FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 16162

FusionGeneSummary for HIBCH_CTNNA2

check button Fusion gene summary
Fusion gene informationFusion gene name: HIBCH_CTNNA2
Fusion gene ID: 16162
HgeneTgene
Gene symbol

HIBCH

CTNNA2

Gene ID

26275

1496

Gene name3-hydroxyisobutyryl-CoA hydrolasecatenin alpha 2
SynonymsHIBYLCOAHCAP-R|CAPR|CT114|CTNR
Cytomap

2q32.2

2p12

Type of geneprotein-codingprotein-coding
Description3-hydroxyisobutyryl-CoA hydrolase, mitochondrial3-hydroxyisobutyryl-Coenzyme A hydrolaseHIB-CoA hydrolaseHIBYL-CoA-Htesticular tissue protein Li 86catenin alpha-2alpha-N-cateninalpha-catenin-related proteincadherin-associated protein, relatedcancer/testis antigen 114catenin (cadherin-associated protein), alpha 2
Modification date2018052320180522
UniProtAcc

Q6NVY1

P26232

Ensembl transtripts involved in fusion geneENST00000392332, ENST00000359678, 
ENST00000410045, ENST00000486981, 
ENST00000466387, ENST00000496558, 
ENST00000361291, ENST00000402739, 
ENST00000540488, ENST00000541047, 
ENST00000343114, ENST00000496251, 
ENST00000409266, 
Fusion gene scores* DoF score5 X 4 X 4=8015 X 12 X 9=1620
# samples 515
** MAII scorelog2(5/80*10)=-0.678071905112638
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(15/1620*10)=-3.43295940727611
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: HIBCH [Title/Abstract] AND CTNNA2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBRCATCGA-A8-A09M-01AHIBCHchr2

191175480

-CTNNA2chr2

80620336

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000392332ENST00000466387HIBCHchr2

