FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 16203

FusionGeneSummary for HIPK2_GRM8

check button Fusion gene summary
Fusion gene informationFusion gene name: HIPK2_GRM8
Fusion gene ID: 16203
HgeneTgene
Gene symbol

HIPK2

GRM8

Gene ID

28996

2918

Gene namehomeodomain interacting protein kinase 2glutamate metabotropic receptor 8
SynonymsPRO0593GLUR8|GPRC1H|MGLUR8|mGlu8
Cytomap

7q34

7q31.33

Type of geneprotein-codingprotein-coding
Descriptionhomeodomain-interacting protein kinase 2hHIPk2metabotropic glutamate receptor 8glutamate receptor, metabotropic 8
Modification date2018052220180523
UniProtAcc

Q9H2X6

O00222

Ensembl transtripts involved in fusion geneENST00000406875, ENST00000428878, 
ENST00000342645, 
ENST00000444921, 
ENST00000339582, ENST00000358373, 
ENST00000405249, ENST00000480995, 
Fusion gene scores* DoF score11 X 7 X 9=6937 X 7 X 6=294
# samples 128
** MAII scorelog2(12/693*10)=-2.5298209465287
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(8/294*10)=-1.877744249949
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: HIPK2 [Title/Abstract] AND GRM8 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneHIPK2

GO:0006468

protein phosphorylation

19448668

HgeneHIPK2

GO:0006978

DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator

14647468

HgeneHIPK2

GO:0045766

positive regulation of angiogenesis

19046997

HgeneHIPK2

GO:0060395

SMAD protein signal transduction

12874272

TgeneGRM8

GO:0007193

adenylate cyclase-inhibiting G-protein coupled receptor signaling pathway

11166323


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLUSCTCGA-39-5011-01AHIPK2chr7

139285163

-GRM8chr7

126249552

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shitENST00000406875ENST00000444921HIPK2chr7

