAGTACCAAATGCTTTAAAAACTATTTAACTTGAGCTTTAAAAATCATTGTATGGATAGTAA
AATTCTACTGTATGGAATACAATGTAATTTTGAATCCATGCTGGCTCTGATGGCTCTTATTAGTCTGTATTTATAAAGGCACACAGTCCT
ATTGTAGCTTATCTTTCGTTATTTTACTGCAGAGCATCTAGACAACTTAGTCCCTCCAGCGGGAAAGTAGCAGCAGCAGCATTAGTCACA
GGTCTTACACTACAGATCTTGTGAAAGAGACCAGTTTGGTACTAATTATGAGCATTTTATTCAAACAAAAGTTTTTGAAATATTACAACT
GGGGATTTAAAAAATTGCAGCTTAGAATCTGATGGTTTTTTTTTTTCTTGATGTTGTTTGTTTGTTTTTGAGATCGAGTTTTGCTCTTGT
TGTCCAGGCTGGAATGCAATGGCACAATCTCGGCTCACTGCAACCTCTGCCTTCTGGGTTCAAGCGATTCTCCTGCCTTAGCCTCCCGAG
TAGCTGGGATTACAGGCACCTGCCACCACGTCCGGCTAATTTTTTGTATTTTGAGTAGAGACGGGGTTTCACCATAATGGTCAGGCTGTT
CTCAAACTCCTGATCTCAGGTGATCCACCCATCTCGGCCTCCCAAAGTGCTGGGATTACTGGCGTGAGCCACCGCACCCGGCCTTGATGT
TTATTTTATAAAGCACTGTAATTTTGTAGCTGATGACAAAAGGCAGCCAAATGTTTTTGATAAATCAGTGGCAACTGTATTTTTGTCTTT
TGAAATAACTCTGAAAACATCAGGACAACATAGATTTCAACCTGATAGCACACCACACACAGTGAGCTGTTGCTTTTTAAATTCTGAAGC
CTTGTCAGGTTTGCTTCCTAGATTTCAAGTGTTTAAAATAATTCTATCTATGAAACTGAAGGATGAAGCAGATCTCTGACTGACATGTAA
AAAAAAATGCCCTTTGAGGGTGTATGGTGGAGATAAATGTTTCTGAATTCAGTAAAATTGATTCCTAAGTATATTATCCTAATCCTGTTT
GCTACAGTTGGTATAAAAAGGCATGAAATATGTATTCAATACCTCTTATGTAACCAAAACCATTTTTAATTAGCTTTTAAGGACTGAGAG
AGCATCATGTTCAACTGGCATGCAGTCTGCCTGCATTGCCAATGAAGTCCTCAACTGTTTAATATTTTGAACTAATATTATTTATAATCT
ATGAATTTAATCTTTTTTGAAAGACTTTAATAATTTGAGTCTCTGAGAGGATACTTTCAATTTCCATGGGGGACTTATTTGTTGGGGATC
TTAAATAAGATTCCTTTTGATCTACCGGAATATACATGTACAGAGTACATTGGATCATGTTGGAAAGAAGGCAAGTGAAAAGGTCAGAGA
TGAAGTAGCAAAGTTATGGAATATCGTGGAAAGGATACTAGTTGTGAAATGGAAAGAGACAAGTTATAGTACCCCAAAAGCAAAACAAGC
AGGAGATGCAAGAGATGCCCCAAAAGGACAAAGCAACAATTTTCTGTTGCCACCTTTATACCGGAAGACTCTGTTGTAGAAGAAAAGAAG
GCTTTGGTGCACCTTATGTGGGAGGAGGAGGGGCAGGGCATGCTGATGCTGAGCGTACAGGCAGACAAGAGCGTAGCCTGCTGTTGCCTC
CATCACTATGAAATGACTTATTTTACCTGAAGGACCCATGGTTTATGTTCCTCTAATTCCTTTCACTCTCCCTAAGCCCTCTGAGAGAGA
TGAAGATAGATGATTTTATTGCTACTAAATTGAAGGGAGCACTATTTCTTTTTGTCTTTTGTTAGCAAAAAATTGCAAAAAGAATTGTAC
ATTCTTGCTAAAAATAAATAAATAAATAAAAAATTAAAAAAACAAGGGACCTAACAAAACTCAGCAGTGTTACTGTATTTTTAAAAAATA
TTTTTATAGACTCATTTTCAGGTTATTAAATGTAAGAGAAACAGATACCCCTCTTTTTTAAAGTAGGTAAATCATTGATGATTTATATTA
CCAATTTTTAGAAGTAATTTTCTAGTAAGCTTGTGGCATCAGAAAATACTAGAAGATTTTTTTAGTTAAATTAGTTAGAACATTTATGAA
TGAATATAATAAATATTTTTTCAGAATAAAATATGGACCCTTTGTGTTTACTAATAGATAAAGCCAGATATAATTTTTTGTTTTTAAGGC
CACAAAATATGGCCTTTGTTAAAGAACACTAAAGTTAGAAATCTAAAGTTAGAGCAACTTTTTAATGGCTATTTCCTATTATTGTAAGTG
TTAAAACCCCTGCAGAATTCTTGATAAGGTGCTATTTATACTATATTTCTTATTATAAGATAACTGTCTTTAGTCTTCTTAGTACTAGTC
TTTTTAGTACTAAATCAATCAGTAAACATCATCATTTCACCCCAAAATTTTGTCACAGAAAAGGCGTATCAAATGAAAAATAATTTCAGA
GATCTTTCTTTCAAGATATTTTTTCCTGATAAAATACATTGTCTTGAAGTAAATACATTGTCAAAACCTAATTGCAATTCTGTTAAATCT