191175480

-CTNNA2chr2

80620336

+
In-frameENST00000392332ENST00000496558HIBCHchr2

191175480

-CTNNA2chr2

80620336

+
In-frameENST00000392332ENST00000361291HIBCHchr2

191175480

-CTNNA2chr2

80620336

+
In-frameENST00000392332ENST00000402739HIBCHchr2

191175480

-CTNNA2chr2

80620336

+
In-frameENST00000392332ENST00000540488HIBCHchr2

191175480

-CTNNA2chr2

80620336

+
In-frameENST00000392332ENST00000541047HIBCHchr2

191175480

-CTNNA2chr2

80620336

+
In-frameENST00000392332ENST00000343114HIBCHchr2

191175480

-CTNNA2chr2

80620336

+
5CDS-intronENST00000392332ENST00000496251HIBCHchr2

191175480

-CTNNA2chr2

80620336

+
5CDS-intronENST00000392332ENST00000409266HIBCHchr2

191175480

-CTNNA2chr2

80620336

+
In-frameENST00000359678ENST00000466387HIBCHchr2

191175480

-CTNNA2chr2

80620336

+
In-frameENST00000359678ENST00000496558HIBCHchr2

191175480

-CTNNA2chr2

80620336

+
In-frameENST00000359678ENST00000361291HIBCHchr2

191175480

-CTNNA2chr2

80620336

+
In-frameENST00000359678ENST00000402739HIBCHchr2

191175480

-CTNNA2chr2

80620336

+
In-frameENST00000359678ENST00000540488HIBCHchr2

191175480

-CTNNA2chr2

80620336

+
In-frameENST00000359678ENST00000541047HIBCHchr2

191175480

-CTNNA2chr2

80620336

+
In-frameENST00000359678ENST00000343114HIBCHchr2

191175480

-CTNNA2chr2

80620336

+
5CDS-intronENST00000359678ENST00000496251HIBCHchr2

191175480

-CTNNA2chr2

80620336

+
5CDS-intronENST00000359678ENST00000409266HIBCHchr2

191175480

-CTNNA2chr2

80620336

+
intron-3CDSENST00000410045ENST00000466387HIBCHchr2

191175480

-CTNNA2chr2

80620336

+
intron-3CDSENST00000410045ENST00000496558HIBCHchr2

191175480

-CTNNA2chr2

80620336

+
intron-3CDSENST00000410045ENST00000361291HIBCHchr2

191175480

-CTNNA2chr2

80620336

+
intron-3CDSENST00000410045ENST00000402739HIBCHchr2

191175480

-CTNNA2chr2

80620336

+
intron-3CDSENST00000410045ENST00000540488HIBCHchr2

191175480

-CTNNA2chr2

80620336

+
intron-3CDSENST00000410045ENST00000541047HIBCHchr2

191175480

-CTNNA2chr2

80620336

+
intron-3CDSENST00000410045ENST00000343114HIBCHchr2

191175480

-CTNNA2chr2

80620336

+
intron-intronENST00000410045ENST00000496251HIBCHchr2

191175480

-CTNNA2chr2

80620336

+
intron-intronENST00000410045ENST00000409266HIBCHchr2

191175480

-CTNNA2chr2

80620336

+
intron-3CDSENST00000486981ENST00000466387HIBCHchr2

191175480

-CTNNA2chr2

80620336

+
intron-3CDSENST00000486981ENST00000496558HIBCHchr2

191175480

-CTNNA2chr2

80620336

+
intron-3CDSENST00000486981ENST00000361291HIBCHchr2

191175480

-CTNNA2chr2

80620336

+
intron-3CDSENST00000486981ENST00000402739HIBCHchr2

191175480

-CTNNA2chr2

80620336

+
intron-3CDSENST00000486981ENST00000540488HIBCHchr2

191175480

-CTNNA2chr2

80620336

+
intron-3CDSENST00000486981ENST00000541047HIBCHchr2

191175480

-CTNNA2chr2

80620336

+
intron-3CDSENST00000486981ENST00000343114HIBCHchr2

191175480

-CTNNA2chr2

80620336

+
intron-intronENST00000486981ENST00000496251HIBCHchr2

191175480

-CTNNA2chr2

80620336

+
intron-intronENST00000486981ENST00000409266HIBCHchr2

191175480

-CTNNA2chr2

80620336

+

Top

FusionProtFeatures for HIBCH_CTNNA2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
HIBCH

Q6NVY1

CTNNA2

P26232

Hydrolyzes 3-hydroxyisobutyryl-CoA (HIBYL-CoA), a salinecatabolite. Has high activity toward isobutyryl-CoA. Could be anisobutyryl-CoA dehydrogenase that functions in valine catabolism.Also hydrolyzes 3-hydroxypropanoyl-CoA.{ECO:0000269|PubMed:8824301}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for HIBCH_CTNNA2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_HIBCH_ENST00000392332_chr2_191175480_-_CTNNA2_ENST00000466387_chr2_80620336_+_580aa
MGQREMWRLMSRFNAFKRTNTILHHLTGRKEKGDPLNIAIDKMTKKTRDLRRQLRKAVMDHISDSFLETNVPLLVLIEAAKSGNEKEVKE
TAQVFREHANKLVEVANLACSISNNEEGVKLVRMAATQIDSLCPQVINAALTLAARPQSKVAQDNMDVFKDQWEKQVRVLTEAVDDITSV
DDFLSVSENHILEDVNKCVIALQEGDVDTLDRTAGAIRGRAARVIHIINAEMENTEAGVTTEKVLEATKLLSETVMPRFAEQVEVAIEAL
SANVPQPFEENEFIDASRLVTDGVRDIRKAVLMIRTPEELEDDSDFEQEDTDVRSRTSVQTEDDQLIAGQSARAIMAQLPQEEKAKIAEQ
VEIFHQEKSKLDAEVAKWDDSGNDIIVLAKQMCMIMMEMTDFTRGKGPLKNTSDVINAAKKIAEAGSRMDKLARAVADQCPDSACKQDLL
AYLQRIALTCHQLNICSKVKAEVQNLGGELIVSGLDSATSLIQAAKNLMNAVVLTVKASTVASTKYQKVTGTAAVNSPVVSWKMKAPEKK