139285163

-GRM8chr7

126249552

-
Frame-shitENST00000406875ENST00000339582HIPK2chr7

139285163

-GRM8chr7

126249552

-
Frame-shitENST00000406875ENST00000358373HIPK2chr7

139285163

-GRM8chr7

126249552

-
In-frameENST00000406875ENST00000405249HIPK2chr7

139285163

-GRM8chr7

126249552

-
5CDS-5UTRENST00000406875ENST00000480995HIPK2chr7

139285163

-GRM8chr7

126249552

-
Frame-shitENST00000428878ENST00000444921HIPK2chr7

139285163

-GRM8chr7

126249552

-
Frame-shitENST00000428878ENST00000339582HIPK2chr7

139285163

-GRM8chr7

126249552

-
Frame-shitENST00000428878ENST00000358373HIPK2chr7

139285163

-GRM8chr7

126249552

-
In-frameENST00000428878ENST00000405249HIPK2chr7

139285163

-GRM8chr7

126249552

-
5CDS-5UTRENST00000428878ENST00000480995HIPK2chr7

139285163

-GRM8chr7

126249552

-
Frame-shitENST00000342645ENST00000444921HIPK2chr7

139285163

-GRM8chr7

126249552

-
Frame-shitENST00000342645ENST00000339582HIPK2chr7

139285163

-GRM8chr7

126249552

-
Frame-shitENST00000342645ENST00000358373HIPK2chr7

139285163

-GRM8chr7

126249552

-
Frame-shitENST00000342645ENST00000405249HIPK2chr7

139285163

-GRM8chr7

126249552

-
5CDS-5UTRENST00000342645ENST00000480995HIPK2chr7

139285163

-GRM8chr7

126249552

-

Top

FusionProtFeatures for HIPK2_GRM8


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
HIPK2

Q9H2X6

GRM8

O00222

Serine/threonine-protein kinase involved intranscription regulation, p53/TP53-mediated cellular apoptosis andregulation of the cell cycle. Acts as a corepressor of severaltranscription factors, including SMAD1 and POU4F1/Brn3a andprobably NK homeodomain transcription factors. PhosphorylatesPDX1, ATF1, PML, p53/TP53, CREB1, CTBP1, CBX4, RUNX1, EP300,CTNNB1, HMGA1 and ZBTB4. Inhibits cell growth and promotesapoptosis through the activation of p53/TP53 both at thetranscription level and at the protein level (by phosphorylationand indirect acetylation). The phosphorylation of p53/TP53 may bemediated by a p53/TP53-HIPK2-AXIN1 complex. Involved in theresponse to hypoxia by acting as a transcriptional co-suppressorof HIF1A. Mediates transcriptional activation of TP73. In responseto TGFB, cooperates with DAXX to activate JNK. Negative regulatorthrough phosphorylation and subsequent proteasomal degradation ofCTNNB1 and the antiapoptotic factor CTBP1. In the Wnt/beta-cateninsignaling pathway acts as an intermediate kinase betweenMAP3K7/TAK1 and NLK to promote the proteasomal degradation of MYB.Phosphorylates CBX4 upon DNA damage and promotes its E3 SUMO-protein ligase activity. Activates CREB1 and ATF1 transcriptionfactors by phosphorylation in response to genotoxic stress. Inresponse to DNA damage, stabilizes PML by phosphorylation. PML,HIPK2 and FBXO3 may act synergically to activate p53/TP53-dependent transactivation. Promotes angiogenesis, and is involvedin erythroid differentiation, especially during fetal livererythropoiesis. Phosphorylation of RUNX1 and EP300 stimulatesEP300 transcription regulation activity. Triggers ZBTB4 proteindegradation in response to DNA damage. Modulates HMGA1 DNA-bindingaffinity. In response to high glucose, triggers phosphorylation-mediated subnuclear localization shifting of PDX1. Involved in theregulation of eye size, lens formation and retinal laminationduring late embryogenesis. {ECO:0000269|PubMed:11740489,ECO:0000269|PubMed:11925430, ECO:0000269|PubMed:12851404,ECO:0000269|PubMed:12874272, ECO:0000269|PubMed:14678985,ECO:0000269|PubMed:17018294, ECO:0000269|PubMed:17960875,ECO:0000269|PubMed:18695000, ECO:0000269|PubMed:18809579,ECO:0000269|PubMed:19015637, ECO:0000269|PubMed:19046997,ECO:0000269|PubMed:19448668, ECO:0000269|PubMed:20307497,ECO:0000269|PubMed:20573984, ECO:0000269|PubMed:20637728,ECO:0000269|PubMed:20980392, ECO:0000269|PubMed:21192925,ECO:0000269|PubMed:22825850}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for HIPK2_GRM8


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_HIPK2_ENST00000406875_chr7_139285163_-_GRM8_ENST00000405249_chr7_126249552_-_837aa
MAPVYEGMASHVQVFSPHTLQSSAFCSVKKLKIEPSSNWDMTGYGSHSKVTSQSKNIPLSQPATTTVSTSLPVPNPSLPYEQTIVFPGST
GHIVVTSASSTSVTGQVLGGPHNLMRRSTVSLLDTYQKCGLKRKSEEIENTSSVQIIEEHPPMIQNNASGATVATATTSTATSKNSGSNS
EGDTQLVQHEVLCSMTNTYEVLEFLGRGTFGQVVKCWKRGTNEIVAIKILKNHPSTARQGQIEVSILARLSTESADDTNFVRAYECFQHK
NHTCLVFEMLEQNLTDFLKQNKFSPLPLKYIRPVLQQVATALMKLKSLGLIHADLKPENIMLVDPSRQPYRVKVIDFGSASHVSKAVCST
YLQSRTYRAPEIILGLPFCEAIDMWSLGCVIAELFLGWPLTPGASETDQIRTISQTQGLPAETLLSAGTKTTRFFNRDTDSPTPLWRLKT
PDDHEAETGIKSKEARKYIFNCLDDMAQVNMTTDLEGSDMLVEKADRREFIDLLKKMLTIDADKRITPIETLNHPFVTMTHLLDFPHSTH
VKSCFQNMEICKRRVNMTDTVNQSKTPFITHVAPSTSTNLTMTFNNQLTTVHNQAPSSTSATISLANPEVSILNYPSTLYQPSAASMAAV
AQRSMPLQTGTAQICARPDPFQQALIVCPPGFQGLQASPSKHAGYSVRMENAVPIVTQAPGAQPLQIQPGLLAQQAWPSGTQQILLPPAW
QQLTGVATHTSVQHATVIPETMAGTQQLADWRNTHAHGSHTNPIMQQPALLTGHVTLPAAQPLNVGVAHVMRQQPTSTTSSRKSKQHQSS