AAGTAATTTTTAGACAGTGTTTCACCGTATTATTTAGGATGTGAAATGCCATTTCTTTCACTGATTACACCATATACAGGAAACAGGTAA
AACAGTGAAAACTTTATTGTGCTGGTTGATGCCAACTTGGTTGAAAAGCTCTCTGCAGAAGAAGTGATCTAGACTGACAGAAGTGTTGCT
AATTACAAGTTGTGTTCTCATGACGTAATTAGAAAGTAACTTCTCAAAGTACAACTTTTATGAAAAAAATAAGCTGTTAAAAAAAGGAAA
TCGTAGGTTAATTTAATTGGGAAAATGGGCAATTGACAGAGACCATTTTCCTAACACATATATGTGCTAGTACTTTAACTTTTTAAAATT
TTACTTCTACGTTTTGTAATATAAAAATTTCTATTTTAAGTTTAGAATGTTATACGTACCGAAAGTATGCAGCCAAATCGATCAGATCAA

>In-frame_HLTF_ENST00000392912_chr3_148777505_-_WWTR1_ENST00000360632_chr3_149260324_-_2738nt
GTCTGACTGGACTCGCGGCGACTTACCTTTCAGTCGTGCGCTCCTGATCCGGCGCTCGGAATTTGTCCCCGGCTTCAGGGCTGCGGGGCC
TGGAAGGAGGCGTATCGAGGCGGCTCGAAAACGATCCAGGGGAGCCGAGGCGCTCCTCTTGTCATCCCACTCAGCGCCATGTCCTGGATG
TTCAAGAGGGATCCAGTTTGGAAGTACTTGCAGACTGTCCAGTATGGAGTTCATGGAAATTTTCCACGCCTCTCATATCCAACTTTCTTT
CCACGTTTTGAATTCCAAGATGTTATCCCTCCAGATGACTTTCTAACTAGTGATGAAGAAGTAGATTCCGTTTTATTTGGAAGTTTGAGA
GGTCATGTGGTTGGACTACGCTATTACACGGGAGTAGTTAATAATAATGAAATGGTTGCATTACAACGAGATCCTAATAACCCTTATGAT
AAGAATGCAATTAAAGTAAACAATGTGAATGGAAATCAAGTTGGCCATTTAAAGAAAGAGCTTGCAGGTGCTTTGGCCTATATCATGGAC
AACAAATTGGCACAAATTGAAGGGGTAGTTCCTTTTGGTGCAAACAATGCTTTTACCATGCCTCTGCATATGACTTTTTGGGGAAAAGAA
GAAAATAGAAAAGCGGTTTCAGATCAGTTGAAGAAACATGGATTTAAATTGGGTCCTGCACCAAAAACTTTAGGATTCAATTTGGAAAGT
GGTTGGGGCTCTGGAAGAGCTGGACCAAGCTATAGTATGCCAGTGCATGCTGCAGTACAGATGACAACTGAACAGCTTAAAACAGAATTT
GACAAATTGTTTGAAGATTTAAAAGAAGATGATAAAACCCATGAAATGGAACCAGCTGAGGCTATTGAAACACCACTGCTTCCACATCAA
AAACAAGCTCTAGCTTGGATGGTGTCACGGGAAAATAGCAAAGAACTTCCACCATTCTGGGAACAGCGAAATGACTTATACTATAACACA
ATAACAAATTTTTCTGAGAAGGACCGACCAGAAAATGTCCATGGAGGAATTTTAGCTGATGATATGGGTTTGGGTAAAACTCTTACGGCC
ATTGCAGTAATCCTTACCAACTTCCATGATGGCAGACCTCTTCCTATTGAAAGAGTTAAAAAGAATCTACTGAAGAAGGAATATAATGTT
AACGATGACTCTATGAAACTTGGAGGAAACAATACCAGTGAAAAGGCAGATGGACTAAGCAAAGACGCATCTAGATGTAGTGAACAACCC
AGTATTTCAGATATCAAGGAGAAGAGTAAGTTTCGCATGTCAGAATTGTCTAGCTCCCGCCCCAAAAGAAGAAAAACTGCTGTCCAGTAC
ATAGAAAGCAGTGATTCAGAGGAAATTGAAACAAGTGAATTGCCGCAGAAAATGAAAGGCAAACTGAAAAATGTACAGTCTGAAACTAAA
GGCAGGGCGAAAGCAGGATCTTCTAAGGTTATAGAAGATGTGGCATTTGCATGTGCATTAACTTCATCTGTTCCTACAACAAAAAAGAAA
ATGTTGAAAAAGGTGATGAATCACCAACACCAGCAGCAGATGGCCCCCAGTACCCTGAGCCAGCAGAACCACCCCACTCAGAACCCACCC
GCAGGGCTCATGAGTATGCCCAATGCGCTGACCACTCAGCAGCAGCAGCAGCAGAAACTGCGGCTTCAGAGAATCCAGATGGAGAGAGAA
AGGATTCGAATGCGCCAAGAGGAGCTCATGAGGCAGGAAGCTGCCCTCTGTCGACAGCTCCCCATGGAAGCTGAGACTCTTGCCCCAGTT
CAGGCTGCTGTCAACCCACCCACGATGACCCCAGACATGAGATCCATCACTAATAATAGCTCAGATCCTTTCCTCAATGGAGGGCCATAT
CATTCGAGGGAGCAGAGCACTGACAGTGGCCTGGGGTTAGGGTGCTACAGTGTCCCCACAACTCCGGAGGACTTCCTCAGCAATGTGGAT
GAGATGGATACAGGAGAAAACGCAGGACAAACACCCATGAACATCAATCCCCAACAGACCCGTTTCCCTGATTTCCTTGACTGTCTTCCA