>In-frame_HIBCH_ENST00000392332_chr2_191175480_-_CTNNA2_ENST00000496558_chr2_80620336_+_580aa
MGQREMWRLMSRFNAFKRTNTILHHLTGRKEKGDPLNIAIDKMTKKTRDLRRQLRKAVMDHISDSFLETNVPLLVLIEAAKSGNEKEVKE
TAQVFREHANKLVEVANLACSISNNEEGVKLVRMAATQIDSLCPQVINAALTLAARPQSKVAQDNMDVFKDQWEKQVRVLTEAVDDITSV
DDFLSVSENHILEDVNKCVIALQEGDVDTLDRTAGAIRGRAARVIHIINAEMENTEAGVTTEKVLEATKLLSETVMPRFAEQVEVAIEAL
SANVPQPFEENEFIDASRLVTDGVRDIRKAVLMIRTPEELEDDSDFEQEDTDVRSRTSVQTEDDQLIAGQSARAIMAQLPQEEKAKIAEQ
VEIFHQEKSKLDAEVAKWDDSGNDIIVLAKQMCMIMMEMTDFTRGKGPLKNTSDVINAAKKIAEAGSRMDKLARAVADQCPDSACKQDLL
AYLQRIALTCHQLNICSKVKAEVQNLGGELIVSGLDSATSLIQAAKNLMNAVVLTVKASTVASTKYQKVTGTAAVNSPVVSWKMKAPEKK

>In-frame_HIBCH_ENST00000392332_chr2_191175480_-_CTNNA2_ENST00000361291_chr2_80620336_+_580aa
MGQREMWRLMSRFNAFKRTNTILHHLTGRKEKGDPLNIAIDKMTKKTRDLRRQLRKAVMDHISDSFLETNVPLLVLIEAAKSGNEKEVKE
TAQVFREHANKLVEVANLACSISNNEEGVKLVRMAATQIDSLCPQVINAALTLAARPQSKVAQDNMDVFKDQWEKQVRVLTEAVDDITSV
DDFLSVSENHILEDVNKCVIALQEGDVDTLDRTAGAIRGRAARVIHIINAEMENTEAGVTTEKVLEATKLLSETVMPRFAEQVEVAIEAL
SANVPQPFEENEFIDASRLVTDGVRDIRKAVLMIRTPEELEDDSDFEQEDTDVRSRTSVQTEDDQLIAGQSARAIMAQLPQEEKAKIAEQ
VEIFHQEKSKLDAEVAKWDDSGNDIIVLAKQMCMIMMEMTDFTRGKGPLKNTSDVINAAKKIAEAGSRMDKLARAVADQCPDSACKQDLL
AYLQRIALTCHQLNICSKVKAEVQNLGGELIVSGLDSATSLIQAAKNLMNAVVLTVKASTVASTKYQKVTGTAAVNSPVVSWKMKAPEKK

>In-frame_HIBCH_ENST00000392332_chr2_191175480_-_CTNNA2_ENST00000402739_chr2_80620336_+_628aa
MGQREMWRLMSRFNAFKRTNTILHHLTGRKEKGDPLNIAIDKMTKKTRDLRRQLRKAVMDHISDSFLETNVPLLVLIEAAKSGNEKEVKE
TAQVFREHANKLVEVANLACSISNNEEGVKLVRMAATQIDSLCPQVINAALTLAARPQSKVAQDNMDVFKDQWEKQVRVLTEAVDDITSV
DDFLSVSENHILEDVNKCVIALQEGDVDTLDRTAGAIRGRAARVIHIINAEMENTEAGVTTEKVLEATKLLSETVMPRFAEQVEVAIEAL
SANVPQPFEENEFIDASRLVTDGVRDIRKAVLMIRTPEELEDDSDFEQEDTDVRSRTSVQTEDDQLIAGQSARAIMAQLPQEEKAKIAEQ
VEIFHQEKSKLDAEVAKWDDSGNDIIVLAKQMCMIMMEMTDFTRGKGPLKNTSDVINAAKKIAEAGSRMDKLARAVADQCPDSACKQDLL
AYLQRIALTCHQLNICSKVKAEVQNLGGELIVSGTGVQSTFTTFTEVDCDVIDGGRASQLSTHLPTCAEGAPIGSGSSDSSMLDSATSLI