>In-frame_HIPK2_ENST00000428878_chr7_139285163_-_GRM8_ENST00000405249_chr7_126249552_-_810aa
MAPVYEGMASHVQVFSPHTLQSSAFCSVKKLKIEPSSNWDMTGYGSHSKVTSQSKNIPLSQPATTTVSTSLPVPNPSLPYEQTIVFPGST
GHIVVTSASSTSVTGQVLGGPHNLMRRSTVSLLDTYQKCGLKRKSEEIENTSSVQIIEEHPPMIQNNASGATVATATTSTATSKNSGSNS
EGDTQLVQHEVLCSMTNTYEVLEFLGRGTFGQVVKCWKRGTNEIVAIKILKNHPSTARQGQIEVSILARLSTESADDTNFVRAYECFQHK
NHTCLVFEMLEQNLTDFLKQNKFSPLPLKYIRPVLQQVATALMKLKSLGLIHADLKPENIMLVDPSRQPYRVKVIDFGSASHVSKAVCST
YLQSRTYRAPEIILGLPFCEAIDMWSLGCVIAELFLGWPLTPGASETDQIRTISQTQGLPAETLLSAGTKTTRFFNRDTDSPTPLWRLKT
PDDHEAETGIKSKEARKYIFNCLDDMAQVNMTTDLEGSDMLVEKADRREFIDLLKKMLTIDADKRITPIETLNHPFVTMTHLLDFPHSTH
VKSCFQNMEICKRRVNMTDTVNQSKTPFITHVAPSTSTNLTMTFNNQLTTVHNQPSAASMAAVAQRSMPLQTGTAQICARPDPFQQALIV
CPPGFQGLQASPSKHAGYSVRMENAVPIVTQAPGAQPLQIQPGLLAQQAWPSGTQQILLPPAWQQLTGVATHTSVQHATVIPETMAGTQQ
LADWRNTHAHGSHTNPIMQQPALLTGHVTLPAAQPLNVGVAHVMRQQPTSTTSSRKSKQHQSSVRQCWHSCHF__KRRCSWTL_TLPVSN