GGAACAAACGTTGACTTAGGAACTTTGGAATCTGAAGACCTGATCCCCCTCTTCAATGATGTAGAGTCTGCTCTGAACAAAAGTGAGCCC
TTTCTAACCTGGCTGTAATCACTACCATTGTAACTTGGATGTAGCCATGACCTTACATTTCCTGGGCCTCTTGGAAAAAGTGATGGAGCA
GAGCAAGTCTGCAGGTGCACCACTTCCCGCCTCCATGACTCGTGCTCCCTCCTTTTTATGTTGCCAGTTTAATCATTGCCTGGTTTTGAT
TGAGAGTAACTTAAGTTAAACATAAATAAATATTCTATTTTCATTTTCTGCAAGCCTGCGTTCTTGTGACAGATTATACAGAATTGTGTC
TGCAGGATTGATTATGCAGAATACTTTTCTCTTTCTTCTCTGCTGCCCCATGGCTAAGCTTTATGGGTGTTAATTGAAATTTATACACCA
ATTGATTTTAAACCATAAAAAGCTGACCACAGGCAGTTACTTCTGAGGGCATCTTGGTCCAGGAAATGTGCACAAAATTCGACCTGATTT
ACAGTTTCAAAAACTGTATTGATGACAGTAGTACCAAATGCTTTAAAAACTATTTAACTTGAGCTTTAAAAATCATTGTATGGATAGTAA

>In-frame_HLTF_ENST00000392912_chr3_148777505_-_WWTR1_ENST00000467467_chr3_149260324_-_2373nt
GTCTGACTGGACTCGCGGCGACTTACCTTTCAGTCGTGCGCTCCTGATCCGGCGCTCGGAATTTGTCCCCGGCTTCAGGGCTGCGGGGCC
TGGAAGGAGGCGTATCGAGGCGGCTCGAAAACGATCCAGGGGAGCCGAGGCGCTCCTCTTGTCATCCCACTCAGCGCCATGTCCTGGATG
TTCAAGAGGGATCCAGTTTGGAAGTACTTGCAGACTGTCCAGTATGGAGTTCATGGAAATTTTCCACGCCTCTCATATCCAACTTTCTTT
CCACGTTTTGAATTCCAAGATGTTATCCCTCCAGATGACTTTCTAACTAGTGATGAAGAAGTAGATTCCGTTTTATTTGGAAGTTTGAGA
GGTCATGTGGTTGGACTACGCTATTACACGGGAGTAGTTAATAATAATGAAATGGTTGCATTACAACGAGATCCTAATAACCCTTATGAT
AAGAATGCAATTAAAGTAAACAATGTGAATGGAAATCAAGTTGGCCATTTAAAGAAAGAGCTTGCAGGTGCTTTGGCCTATATCATGGAC
AACAAATTGGCACAAATTGAAGGGGTAGTTCCTTTTGGTGCAAACAATGCTTTTACCATGCCTCTGCATATGACTTTTTGGGGAAAAGAA
GAAAATAGAAAAGCGGTTTCAGATCAGTTGAAGAAACATGGATTTAAATTGGGTCCTGCACCAAAAACTTTAGGATTCAATTTGGAAAGT
GGTTGGGGCTCTGGAAGAGCTGGACCAAGCTATAGTATGCCAGTGCATGCTGCAGTACAGATGACAACTGAACAGCTTAAAACAGAATTT
GACAAATTGTTTGAAGATTTAAAAGAAGATGATAAAACCCATGAAATGGAACCAGCTGAGGCTATTGAAACACCACTGCTTCCACATCAA
AAACAAGCTCTAGCTTGGATGGTGTCACGGGAAAATAGCAAAGAACTTCCACCATTCTGGGAACAGCGAAATGACTTATACTATAACACA
ATAACAAATTTTTCTGAGAAGGACCGACCAGAAAATGTCCATGGAGGAATTTTAGCTGATGATATGGGTTTGGGTAAAACTCTTACGGCC
ATTGCAGTAATCCTTACCAACTTCCATGATGGCAGACCTCTTCCTATTGAAAGAGTTAAAAAGAATCTACTGAAGAAGGAATATAATGTT
AACGATGACTCTATGAAACTTGGAGGAAACAATACCAGTGAAAAGGCAGATGGACTAAGCAAAGACGCATCTAGATGTAGTGAACAACCC
AGTATTTCAGATATCAAGGAGAAGAGTAAGTTTCGCATGTCAGAATTGTCTAGCTCCCGCCCCAAAAGAAGAAAAACTGCTGTCCAGTAC
ATAGAAAGCAGTGATTCAGAGGAAATTGAAACAAGTGAATTGCCGCAGAAAATGAAAGGCAAACTGAAAAATGTACAGTCTGAAACTAAA
GGCAGGGCGAAAGCAGGATCTTCTAAGGTTATAGAAGATGTGGCATTTGCATGTGCATTAACTTCATCTGTTCCTACAACAAAAAAGAAA
ATGTTGAAAAAGGTGATGAATCACCAACACCAGCAGCAGATGGCCCCCAGTACCCTGAGCCAGCAGAACCACCCCACTCAGAACCCACCC
GCAGGGCTCATGAGTATGCCCAATGCGCTGACCACTCAGCAGCAGCAGCAGCAGAAACTGCGGCTTCAGAGAATCCAGATGGAGAGAGAA
AGGATTCGAATGCGCCAAGAGGAGCTCATGAGGCAGGAAGCTGCCCTCTGTCGACAGCTCCCCATGGAAGCTGAGACTCTTGCCCCAGTT