>In-frame_HIBCH_ENST00000392332_chr2_191175480_-_CTNNA2_ENST00000540488_chr2_80620336_+_535aa
MGQREMWRLMSRFNAFKRTNTILHHLTGRKEKGDPLNIAIDKMTKKTRDLRRQLRKAVMDHISDSFLETNVPLLVLIEAAKSGNEKEVKE
TAQVFREHANKLVEVANLACSISNNEEGVKLVRMAATQIDSLCPQVINAALTLAARPQSKVAQDNMDVFKDQWEKQVRVLTEAVDDITSV
DDFLSVSENHILEDVNKCVIALQEGDVDTLDRTAGAIRGRAARVIHIINAEMENTEAGVTTEKVLEATKLLSETVMPRFAEQVEVAIEAL
SANVPQPFEENEFIDASRLVTDGVRDIRKAVLMIRTPEELEDDSDFEQEDTDVRSRTSVQTEDDQLIAGQSARAIMAQLPQEEKAKIAEQ
VEIFHQEKSKLDAEVAKWDDSGNDIIVLAKQMCMIMMEMTDFTRGKGPLKNTSDVINAAKKIAEAGSRMDKLARAVADQLDSATSLIQAA

>In-frame_HIBCH_ENST00000392332_chr2_191175480_-_CTNNA2_ENST00000541047_chr2_80620336_+_580aa
MGQREMWRLMSRFNAFKRTNTILHHLTGRKEKGDPLNIAIDKMTKKTRDLRRQLRKAVMDHISDSFLETNVPLLVLIEAAKSGNEKEVKE
TAQVFREHANKLVEVANLACSISNNEEGVKLVRMAATQIDSLCPQVINAALTLAARPQSKVAQDNMDVFKDQWEKQVRVLTEAVDDITSV
DDFLSVSENHILEDVNKCVIALQEGDVDTLDRTAGAIRGRAARVIHIINAEMENTEAGVTTEKVLEATKLLSETVMPRFAEQVEVAIEAL
SANVPQPFEENEFIDASRLVTDGVRDIRKAVLMIRTPEELEDDSDFEQEDTDVRSRTSVQTEDDQLIAGQSARAIMAQLPQEEKAKIAEQ
VEIFHQEKSKLDAEVAKWDDSGNDIIVLAKQMCMIMMEMTDFTRGKGPLKNTSDVINAAKKIAEAGSRMDKLARAVADQCPDSACKQDLL
AYLQRIALTCHQLNICSKVKAEVQNLGGELIVSGLDSATSLIQAAKNLMNAVVLTVKASTVASTKYQKVTGTAAVNSPVVSWKMKAPEKK

>In-frame_HIBCH_ENST00000392332_chr2_191175480_-_CTNNA2_ENST00000343114_chr2_80620336_+_580aa
MGQREMWRLMSRFNAFKRTNTILHHLTGRKEKGDPLNIAIDKMTKKTRDLRRQLRKAVMDHISDSFLETNVPLLVLIEAAKSGNEKEVKE
TAQVFREHANKLVEVANLACSISNNEEGVKLVRMAATQIDSLCPQVINAALTLAARPQSKVAQDNMDVFKDQWEKQVRVLTEAVDDITSV
DDFLSVSENHILEDVNKCVIALQEGDVDTLDRTAGAIRGRAARVIHIINAEMENTEAGVTTEKVLEATKLLSETVMPRFAEQVEVAIEAL
SANVPQPFEENEFIDASRLVTDGVRDIRKAVLMIRTPEELEDDSDFEQEDTDVRSRTSVQTEDDQLIAGQSARAIMAQLPQEEKAKIAEQ
VEIFHQEKSKLDAEVAKWDDSGNDIIVLAKQMCMIMMEMTDFTRGKGPLKNTSDVINAAKKIAEAGSRMDKLARAVADQCPDSACKQDLL
AYLQRIALTCHQLNICSKVKAEVQNLGGELIVSGLDSATSLIQAAKNLMNAVVLTVKASTVASTKYQKVTGTAAVNSPVVSWKMKAPEKK