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_HIPK2_ENST00000406875_chr7_139285163_-_GRM8_ENST00000405249_chr7_126249552_-_2513nt
ATGGCCCCCGTGTACGAAGGTATGGCCTCACATGTGCAAGTTTTCTCCCCTCACACCCTTCAATCAAGTGCCTTCTGTAGTGTGAAGAAA
CTGAAAATAGAGCCGAGTTCCAACTGGGACATGACTGGGTACGGCTCCCACAGCAAAGTGTATAGCCAGAGCAAGAACATCCCCCTGTCG
CAGCCAGCCACCACAACCGTCAGCACCTCCTTGCCGGTCCCAAACCCAAGCCTACCTTACGAGCAGACCATCGTCTTCCCAGGAAGCACC
GGGCACATCGTGGTCACCTCAGCAAGCAGCACTTCTGTCACCGGGCAAGTCCTCGGCGGACCACACAACCTAATGCGTCGAAGCACTGTG
AGCCTCCTTGATACCTACCAAAAATGTGGACTCAAGCGTAAGAGCGAGGAGATCGAGAACACAAGCAGCGTGCAGATCATCGAGGAGCAT
CCACCCATGATTCAGAATAATGCAAGCGGGGCCACTGTCGCCACTGCCACCACGTCTACTGCCACCTCCAAAAACAGCGGCTCCAACAGC
GAGGGCGACTATCAGCTGGTGCAGCATGAGGTGCTGTGCTCCATGACCAACACCTACGAGGTCTTAGAGTTCTTGGGCCGAGGGACGTTT
GGGCAAGTGGTCAAGTGCTGGAAACGGGGCACCAATGAGATCGTAGCCATCAAGATCCTGAAGAACCACCCATCCTATGCCCGACAAGGT
CAGATTGAAGTGAGCATCCTGGCCCGGTTGAGCACGGAGAGTGCCGATGACTATAACTTCGTCCGGGCCTACGAATGCTTCCAGCACAAG
AACCACACGTGCTTGGTCTTCGAGATGTTGGAGCAGAACCTCTATGACTTTCTGAAGCAAAACAAGTTTAGCCCCTTGCCCCTCAAATAC
ATTCGCCCAGTTCTCCAGCAGGTAGCCACAGCCCTGATGAAACTCAAAAGCCTAGGTCTTATCCACGCTGACCTCAAACCAGAAAACATC
ATGCTGGTGGATCCATCTAGACAACCATACAGAGTCAAGGTCATCGACTTTGGTTCAGCCAGCCACGTCTCCAAGGCTGTGTGCTCCACC
TACTTGCAGTCCAGATATTACAGGGCCCCTGAGATCATCCTTGGTTTACCATTTTGTGAGGCAATTGACATGTGGTCCCTGGGCTGTGTT
ATTGCAGAATTGTTCCTGGGTTGGCCGTTATATCCAGGAGCTTCGGAGTATGATCAGATTCGGTATATTTCACAAACACAGGGTTTGCCT
GCTGAATATTTATTAAGCGCCGGGACAAAGACAACTAGGTTTTTCAACCGTGACACGGACTCACCATATCCTTTGTGGAGACTGAAGACA
CCAGATGACCATGAAGCAGAGACAGGGATTAAGTCAAAAGAAGCAAGAAAGTACATTTTCAACTGTTTAGATGATATGGCCCAGGTGAAC
ATGACGACAGATTTGGAAGGGAGCGACATGTTGGTAGAAAAGGCTGACCGGCGGGAGTTCATTGACCTGTTGAAGAAGATGCTGACCATT
GATGCTGACAAGAGAATCACTCCAATCGAAACCCTGAACCATCCCTTTGTCACCATGACACACTTACTCGATTTTCCCCACAGCACACAC
GTCAAATCATGTTTCCAGAACATGGAGATCTGCAAGCGTCGGGTGAATATGTATGACACGGTGAACCAGAGCAAAACCCCTTTCATCACG
CACGTGGCCCCCAGCACGTCCACCAACCTGACCATGACCTTTAACAACCAGCTGACCACTGTCCACAACCAGGCTCCCTCCTCTACCAGT
GCCACTATTTCCTTAGCCAATCCCGAAGTCTCCATACTAAACTACCCATCTACACTCTACCAGCCCTCAGCGGCATCCATGGCTGCAGTG
GCCCAGCGGAGCATGCCCCTGCAGACAGGAACAGCCCAGATTTGTGCCCGGCCTGACCCGTTCCAGCAAGCTCTCATCGTGTGTCCCCCC
GGCTTCCAAGGCTTGCAGGCCTCTCCCTCTAAGCACGCTGGCTACTCGGTGCGAATGGAAAATGCAGTTCCCATCGTCACTCAAGCCCCA
GGAGCTCAGCCTCTTCAGATCCAACCAGGTCTGCTTGCCCAGCAGGCTTGGCCAAGTGGGACCCAGCAGATCCTGCTTCCCCCAGCATGG
CAGCAACTGACTGGAGTGGCCACCCACACATCAGTGCAGCATGCCACCGTGATTCCCGAGACCATGGCAGGCACCCAGCAGCTGGCGGAC
TGGAGAAATACGCATGCTCACGGAAGCCATTATAATCCCATCATGCAGCAGCCTGCACTATTGACCGGTCATGTGACCCTTCCAGCAGCA
CAGCCCTTAAATGTGGGTGTGGCCCACGTGATGCGGCAGCAGCCAACCAGCACCACCTCCTCCCGGAAGAGTAAGCAGCACCAGTCATCT