CAGGCTGCTGTCAACCCACCCACGATGACCCCAGACATGAGATCCATCACTAATAATAGCTCAGATCCTTTCCTCAATGGAGGGCCATAT
CATTCGAGGGAGCAGAGCACTGACAGTGGCCTGGGGTTAGGGTGCTACAGTGTCCCCACAACTCCGGAGGACTTCCTCAGCAATGTGGAT
GAGATGGATACAGGAGAAAACGCAGGACAAACACCCATGAACATCAATCCCCAACAGACCCGTTTCCCTGATTTCCTTGACTGTCTTCCA
GGAACAAACGTTGACTTAGGAACTTTGGAATCTGAAGACCTGATCCCCCTCTTCAATGATGTAGAGTCTGCTCTGAACAAAAGTGAGCCC
TTTCTAACCTGGCTGTAATCACTACCATTGTAACTTGGATGTAGCCATGACCTTACATTTCCTGGGCCTCTTGGAAAAAGTGATGGAGCA
GAGCAAGTCTGCAGGTGCACCACTTCCCGCCTCCATGACTCGTGCTCCCTCCTTTTTATGTTGCCAGTTTAATCATTGCCTGGTTTTGAT

>In-frame_HLTF_ENST00000494055_chr3_148777505_-_WWTR1_ENST00000465804_chr3_149260324_-_5798nt
ACAGAGCGACGCTGGTCTCCCAGATTGTTGCAGAAGGAGACGGCGTCGACGTCTGACTGGACTCGCGGCGACTTACCTTTCAGTCGTGCG
CTCCTGATCCGGCGCTCGGAATTTGTCCCCGGCTTCAGGGCTGCGGGGCCTGGAAGGAGGCGTATCGAGGCGGCTCGAAAACGATCCAGG
GGAGCCGAGGCGCTCCTCTTGTCATCCCACTCAGCGCCATGTCCTGGATGTTCAAGAGGGATCCAGTTTGGAAGTACTTGCAGACTGTCC
AGTATGGAGTTCATGGAAATTTTCCACGCCTCTCATATCCAACTTTCTTTCCACGTTTTGAATTCCAAGATGTTATCCCTCCAGATGACT
TTCTAACTAGTGATGAAGAAGTAGATTCCGTTTTATTTGGAAGTTTGAGAGGTCATGTGGTTGGACTACGCTATTACACGGGAGTAGTTA
ATAATAATGAAATGGTTGCATTACAACGAGATCCTAATAACCCTTATGATAAGAATGCAATTAAAGTAAACAATGTGAATGGAAATCAAG
TTGGCCATTTAAAGAAAGAGCTTGCAGGTGCTTTGGCCTATATCATGGACAACAAATTGGCACAAATTGAAGGGGTAGTTCCTTTTGGTG
CAAACAATGCTTTTACCATGCCTCTGCATATGACTTTTTGGGGAAAAGAAGAAAATAGAAAAGCGGTTTCAGATCAGTTGAAGAAACATG
GATTTAAATTGGGTCCTGCACCAAAAACTTTAGGATTCAATTTGGAAAGTGGTTGGGGCTCTGGAAGAGCTGGACCAAGCTATAGTATGC
CAGTGCATGCTGCAGTACAGATGACAACTGAACAGCTTAAAACAGAATTTGACAAATTGTTTGAAGATTTAAAAGAAGATGATAAAACCC
ATGAAATGGAACCAGCTGAGGCTATTGAAACACCACTGCTTCCACATCAAAAACAAGCTCTAGCTTGGATGGTGTCACGGGAAAATAGCA
AAGAACTTCCACCATTCTGGGAACAGCGAAATGACTTATACTATAACACAATAACAAATTTTTCTGAGAAGGACCGACCAGAAAATGTCC
ATGGAGGAATTTTAGCTGATGATATGGGTTTGGGTAAAACTCTTACGGCCATTGCAGTAATCCTTACCAACTTCCATGATGGCAGACCTC
TTCCTATTGAAAGAGTTAAAAAGAATCTACTGAAGAAGGAATATAATGTTAACGATGACTCTATGAAACTTGGAGGAAACAATACCAGTG
AAAAGGCAGATGGACTAAGCAAAGACGCATCTAGATGTAGTGAACAACCCAGTATTTCAGATATCAAGGAGAAGAGTAAGTTTCGCATGT
CAGAATTGTCTAGCTCCCGCCCCAAAAGAAGAAAAACTGCTGTCCAGTACATAGAAAGCAGTGATTCAGAGGAAATTGAAACAAGTGAAT
TGCCGCAGAAAATGAAAGGCAAACTGAAAAATGTACAGTCTGAAACTAAAGGCAGGGCGAAAGCAGGATCTTCTAAGGTTATAGAAGATG
TGGCATTTGCATGTGCATTAACTTCATCTGTTCCTACAACAAAAAAGAAAATGTTGAAAAAGGTGATGAATCACCAACACCAGCAGCAGA
TGGCCCCCAGTACCCTGAGCCAGCAGAACCACCCCACTCAGAACCCACCCGCAGGGCTCATGAGTATGCCCAATGCGCTGACCACTCAGC
AGCAGCAGCAGCAGAAACTGCGGCTTCAGAGAATCCAGATGGAGAGAGAAAGGATTCGAATGCGCCAAGAGGAGCTCATGAGGCAGGAAG
CTGCCCTCTGTCGACAGCTCCCCATGGAAGCTGAGACTCTTGCCCCAGTTCAGGCTGCTGTCAACCCACCCACGATGACCCCAGACATGA
GATCCATCACTAATAATAGCTCAGATCCTTTCCTCAATGGAGGGCCATATCATTCGAGGGAGCAGAGCACTGACAGTGGCCTGGGGTTAG