>In-frame_HIBCH_ENST00000359678_chr2_191175480_-_CTNNA2_ENST00000466387_chr2_80620336_+_580aa
MGQREMWRLMSRFNAFKRTNTILHHLTGRKEKGDPLNIAIDKMTKKTRDLRRQLRKAVMDHISDSFLETNVPLLVLIEAAKSGNEKEVKE
TAQVFREHANKLVEVANLACSISNNEEGVKLVRMAATQIDSLCPQVINAALTLAARPQSKVAQDNMDVFKDQWEKQVRVLTEAVDDITSV
DDFLSVSENHILEDVNKCVIALQEGDVDTLDRTAGAIRGRAARVIHIINAEMENTEAGVTTEKVLEATKLLSETVMPRFAEQVEVAIEAL
SANVPQPFEENEFIDASRLVTDGVRDIRKAVLMIRTPEELEDDSDFEQEDTDVRSRTSVQTEDDQLIAGQSARAIMAQLPQEEKAKIAEQ
VEIFHQEKSKLDAEVAKWDDSGNDIIVLAKQMCMIMMEMTDFTRGKGPLKNTSDVINAAKKIAEAGSRMDKLARAVADQCPDSACKQDLL
AYLQRIALTCHQLNICSKVKAEVQNLGGELIVSGLDSATSLIQAAKNLMNAVVLTVKASTVASTKYQKVTGTAAVNSPVVSWKMKAPEKK

>In-frame_HIBCH_ENST00000359678_chr2_191175480_-_CTNNA2_ENST00000496558_chr2_80620336_+_580aa
MGQREMWRLMSRFNAFKRTNTILHHLTGRKEKGDPLNIAIDKMTKKTRDLRRQLRKAVMDHISDSFLETNVPLLVLIEAAKSGNEKEVKE
TAQVFREHANKLVEVANLACSISNNEEGVKLVRMAATQIDSLCPQVINAALTLAARPQSKVAQDNMDVFKDQWEKQVRVLTEAVDDITSV
DDFLSVSENHILEDVNKCVIALQEGDVDTLDRTAGAIRGRAARVIHIINAEMENTEAGVTTEKVLEATKLLSETVMPRFAEQVEVAIEAL
SANVPQPFEENEFIDASRLVTDGVRDIRKAVLMIRTPEELEDDSDFEQEDTDVRSRTSVQTEDDQLIAGQSARAIMAQLPQEEKAKIAEQ
VEIFHQEKSKLDAEVAKWDDSGNDIIVLAKQMCMIMMEMTDFTRGKGPLKNTSDVINAAKKIAEAGSRMDKLARAVADQCPDSACKQDLL
AYLQRIALTCHQLNICSKVKAEVQNLGGELIVSGLDSATSLIQAAKNLMNAVVLTVKASTVASTKYQKVTGTAAVNSPVVSWKMKAPEKK

>In-frame_HIBCH_ENST00000359678_chr2_191175480_-_CTNNA2_ENST00000361291_chr2_80620336_+_580aa
MGQREMWRLMSRFNAFKRTNTILHHLTGRKEKGDPLNIAIDKMTKKTRDLRRQLRKAVMDHISDSFLETNVPLLVLIEAAKSGNEKEVKE
TAQVFREHANKLVEVANLACSISNNEEGVKLVRMAATQIDSLCPQVINAALTLAARPQSKVAQDNMDVFKDQWEKQVRVLTEAVDDITSV
DDFLSVSENHILEDVNKCVIALQEGDVDTLDRTAGAIRGRAARVIHIINAEMENTEAGVTTEKVLEATKLLSETVMPRFAEQVEVAIEAL
SANVPQPFEENEFIDASRLVTDGVRDIRKAVLMIRTPEELEDDSDFEQEDTDVRSRTSVQTEDDQLIAGQSARAIMAQLPQEEKAKIAEQ
VEIFHQEKSKLDAEVAKWDDSGNDIIVLAKQMCMIMMEMTDFTRGKGPLKNTSDVINAAKKIAEAGSRMDKLARAVADQCPDSACKQDLL
AYLQRIALTCHQLNICSKVKAEVQNLGGELIVSGLDSATSLIQAAKNLMNAVVLTVKASTVASTKYQKVTGTAAVNSPVVSWKMKAPEKK