>In-frame_HIPK2_ENST00000428878_chr7_139285163_-_GRM8_ENST00000405249_chr7_126249552_-_2432nt
ATGGCCCCCGTGTACGAAGGTATGGCCTCACATGTGCAAGTTTTCTCCCCTCACACCCTTCAATCAAGTGCCTTCTGTAGTGTGAAGAAA
CTGAAAATAGAGCCGAGTTCCAACTGGGACATGACTGGGTACGGCTCCCACAGCAAAGTGTATAGCCAGAGCAAGAACATCCCCCTGTCG
CAGCCAGCCACCACAACCGTCAGCACCTCCTTGCCGGTCCCAAACCCAAGCCTACCTTACGAGCAGACCATCGTCTTCCCAGGAAGCACC
GGGCACATCGTGGTCACCTCAGCAAGCAGCACTTCTGTCACCGGGCAAGTCCTCGGCGGACCACACAACCTAATGCGTCGAAGCACTGTG
AGCCTCCTTGATACCTACCAAAAATGTGGACTCAAGCGTAAGAGCGAGGAGATCGAGAACACAAGCAGCGTGCAGATCATCGAGGAGCAT
CCACCCATGATTCAGAATAATGCAAGCGGGGCCACTGTCGCCACTGCCACCACGTCTACTGCCACCTCCAAAAACAGCGGCTCCAACAGC
GAGGGCGACTATCAGCTGGTGCAGCATGAGGTGCTGTGCTCCATGACCAACACCTACGAGGTCTTAGAGTTCTTGGGCCGAGGGACGTTT
GGGCAAGTGGTCAAGTGCTGGAAACGGGGCACCAATGAGATCGTAGCCATCAAGATCCTGAAGAACCACCCATCCTATGCCCGACAAGGT
CAGATTGAAGTGAGCATCCTGGCCCGGTTGAGCACGGAGAGTGCCGATGACTATAACTTCGTCCGGGCCTACGAATGCTTCCAGCACAAG
AACCACACGTGCTTGGTCTTCGAGATGTTGGAGCAGAACCTCTATGACTTTCTGAAGCAAAACAAGTTTAGCCCCTTGCCCCTCAAATAC
ATTCGCCCAGTTCTCCAGCAGGTAGCCACAGCCCTGATGAAACTCAAAAGCCTAGGTCTTATCCACGCTGACCTCAAACCAGAAAACATC
ATGCTGGTGGATCCATCTAGACAACCATACAGAGTCAAGGTCATCGACTTTGGTTCAGCCAGCCACGTCTCCAAGGCTGTGTGCTCCACC
TACTTGCAGTCCAGATATTACAGGGCCCCTGAGATCATCCTTGGTTTACCATTTTGTGAGGCAATTGACATGTGGTCCCTGGGCTGTGTT
ATTGCAGAATTGTTCCTGGGTTGGCCGTTATATCCAGGAGCTTCGGAGTATGATCAGATTCGGTATATTTCACAAACACAGGGTTTGCCT
GCTGAATATTTATTAAGCGCCGGGACAAAGACAACTAGGTTTTTCAACCGTGACACGGACTCACCATATCCTTTGTGGAGACTGAAGACA
CCAGATGACCATGAAGCAGAGACAGGGATTAAGTCAAAAGAAGCAAGAAAGTACATTTTCAACTGTTTAGATGATATGGCCCAGGTGAAC
ATGACGACAGATTTGGAAGGGAGCGACATGTTGGTAGAAAAGGCTGACCGGCGGGAGTTCATTGACCTGTTGAAGAAGATGCTGACCATT
GATGCTGACAAGAGAATCACTCCAATCGAAACCCTGAACCATCCCTTTGTCACCATGACACACTTACTCGATTTTCCCCACAGCACACAC
GTCAAATCATGTTTCCAGAACATGGAGATCTGCAAGCGTCGGGTGAATATGTATGACACGGTGAACCAGAGCAAAACCCCTTTCATCACG
CACGTGGCCCCCAGCACGTCCACCAACCTGACCATGACCTTTAACAACCAGCTGACCACTGTCCACAACCAGCCCTCAGCGGCATCCATG
GCTGCAGTGGCCCAGCGGAGCATGCCCCTGCAGACAGGAACAGCCCAGATTTGTGCCCGGCCTGACCCGTTCCAGCAAGCTCTCATCGTG
TGTCCCCCCGGCTTCCAAGGCTTGCAGGCCTCTCCCTCTAAGCACGCTGGCTACTCGGTGCGAATGGAAAATGCAGTTCCCATCGTCACT
CAAGCCCCAGGAGCTCAGCCTCTTCAGATCCAACCAGGTCTGCTTGCCCAGCAGGCTTGGCCAAGTGGGACCCAGCAGATCCTGCTTCCC
CCAGCATGGCAGCAACTGACTGGAGTGGCCACCCACACATCAGTGCAGCATGCCACCGTGATTCCCGAGACCATGGCAGGCACCCAGCAG
CTGGCGGACTGGAGAAATACGCATGCTCACGGAAGCCATTATAATCCCATCATGCAGCAGCCTGCACTATTGACCGGTCATGTGACCCTT
CCAGCAGCACAGCCCTTAAATGTGGGTGTGGCCCACGTGATGCGGCAGCAGCCAACCAGCACCACCTCCTCCCGGAAGAGTAAGCAGCAC
CAGTCATCTGTGAGGCAGTGCTGGCACTCCTGTCACTTTTAATGAAAACGGAGATGCTCCTGGACGTTATGATATCTTCCAGTATCAAAT