GGTGCTACAGTGTCCCCACAACTCCGGAGGACTTCCTCAGCAATGTGGATGAGATGGATACAGGAGAAAACGCAGGACAAACACCCATGA
ACATCAATCCCCAACAGACCCGTTTCCCTGATTTCCTTGACTGTCTTCCAGGAACAAACGTTGACTTAGGAACTTTGGAATCTGAAGACC
TGATCCCCCTCTTCAATGATGTAGAGTCTGCTCTGAACAAAAGTGAGCCCTTTCTAACCTGGCTGTAATCACTACCATTGTAACTTGGAT
GTAGCCATGACCTTACATTTCCTGGGCCTCTTGGAAAAAGTGATGGAGCAGAGCAAGTCTGCAGGTGCACCACTTCCCGCCTCCATGACT
CGTGCTCCCTCCTTTTTATGTTGCCAGTTTAATCATTGCCTGGTTTTGATTGAGAGTAACTTAAGTTAAACATAAATAAATATTCTATTT
TCATTTTCTGCAAGCCTGCGTTCTTGTGACAGATTATACAGAATTGTGTCTGCAGGATTGATTATGCAGAATACTTTTCTCTTTCTTCTC
TGCTGCCCCATGGCTAAGCTTTATGGGTGTTAATTGAAATTTATACACCAATTGATTTTAAACCATAAAAAGCTGACCACAGGCAGTTAC
TTCTGAGGGCATCTTGGTCCAGGAAATGTGCACAAAATTCGACCTGATTTACAGTTTCAAAAACTGTATTGATGACAGTAGTACCAAATG
CTTTAAAAACTATTTAACTTGAGCTTTAAAAATCATTGTATGGATAGTAAAATTCTACTGTATGGAATACAATGTAATTTTGAATCCATG
CTGGCTCTGATGGCTCTTATTAGTCTGTATTTATAAAGGCACACAGTCCTATTGTAGCTTATCTTTCGTTATTTTACTGCAGAGCATCTA
GACAACTTAGTCCCTCCAGCGGGAAAGTAGCAGCAGCAGCATTAGTCACAGGTCTTACACTACAGATCTTGTGAAAGAGACCAGTTTGGT
ACTAATTATGAGCATTTTATTCAAACAAAAGTTTTTGAAATATTACAACTGGGGATTTAAAAAATTGCAGCTTAGAATCTGATGGTTTTT
TTTTTTCTTGATGTTGTTTGTTTGTTTTTGAGATCGAGTTTTGCTCTTGTTGTCCAGGCTGGAATGCAATGGCACAATCTCGGCTCACTG
CAACCTCTGCCTTCTGGGTTCAAGCGATTCTCCTGCCTTAGCCTCCCGAGTAGCTGGGATTACAGGCACCTGCCACCACGTCCGGCTAAT
TTTTTGTATTTTGAGTAGAGACGGGGTTTCACCATAATGGTCAGGCTGTTCTCAAACTCCTGATCTCAGGTGATCCACCCATCTCGGCCT
CCCAAAGTGCTGGGATTACTGGCGTGAGCCACCGCACCCGGCCTTGATGTTTATTTTATAAAGCACTGTAATTTTGTAGCTGATGACAAA
AGGCAGCCAAATGTTTTTGATAAATCAGTGGCAACTGTATTTTTGTCTTTTGAAATAACTCTGAAAACATCAGGACAACATAGATTTCAA
CCTGATAGCACACCACACACAGTGAGCTGTTGCTTTTTAAATTCTGAAGCCTTGTCAGGTTTGCTTCCTAGATTTCAAGTGTTTAAAATA
ATTCTATCTATGAAACTGAAGGATGAAGCAGATCTCTGACTGACATGTAAAAAAAAATGCCCTTTGAGGGTGTATGGTGGAGATAAATGT
TTCTGAATTCAGTAAAATTGATTCCTAAGTATATTATCCTAATCCTGTTTGCTACAGTTGGTATAAAAAGGCATGAAATATGTATTCAAT
ACCTCTTATGTAACCAAAACCATTTTTAATTAGCTTTTAAGGACTGAGAGAGCATCATGTTCAACTGGCATGCAGTCTGCCTGCATTGCC
AATGAAGTCCTCAACTGTTTAATATTTTGAACTAATATTATTTATAATCTATGAATTTAATCTTTTTTGAAAGACTTTAATAATTTGAGT
CTCTGAGAGGATACTTTCAATTTCCATGGGGGACTTATTTGTTGGGGATCTTAAATAAGATTCCTTTTGATCTACCGGAATATACATGTA
CAGAGTACATTGGATCATGTTGGAAAGAAGGCAAGTGAAAAGGTCAGAGATGAAGTAGCAAAGTTATGGAATATCGTGGAAAGGATACTA
GTTGTGAAATGGAAAGAGACAAGTTATAGTACCCCAAAAGCAAAACAAGCAGGAGATGCAAGAGATGCCCCAAAAGGACAAAGCAACAAT
TTTCTGTTGCCACCTTTATACCGGAAGACTCTGTTGTAGAAGAAAAGAAGGCTTTGGTGCACCTTATGTGGGAGGAGGAGGGGCAGGGCA
TGCTGATGCTGAGCGTACAGGCAGACAAGAGCGTAGCCTGCTGTTGCCTCCATCACTATGAAATGACTTATTTTACCTGAAGGACCCATG
GTTTATGTTCCTCTAATTCCTTTCACTCTCCCTAAGCCCTCTGAGAGAGATGAAGATAGATGATTTTATTGCTACTAAATTGAAGGGAGC