>In-frame_HIBCH_ENST00000359678_chr2_191175480_-_CTNNA2_ENST00000402739_chr2_80620336_+_628aa
MGQREMWRLMSRFNAFKRTNTILHHLTGRKEKGDPLNIAIDKMTKKTRDLRRQLRKAVMDHISDSFLETNVPLLVLIEAAKSGNEKEVKE
TAQVFREHANKLVEVANLACSISNNEEGVKLVRMAATQIDSLCPQVINAALTLAARPQSKVAQDNMDVFKDQWEKQVRVLTEAVDDITSV
DDFLSVSENHILEDVNKCVIALQEGDVDTLDRTAGAIRGRAARVIHIINAEMENTEAGVTTEKVLEATKLLSETVMPRFAEQVEVAIEAL
SANVPQPFEENEFIDASRLVTDGVRDIRKAVLMIRTPEELEDDSDFEQEDTDVRSRTSVQTEDDQLIAGQSARAIMAQLPQEEKAKIAEQ
VEIFHQEKSKLDAEVAKWDDSGNDIIVLAKQMCMIMMEMTDFTRGKGPLKNTSDVINAAKKIAEAGSRMDKLARAVADQCPDSACKQDLL
AYLQRIALTCHQLNICSKVKAEVQNLGGELIVSGTGVQSTFTTFTEVDCDVIDGGRASQLSTHLPTCAEGAPIGSGSSDSSMLDSATSLI

>In-frame_HIBCH_ENST00000359678_chr2_191175480_-_CTNNA2_ENST00000540488_chr2_80620336_+_535aa
MGQREMWRLMSRFNAFKRTNTILHHLTGRKEKGDPLNIAIDKMTKKTRDLRRQLRKAVMDHISDSFLETNVPLLVLIEAAKSGNEKEVKE
TAQVFREHANKLVEVANLACSISNNEEGVKLVRMAATQIDSLCPQVINAALTLAARPQSKVAQDNMDVFKDQWEKQVRVLTEAVDDITSV
DDFLSVSENHILEDVNKCVIALQEGDVDTLDRTAGAIRGRAARVIHIINAEMENTEAGVTTEKVLEATKLLSETVMPRFAEQVEVAIEAL
SANVPQPFEENEFIDASRLVTDGVRDIRKAVLMIRTPEELEDDSDFEQEDTDVRSRTSVQTEDDQLIAGQSARAIMAQLPQEEKAKIAEQ
VEIFHQEKSKLDAEVAKWDDSGNDIIVLAKQMCMIMMEMTDFTRGKGPLKNTSDVINAAKKIAEAGSRMDKLARAVADQLDSATSLIQAA

>In-frame_HIBCH_ENST00000359678_chr2_191175480_-_CTNNA2_ENST00000541047_chr2_80620336_+_580aa
MGQREMWRLMSRFNAFKRTNTILHHLTGRKEKGDPLNIAIDKMTKKTRDLRRQLRKAVMDHISDSFLETNVPLLVLIEAAKSGNEKEVKE
TAQVFREHANKLVEVANLACSISNNEEGVKLVRMAATQIDSLCPQVINAALTLAARPQSKVAQDNMDVFKDQWEKQVRVLTEAVDDITSV
DDFLSVSENHILEDVNKCVIALQEGDVDTLDRTAGAIRGRAARVIHIINAEMENTEAGVTTEKVLEATKLLSETVMPRFAEQVEVAIEAL
SANVPQPFEENEFIDASRLVTDGVRDIRKAVLMIRTPEELEDDSDFEQEDTDVRSRTSVQTEDDQLIAGQSARAIMAQLPQEEKAKIAEQ
VEIFHQEKSKLDAEVAKWDDSGNDIIVLAKQMCMIMMEMTDFTRGKGPLKNTSDVINAAKKIAEAGSRMDKLARAVADQCPDSACKQDLL
AYLQRIALTCHQLNICSKVKAEVQNLGGELIVSGLDSATSLIQAAKNLMNAVVLTVKASTVASTKYQKVTGTAAVNSPVVSWKMKAPEKK