* Fusion transcript sequences (Full-length transcript).
>In-frame_HIPK2_ENST00000406875_chr7_139285163_-_GRM8_ENST00000405249_chr7_126249552_-_2608nt
CTCAAGATGGCAGATTCCGACTGAGGCTGGGGGGGCCGAGCTCGCGCGCCGCTTTCCCGTCCCCGTTGCCATGAACCGCGGACACCCCGG
CCCCGATGGCCCCCGTGTACGAAGGTATGGCCTCACATGTGCAAGTTTTCTCCCCTCACACCCTTCAATCAAGTGCCTTCTGTAGTGTGA
AGAAACTGAAAATAGAGCCGAGTTCCAACTGGGACATGACTGGGTACGGCTCCCACAGCAAAGTGTATAGCCAGAGCAAGAACATCCCCC
TGTCGCAGCCAGCCACCACAACCGTCAGCACCTCCTTGCCGGTCCCAAACCCAAGCCTACCTTACGAGCAGACCATCGTCTTCCCAGGAA
GCACCGGGCACATCGTGGTCACCTCAGCAAGCAGCACTTCTGTCACCGGGCAAGTCCTCGGCGGACCACACAACCTAATGCGTCGAAGCA
CTGTGAGCCTCCTTGATACCTACCAAAAATGTGGACTCAAGCGTAAGAGCGAGGAGATCGAGAACACAAGCAGCGTGCAGATCATCGAGG
AGCATCCACCCATGATTCAGAATAATGCAAGCGGGGCCACTGTCGCCACTGCCACCACGTCTACTGCCACCTCCAAAAACAGCGGCTCCA
ACAGCGAGGGCGACTATCAGCTGGTGCAGCATGAGGTGCTGTGCTCCATGACCAACACCTACGAGGTCTTAGAGTTCTTGGGCCGAGGGA
CGTTTGGGCAAGTGGTCAAGTGCTGGAAACGGGGCACCAATGAGATCGTAGCCATCAAGATCCTGAAGAACCACCCATCCTATGCCCGAC
AAGGTCAGATTGAAGTGAGCATCCTGGCCCGGTTGAGCACGGAGAGTGCCGATGACTATAACTTCGTCCGGGCCTACGAATGCTTCCAGC
ACAAGAACCACACGTGCTTGGTCTTCGAGATGTTGGAGCAGAACCTCTATGACTTTCTGAAGCAAAACAAGTTTAGCCCCTTGCCCCTCA
AATACATTCGCCCAGTTCTCCAGCAGGTAGCCACAGCCCTGATGAAACTCAAAAGCCTAGGTCTTATCCACGCTGACCTCAAACCAGAAA
ACATCATGCTGGTGGATCCATCTAGACAACCATACAGAGTCAAGGTCATCGACTTTGGTTCAGCCAGCCACGTCTCCAAGGCTGTGTGCT
CCACCTACTTGCAGTCCAGATATTACAGGGCCCCTGAGATCATCCTTGGTTTACCATTTTGTGAGGCAATTGACATGTGGTCCCTGGGCT
GTGTTATTGCAGAATTGTTCCTGGGTTGGCCGTTATATCCAGGAGCTTCGGAGTATGATCAGATTCGGTATATTTCACAAACACAGGGTT
TGCCTGCTGAATATTTATTAAGCGCCGGGACAAAGACAACTAGGTTTTTCAACCGTGACACGGACTCACCATATCCTTTGTGGAGACTGA
AGACACCAGATGACCATGAAGCAGAGACAGGGATTAAGTCAAAAGAAGCAAGAAAGTACATTTTCAACTGTTTAGATGATATGGCCCAGG
TGAACATGACGACAGATTTGGAAGGGAGCGACATGTTGGTAGAAAAGGCTGACCGGCGGGAGTTCATTGACCTGTTGAAGAAGATGCTGA
CCATTGATGCTGACAAGAGAATCACTCCAATCGAAACCCTGAACCATCCCTTTGTCACCATGACACACTTACTCGATTTTCCCCACAGCA
CACACGTCAAATCATGTTTCCAGAACATGGAGATCTGCAAGCGTCGGGTGAATATGTATGACACGGTGAACCAGAGCAAAACCCCTTTCA
TCACGCACGTGGCCCCCAGCACGTCCACCAACCTGACCATGACCTTTAACAACCAGCTGACCACTGTCCACAACCAGGCTCCCTCCTCTA
CCAGTGCCACTATTTCCTTAGCCAATCCCGAAGTCTCCATACTAAACTACCCATCTACACTCTACCAGCCCTCAGCGGCATCCATGGCTG
CAGTGGCCCAGCGGAGCATGCCCCTGCAGACAGGAACAGCCCAGATTTGTGCCCGGCCTGACCCGTTCCAGCAAGCTCTCATCGTGTGTC
CCCCCGGCTTCCAAGGCTTGCAGGCCTCTCCCTCTAAGCACGCTGGCTACTCGGTGCGAATGGAAAATGCAGTTCCCATCGTCACTCAAG
CCCCAGGAGCTCAGCCTCTTCAGATCCAACCAGGTCTGCTTGCCCAGCAGGCTTGGCCAAGTGGGACCCAGCAGATCCTGCTTCCCCCAG
CATGGCAGCAACTGACTGGAGTGGCCACCCACACATCAGTGCAGCATGCCACCGTGATTCCCGAGACCATGGCAGGCACCCAGCAGCTGG
CGGACTGGAGAAATACGCATGCTCACGGAAGCCATTATAATCCCATCATGCAGCAGCCTGCACTATTGACCGGTCATGTGACCCTTCCAG
CAGCACAGCCCTTAAATGTGGGTGTGGCCCACGTGATGCGGCAGCAGCCAACCAGCACCACCTCCTCCCGGAAGAGTAAGCAGCACCAGT