ACTATTTCTTTTTGTCTTTTGTTAGCAAAAAATTGCAAAAAGAATTGTACATTCTTGCTAAAAATAAATAAATAAATAAAAAATTAAAAA
AACAAGGGACCTAACAAAACTCAGCAGTGTTACTGTATTTTTAAAAAATATTTTTATAGACTCATTTTCAGGTTATTAAATGTAAGAGAA
ACAGATACCCCTCTTTTTTAAAGTAGGTAAATCATTGATGATTTATATTACCAATTTTTAGAAGTAATTTTCTAGTAAGCTTGTGGCATC
AGAAAATACTAGAAGATTTTTTTAGTTAAATTAGTTAGAACATTTATGAATGAATATAATAAATATTTTTTCAGAATAAAATATGGACCC
TTTGTGTTTACTAATAGATAAAGCCAGATATAATTTTTTGTTTTTAAGGCCACAAAATATGGCCTTTGTTAAAGAACACTAAAGTTAGAA
ATCTAAAGTTAGAGCAACTTTTTAATGGCTATTTCCTATTATTGTAAGTGTTAAAACCCCTGCAGAATTCTTGATAAGGTGCTATTTATA
CTATATTTCTTATTATAAGATAACTGTCTTTAGTCTTCTTAGTACTAGTCTTTTTAGTACTAAATCAATCAGTAAACATCATCATTTCAC
CCCAAAATTTTGTCACAGAAAAGGCGTATCAAATGAAAAATAATTTCAGAGATCTTTCTTTCAAGATATTTTTTCCTGATAAAATACATT
GTCTTGAAGTAAATACATTGTCAAAACCTAATTGCAATTCTGTTAAATCTAAGTAATTTTTAGACAGTGTTTCACCGTATTATTTAGGAT
GTGAAATGCCATTTCTTTCACTGATTACACCATATACAGGAAACAGGTAAAACAGTGAAAACTTTATTGTGCTGGTTGATGCCAACTTGG
TTGAAAAGCTCTCTGCAGAAGAAGTGATCTAGACTGACAGAAGTGTTGCTAATTACAAGTTGTGTTCTCATGACGTAATTAGAAAGTAAC
TTCTCAAAGTACAACTTTTATGAAAAAAATAAGCTGTTAAAAAAAGGAAATCGTAGGTTAATTTAATTGGGAAAATGGGCAATTGACAGA
GACCATTTTCCTAACACATATATGTGCTAGTACTTTAACTTTTTAAAATTTTACTTCTACGTTTTGTAATATAAAAATTTCTATTTTAAG
TTTAGAATGTTATACGTACCGAAAGTATGCAGCCAAATCGATCAGATCAAACCATTTTACCTGGAGTTTGGTACTGGTTTTTACTTCTCT

>In-frame_HLTF_ENST00000494055_chr3_148777505_-_WWTR1_ENST00000360632_chr3_149260324_-_2788nt
ACAGAGCGACGCTGGTCTCCCAGATTGTTGCAGAAGGAGACGGCGTCGACGTCTGACTGGACTCGCGGCGACTTACCTTTCAGTCGTGCG
CTCCTGATCCGGCGCTCGGAATTTGTCCCCGGCTTCAGGGCTGCGGGGCCTGGAAGGAGGCGTATCGAGGCGGCTCGAAAACGATCCAGG
GGAGCCGAGGCGCTCCTCTTGTCATCCCACTCAGCGCCATGTCCTGGATGTTCAAGAGGGATCCAGTTTGGAAGTACTTGCAGACTGTCC
AGTATGGAGTTCATGGAAATTTTCCACGCCTCTCATATCCAACTTTCTTTCCACGTTTTGAATTCCAAGATGTTATCCCTCCAGATGACT
TTCTAACTAGTGATGAAGAAGTAGATTCCGTTTTATTTGGAAGTTTGAGAGGTCATGTGGTTGGACTACGCTATTACACGGGAGTAGTTA
ATAATAATGAAATGGTTGCATTACAACGAGATCCTAATAACCCTTATGATAAGAATGCAATTAAAGTAAACAATGTGAATGGAAATCAAG
TTGGCCATTTAAAGAAAGAGCTTGCAGGTGCTTTGGCCTATATCATGGACAACAAATTGGCACAAATTGAAGGGGTAGTTCCTTTTGGTG
CAAACAATGCTTTTACCATGCCTCTGCATATGACTTTTTGGGGAAAAGAAGAAAATAGAAAAGCGGTTTCAGATCAGTTGAAGAAACATG
GATTTAAATTGGGTCCTGCACCAAAAACTTTAGGATTCAATTTGGAAAGTGGTTGGGGCTCTGGAAGAGCTGGACCAAGCTATAGTATGC
CAGTGCATGCTGCAGTACAGATGACAACTGAACAGCTTAAAACAGAATTTGACAAATTGTTTGAAGATTTAAAAGAAGATGATAAAACCC
ATGAAATGGAACCAGCTGAGGCTATTGAAACACCACTGCTTCCACATCAAAAACAAGCTCTAGCTTGGATGGTGTCACGGGAAAATAGCA
AAGAACTTCCACCATTCTGGGAACAGCGAAATGACTTATACTATAACACAATAACAAATTTTTCTGAGAAGGACCGACCAGAAAATGTCC
ATGGAGGAATTTTAGCTGATGATATGGGTTTGGGTAAAACTCTTACGGCCATTGCAGTAATCCTTACCAACTTCCATGATGGCAGACCTC
TTCCTATTGAAAGAGTTAAAAAGAATCTACTGAAGAAGGAATATAATGTTAACGATGACTCTATGAAACTTGGAGGAAACAATACCAGTG