>In-frame_HIBCH_ENST00000359678_chr2_191175480_-_CTNNA2_ENST00000343114_chr2_80620336_+_580aa
MGQREMWRLMSRFNAFKRTNTILHHLTGRKEKGDPLNIAIDKMTKKTRDLRRQLRKAVMDHISDSFLETNVPLLVLIEAAKSGNEKEVKE
TAQVFREHANKLVEVANLACSISNNEEGVKLVRMAATQIDSLCPQVINAALTLAARPQSKVAQDNMDVFKDQWEKQVRVLTEAVDDITSV
DDFLSVSENHILEDVNKCVIALQEGDVDTLDRTAGAIRGRAARVIHIINAEMENTEAGVTTEKVLEATKLLSETVMPRFAEQVEVAIEAL
SANVPQPFEENEFIDASRLVTDGVRDIRKAVLMIRTPEELEDDSDFEQEDTDVRSRTSVQTEDDQLIAGQSARAIMAQLPQEEKAKIAEQ
VEIFHQEKSKLDAEVAKWDDSGNDIIVLAKQMCMIMMEMTDFTRGKGPLKNTSDVINAAKKIAEAGSRMDKLARAVADQCPDSACKQDLL
AYLQRIALTCHQLNICSKVKAEVQNLGGELIVSGLDSATSLIQAAKNLMNAVVLTVKASTVASTKYQKVTGTAAVNSPVVSWKMKAPEKK


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_HIBCH_ENST00000392332_chr2_191175480_-_CTNNA2_ENST00000466387_chr2_80620336_+_1740nt
ATGGGGCAGCGCGAGATGTGGAGGCTCATGTCGAGGTTTAATGCATTCAAAAGGACTAATACCATACTGCACCATTTGACTGGAAGGAAA
GAAAAAGGAGATCCTCTCAACATTGCGATTGATAAGATGACTAAGAAAACAAGAGATCTAAGGAGACAGCTTCGGAAAGCAGTGATGGAT
CACATATCTGACTCTTTCCTGGAAACCAATGTTCCTTTGCTAGTTCTCATTGAGGCTGCAAAGAGCGGAAATGAAAAGGAAGTGAAAGAA
TATGCCCAAGTTTTCCGTGAGCATGCCAACAAACTGGTAGAGGTTGCCAATTTGGCCTGTTCCATCTCCAACAATGAAGAAGGGGTGAAA
TTAGTTCGGATGGCAGCCACCCAGATTGACAGCCTGTGTCCCCAGGTCATCAATGCCGCTCTGACACTGGCTGCCCGGCCACAGAGCAAA
GTTGCTCAGGATAACATGGACGTCTTCAAAGACCAGTGGGAGAAGCAGGTCCGAGTGTTGACAGAGGCCGTGGATGACATCACCTCAGTG
GATGACTTCCTCTCTGTCTCAGAAAATCACATCTTGGAGGATGTGAACAAGTGTGTGATAGCCCTCCAAGAGGGCGATGTGGACACTCTG
GACCGGACTGCAGGGGCCATCAGGGGCCGGGCAGCTCGAGTCATACACATCATCAATGCTGAGATGGAGAACTATGAAGCTGGGGTTTAT
ACTGAGAAGGTGTTGGAAGCTACAAAATTGCTTTCTGAAACAGTGATGCCACGCTTCGCTGAACAAGTAGAGGTTGCCATTGAAGCCCTG
AGTGCCAACGTTCCTCAACCGTTTGAGGAGAATGAGTTCATCGATGCCTCTCGCCTGGTGTATGATGGCGTTCGGGACATCAGAAAGGCT
GTGCTGATGATCAGGACCCCAGAAGAACTAGAGGATGATTCTGACTTTGAGCAGGAAGATTATGATGTGCGTAGCAGGACAAGTGTTCAG
ACTGAGGATGACCAGCTCATTGCAGGGCAGAGCGCACGGGCCATCATGGCGCAACTACCGCAGGAGGAGAAGGCAAAAATAGCTGAGCAG
GTGGAGATATTCCATCAAGAGAAAAGCAAGCTGGATGCAGAAGTGGCCAAATGGGACGACAGCGGCAATGATATCATTGTACTGGCCAAG
CAGATGTGTATGATCATGATGGAAATGACAGACTTCACAAGAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATTAATGCTGCCAAG
AAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGCTCGTGCTGTGGCTGATCAGTGTCCTGATTCAGCATGTAAGCAGGATTTATTA
GCCTACCTTCAACGAATTGCCTTGTATTGCCATCAGCTTAATATCTGCAGCAAGGTGAAGGCAGAAGTGCAGAATCTGGGAGGAGAGCTC
ATTGTGTCAGGGCTGGACAGTGCCACATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTGAAAGCATCCTAT
GTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCCAGAGAAGAAG
CCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAAACACATTTCGCCTGTACAGGCTTTA