>In-frame_HIPK2_ENST00000428878_chr7_139285163_-_GRM8_ENST00000405249_chr7_126249552_-_2587nt
CACGGGAGGCGGTGATGCGGGCGCGGGCGGCCTCGGCTGCGCCGAGAGCGGAGACACAGGCTCAAGATGGCAGATTCCGACTGAGGCTGG
GGGGGCCGAGCTCGCGCGCCGCTTTCCCGTCCCCGTTGCCATGAACCGCGGACACCCCGGCCCCGATGGCCCCCGTGTACGAAGGTATGG
CCTCACATGTGCAAGTTTTCTCCCCTCACACCCTTCAATCAAGTGCCTTCTGTAGTGTGAAGAAACTGAAAATAGAGCCGAGTTCCAACT
GGGACATGACTGGGTACGGCTCCCACAGCAAAGTGTATAGCCAGAGCAAGAACATCCCCCTGTCGCAGCCAGCCACCACAACCGTCAGCA
CCTCCTTGCCGGTCCCAAACCCAAGCCTACCTTACGAGCAGACCATCGTCTTCCCAGGAAGCACCGGGCACATCGTGGTCACCTCAGCAA
GCAGCACTTCTGTCACCGGGCAAGTCCTCGGCGGACCACACAACCTAATGCGTCGAAGCACTGTGAGCCTCCTTGATACCTACCAAAAAT
GTGGACTCAAGCGTAAGAGCGAGGAGATCGAGAACACAAGCAGCGTGCAGATCATCGAGGAGCATCCACCCATGATTCAGAATAATGCAA
GCGGGGCCACTGTCGCCACTGCCACCACGTCTACTGCCACCTCCAAAAACAGCGGCTCCAACAGCGAGGGCGACTATCAGCTGGTGCAGC
ATGAGGTGCTGTGCTCCATGACCAACACCTACGAGGTCTTAGAGTTCTTGGGCCGAGGGACGTTTGGGCAAGTGGTCAAGTGCTGGAAAC
GGGGCACCAATGAGATCGTAGCCATCAAGATCCTGAAGAACCACCCATCCTATGCCCGACAAGGTCAGATTGAAGTGAGCATCCTGGCCC
GGTTGAGCACGGAGAGTGCCGATGACTATAACTTCGTCCGGGCCTACGAATGCTTCCAGCACAAGAACCACACGTGCTTGGTCTTCGAGA
TGTTGGAGCAGAACCTCTATGACTTTCTGAAGCAAAACAAGTTTAGCCCCTTGCCCCTCAAATACATTCGCCCAGTTCTCCAGCAGGTAG
CCACAGCCCTGATGAAACTCAAAAGCCTAGGTCTTATCCACGCTGACCTCAAACCAGAAAACATCATGCTGGTGGATCCATCTAGACAAC
CATACAGAGTCAAGGTCATCGACTTTGGTTCAGCCAGCCACGTCTCCAAGGCTGTGTGCTCCACCTACTTGCAGTCCAGATATTACAGGG
CCCCTGAGATCATCCTTGGTTTACCATTTTGTGAGGCAATTGACATGTGGTCCCTGGGCTGTGTTATTGCAGAATTGTTCCTGGGTTGGC
CGTTATATCCAGGAGCTTCGGAGTATGATCAGATTCGGTATATTTCACAAACACAGGGTTTGCCTGCTGAATATTTATTAAGCGCCGGGA
CAAAGACAACTAGGTTTTTCAACCGTGACACGGACTCACCATATCCTTTGTGGAGACTGAAGACACCAGATGACCATGAAGCAGAGACAG
GGATTAAGTCAAAAGAAGCAAGAAAGTACATTTTCAACTGTTTAGATGATATGGCCCAGGTGAACATGACGACAGATTTGGAAGGGAGCG
ACATGTTGGTAGAAAAGGCTGACCGGCGGGAGTTCATTGACCTGTTGAAGAAGATGCTGACCATTGATGCTGACAAGAGAATCACTCCAA
TCGAAACCCTGAACCATCCCTTTGTCACCATGACACACTTACTCGATTTTCCCCACAGCACACACGTCAAATCATGTTTCCAGAACATGG
AGATCTGCAAGCGTCGGGTGAATATGTATGACACGGTGAACCAGAGCAAAACCCCTTTCATCACGCACGTGGCCCCCAGCACGTCCACCA
ACCTGACCATGACCTTTAACAACCAGCTGACCACTGTCCACAACCAGCCCTCAGCGGCATCCATGGCTGCAGTGGCCCAGCGGAGCATGC
CCCTGCAGACAGGAACAGCCCAGATTTGTGCCCGGCCTGACCCGTTCCAGCAAGCTCTCATCGTGTGTCCCCCCGGCTTCCAAGGCTTGC
AGGCCTCTCCCTCTAAGCACGCTGGCTACTCGGTGCGAATGGAAAATGCAGTTCCCATCGTCACTCAAGCCCCAGGAGCTCAGCCTCTTC
AGATCCAACCAGGTCTGCTTGCCCAGCAGGCTTGGCCAAGTGGGACCCAGCAGATCCTGCTTCCCCCAGCATGGCAGCAACTGACTGGAG
TGGCCACCCACACATCAGTGCAGCATGCCACCGTGATTCCCGAGACCATGGCAGGCACCCAGCAGCTGGCGGACTGGAGAAATACGCATG
CTCACGGAAGCCATTATAATCCCATCATGCAGCAGCCTGCACTATTGACCGGTCATGTGACCCTTCCAGCAGCACAGCCCTTAAATGTGG
GTGTGGCCCACGTGATGCGGCAGCAGCCAACCAGCACCACCTCCTCCCGGAAGAGTAAGCAGCACCAGTCATCTGTGAGGCAGTGCTGGC