AAAAGGCAGATGGACTAAGCAAAGACGCATCTAGATGTAGTGAACAACCCAGTATTTCAGATATCAAGGAGAAGAGTAAGTTTCGCATGT
CAGAATTGTCTAGCTCCCGCCCCAAAAGAAGAAAAACTGCTGTCCAGTACATAGAAAGCAGTGATTCAGAGGAAATTGAAACAAGTGAAT
TGCCGCAGAAAATGAAAGGCAAACTGAAAAATGTACAGTCTGAAACTAAAGGCAGGGCGAAAGCAGGATCTTCTAAGGTTATAGAAGATG
TGGCATTTGCATGTGCATTAACTTCATCTGTTCCTACAACAAAAAAGAAAATGTTGAAAAAGGTGATGAATCACCAACACCAGCAGCAGA
TGGCCCCCAGTACCCTGAGCCAGCAGAACCACCCCACTCAGAACCCACCCGCAGGGCTCATGAGTATGCCCAATGCGCTGACCACTCAGC
AGCAGCAGCAGCAGAAACTGCGGCTTCAGAGAATCCAGATGGAGAGAGAAAGGATTCGAATGCGCCAAGAGGAGCTCATGAGGCAGGAAG
CTGCCCTCTGTCGACAGCTCCCCATGGAAGCTGAGACTCTTGCCCCAGTTCAGGCTGCTGTCAACCCACCCACGATGACCCCAGACATGA
GATCCATCACTAATAATAGCTCAGATCCTTTCCTCAATGGAGGGCCATATCATTCGAGGGAGCAGAGCACTGACAGTGGCCTGGGGTTAG
GGTGCTACAGTGTCCCCACAACTCCGGAGGACTTCCTCAGCAATGTGGATGAGATGGATACAGGAGAAAACGCAGGACAAACACCCATGA
ACATCAATCCCCAACAGACCCGTTTCCCTGATTTCCTTGACTGTCTTCCAGGAACAAACGTTGACTTAGGAACTTTGGAATCTGAAGACC
TGATCCCCCTCTTCAATGATGTAGAGTCTGCTCTGAACAAAAGTGAGCCCTTTCTAACCTGGCTGTAATCACTACCATTGTAACTTGGAT
GTAGCCATGACCTTACATTTCCTGGGCCTCTTGGAAAAAGTGATGGAGCAGAGCAAGTCTGCAGGTGCACCACTTCCCGCCTCCATGACT
CGTGCTCCCTCCTTTTTATGTTGCCAGTTTAATCATTGCCTGGTTTTGATTGAGAGTAACTTAAGTTAAACATAAATAAATATTCTATTT
TCATTTTCTGCAAGCCTGCGTTCTTGTGACAGATTATACAGAATTGTGTCTGCAGGATTGATTATGCAGAATACTTTTCTCTTTCTTCTC
TGCTGCCCCATGGCTAAGCTTTATGGGTGTTAATTGAAATTTATACACCAATTGATTTTAAACCATAAAAAGCTGACCACAGGCAGTTAC
TTCTGAGGGCATCTTGGTCCAGGAAATGTGCACAAAATTCGACCTGATTTACAGTTTCAAAAACTGTATTGATGACAGTAGTACCAAATG

>In-frame_HLTF_ENST00000494055_chr3_148777505_-_WWTR1_ENST00000467467_chr3_149260324_-_2423nt
ACAGAGCGACGCTGGTCTCCCAGATTGTTGCAGAAGGAGACGGCGTCGACGTCTGACTGGACTCGCGGCGACTTACCTTTCAGTCGTGCG
CTCCTGATCCGGCGCTCGGAATTTGTCCCCGGCTTCAGGGCTGCGGGGCCTGGAAGGAGGCGTATCGAGGCGGCTCGAAAACGATCCAGG
GGAGCCGAGGCGCTCCTCTTGTCATCCCACTCAGCGCCATGTCCTGGATGTTCAAGAGGGATCCAGTTTGGAAGTACTTGCAGACTGTCC
AGTATGGAGTTCATGGAAATTTTCCACGCCTCTCATATCCAACTTTCTTTCCACGTTTTGAATTCCAAGATGTTATCCCTCCAGATGACT
TTCTAACTAGTGATGAAGAAGTAGATTCCGTTTTATTTGGAAGTTTGAGAGGTCATGTGGTTGGACTACGCTATTACACGGGAGTAGTTA
ATAATAATGAAATGGTTGCATTACAACGAGATCCTAATAACCCTTATGATAAGAATGCAATTAAAGTAAACAATGTGAATGGAAATCAAG
TTGGCCATTTAAAGAAAGAGCTTGCAGGTGCTTTGGCCTATATCATGGACAACAAATTGGCACAAATTGAAGGGGTAGTTCCTTTTGGTG
CAAACAATGCTTTTACCATGCCTCTGCATATGACTTTTTGGGGAAAAGAAGAAAATAGAAAAGCGGTTTCAGATCAGTTGAAGAAACATG
GATTTAAATTGGGTCCTGCACCAAAAACTTTAGGATTCAATTTGGAAAGTGGTTGGGGCTCTGGAAGAGCTGGACCAAGCTATAGTATGC
CAGTGCATGCTGCAGTACAGATGACAACTGAACAGCTTAAAACAGAATTTGACAAATTGTTTGAAGATTTAAAAGAAGATGATAAAACCC
ATGAAATGGAACCAGCTGAGGCTATTGAAACACCACTGCTTCCACATCAAAAACAAGCTCTAGCTTGGATGGTGTCACGGGAAAATAGCA
AAGAACTTCCACCATTCTGGGAACAGCGAAATGACTTATACTATAACACAATAACAAATTTTTCTGAGAAGGACCGACCAGAAAATGTCC
ATGGAGGAATTTTAGCTGATGATATGGGTTTGGGTAAAACTCTTACGGCCATTGCAGTAATCCTTACCAACTTCCATGATGGCAGACCTC
TTCCTATTGAAAGAGTTAAAAAGAATCTACTGAAGAAGGAATATAATGTTAACGATGACTCTATGAAACTTGGAGGAAACAATACCAGTG
AAAAGGCAGATGGACTAAGCAAAGACGCATCTAGATGTAGTGAACAACCCAGTATTTCAGATATCAAGGAGAAGAGTAAGTTTCGCATGT
CAGAATTGTCTAGCTCCCGCCCCAAAAGAAGAAAAACTGCTGTCCAGTACATAGAAAGCAGTGATTCAGAGGAAATTGAAACAAGTGAAT
TGCCGCAGAAAATGAAAGGCAAACTGAAAAATGTACAGTCTGAAACTAAAGGCAGGGCGAAAGCAGGATCTTCTAAGGTTATAGAAGATG
TGGCATTTGCATGTGCATTAACTTCATCTGTTCCTACAACAAAAAAGAAAATGTTGAAAAAGGTGATGAATCACCAACACCAGCAGCAGA
TGGCCCCCAGTACCCTGAGCCAGCAGAACCACCCCACTCAGAACCCACCCGCAGGGCTCATGAGTATGCCCAATGCGCTGACCACTCAGC
AGCAGCAGCAGCAGAAACTGCGGCTTCAGAGAATCCAGATGGAGAGAGAAAGGATTCGAATGCGCCAAGAGGAGCTCATGAGGCAGGAAG
CTGCCCTCTGTCGACAGCTCCCCATGGAAGCTGAGACTCTTGCCCCAGTTCAGGCTGCTGTCAACCCACCCACGATGACCCCAGACATGA
GATCCATCACTAATAATAGCTCAGATCCTTTCCTCAATGGAGGGCCATATCATTCGAGGGAGCAGAGCACTGACAGTGGCCTGGGGTTAG
GGTGCTACAGTGTCCCCACAACTCCGGAGGACTTCCTCAGCAATGTGGATGAGATGGATACAGGAGAAAACGCAGGACAAACACCCATGA
ACATCAATCCCCAACAGACCCGTTTCCCTGATTTCCTTGACTGTCTTCCAGGAACAAACGTTGACTTAGGAACTTTGGAATCTGAAGACC
TGATCCCCCTCTTCAATGATGTAGAGTCTGCTCTGAACAAAAGTGAGCCCTTTCTAACCTGGCTGTAATCACTACCATTGTAACTTGGAT
GTAGCCATGACCTTACATTTCCTGGGCCTCTTGGAAAAAGTGATGGAGCAGAGCAAGTCTGCAGGTGCACCACTTCCCGCCTCCATGACT


Top

FusionGenePPI for HLTF_WWTR1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
HLTFPCNA, UBE2N, UBE2V2, RAD18, USP7, RPAP1, UBE2Z, EWSR1, CHFR, SHPRH, RNF146, ELAVL1, SPRTN, SP1, SP3, NOTCH1, DTL, BRCA1, CDK9, HSPA8, SULT1C2, WBP4, RPA3, RPA2, RPA1, UBC, UBE2A, HLTF, DLD, RNF166, APLF, HIST1H2BA, S100A10, FBXW11, NTRK1, PDK3, SMC1A, EMC2, AP4S1, SYNPO, CERK, TCEAL4, SNW1, CDC5L, NANOG, POU5F1, NFATC1, NFATC2, PMPCA, CHD1L, FEN1, VPRBPWWTR1TEAD4, TEAD3, SLC9A3R2, YWHAE, YWHAZ, YWHAG, KLF5, PPP1CA, TP53BP2, BTRC, YWHAQ, LATS1, NOTCH1, MED28, DVL1, DVL2, DVL3, HIF1A, AMOTL1, AMOT, TEAD1, FBXW11, TEAD2, LATS2, WBP2, TRIM25


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneHLTFchr3:148777505chr3:149260324ENST00000310053-1325925_10094581010SP1 and SP3
HgeneHLTFchr3:148777505chr3:149260324ENST00000392912-1326925_10094581161SP1 and SP3
HgeneHLTFchr3:148777505chr3:149260324ENST00000465259-1325925_10094571009SP1 and SP3
HgeneHLTFchr3:148777505chr3:149260324ENST00000494055-1326925_10094581040SP1 and SP3


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for HLTF_WWTR1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for HLTF_WWTR1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneHLTFC0022665Kidney Neoplasm1CTD_human
TgeneWWTR1C0026846Muscular Atrophy1CTD_human