Top

FusionGenePPI for HIPK2_GRM8


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
HIPK2DAXX, SP100, UBE2I, SUMO1, SKI, SMAD1, SMAD2, SMAD3, TP53INP1, TP53, CREBBP, RANBP9, NKX2-1, TRADD, TP73, TP63, FBXW7, BTRC, CUL1, MYB, RUNX1, EP300, HIPK2, NLK, MAP3K7, MYBL1, MYBL2, WSB1, SIAH1P1, SIAH1, SIAH2, CXCL1, AXIN1, HIST2H2BE, SENP2, SENP1, FBXO3, PML, CBX4, PAX6, CHMP4B, DCAF7, DYRK1A, DYRK1B, MAP3K1, MDM2, ZBTB4, MECP2, MBP, MKNK1, AATF, XAF1, SUMO2, SUMO3, RGMA, ABL1, PARP1, HSPA1A, STUB1, LZTS2, ACTBL2, TRIM25GRM8


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for HIPK2_GRM8


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
TgeneGRM8O00222DB00142Glutamic AcidMetabotropic glutamate receptor 8small moleculeapproved|nutraceutical

Top

RelatedDiseases for HIPK2_GRM8


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneGRM8C0036341Schizophrenia3PSYGENET
TgeneGRM8C0001957Alcohol Withdrawal Delirium1PSYGENET
TgeneGRM8C0001973Alcoholic Intoxication, Chronic1PSYGENET
TgeneGRM8C0003469Anxiety Disorders1CTD_human
TgeneGRM8C0004352Autistic Disorder1CTD_human
TgeneGRM8C0017639Gliosis1CTD_human
TgeneGRM8C0149925Small cell carcinoma of lung1CTD_human
TgeneGRM8C1263846Attention deficit hyperactivity disorder1CTD_human