>In-frame_HIBCH_ENST00000392332_chr2_191175480_-_CTNNA2_ENST00000496558_chr2_80620336_+_1740nt
ATGGGGCAGCGCGAGATGTGGAGGCTCATGTCGAGGTTTAATGCATTCAAAAGGACTAATACCATACTGCACCATTTGACTGGAAGGAAA
GAAAAAGGAGATCCTCTCAACATTGCGATTGATAAGATGACTAAGAAAACAAGAGATCTAAGGAGACAGCTTCGGAAAGCAGTGATGGAT
CACATATCTGACTCTTTCCTGGAAACCAATGTTCCTTTGCTAGTTCTCATTGAGGCTGCAAAGAGCGGAAATGAAAAGGAAGTGAAAGAA
TATGCCCAAGTTTTCCGTGAGCATGCCAACAAACTGGTAGAGGTTGCCAATTTGGCCTGTTCCATCTCCAACAATGAAGAAGGGGTGAAA
TTAGTTCGGATGGCAGCCACCCAGATTGACAGCCTGTGTCCCCAGGTCATCAATGCCGCTCTGACACTGGCTGCCCGGCCACAGAGCAAA
GTTGCTCAGGATAACATGGACGTCTTCAAAGACCAGTGGGAGAAGCAGGTCCGAGTGTTGACAGAGGCCGTGGATGACATCACCTCAGTG
GATGACTTCCTCTCTGTCTCAGAAAATCACATCTTGGAGGATGTGAACAAGTGTGTGATAGCCCTCCAAGAGGGCGATGTGGACACTCTG
GACCGGACTGCAGGGGCCATCAGGGGCCGGGCAGCTCGAGTCATACACATCATCAATGCTGAGATGGAGAACTATGAAGCTGGGGTTTAT
ACTGAGAAGGTGTTGGAAGCTACAAAATTGCTTTCTGAAACAGTGATGCCACGCTTCGCTGAACAAGTAGAGGTTGCCATTGAAGCCCTG
AGTGCCAACGTTCCTCAACCGTTTGAGGAGAATGAGTTCATCGATGCCTCTCGCCTGGTGTATGATGGCGTTCGGGACATCAGAAAGGCT
GTGCTGATGATCAGGACCCCAGAAGAACTAGAGGATGATTCTGACTTTGAGCAGGAAGATTATGATGTGCGTAGCAGGACAAGTGTTCAG
ACTGAGGATGACCAGCTCATTGCAGGGCAGAGCGCACGGGCCATCATGGCGCAACTACCGCAGGAGGAGAAGGCAAAAATAGCTGAGCAG
GTGGAGATATTCCATCAAGAGAAAAGCAAGCTGGATGCAGAAGTGGCCAAATGGGACGACAGCGGCAATGATATCATTGTACTGGCCAAG
CAGATGTGTATGATCATGATGGAAATGACAGACTTCACAAGAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATTAATGCTGCCAAG
AAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGCTCGTGCTGTGGCTGATCAGTGTCCTGATTCAGCATGTAAGCAGGATTTATTA
GCCTACCTTCAACGAATTGCCTTGTATTGCCATCAGCTTAATATCTGCAGCAAGGTGAAGGCAGAAGTGCAGAATCTGGGAGGAGAGCTC
ATTGTGTCAGGGCTGGACAGTGCCACATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTGAAAGCATCCTAT
GTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCCAGAGAAGAAG
CCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAAACACATTTCGCCTGTACAGGCTTTA

>In-frame_HIBCH_ENST00000392332_chr2_191175480_-_CTNNA2_ENST00000361291_chr2_80620336_+_1740nt
ATGGGGCAGCGCGAGATGTGGAGGCTCATGTCGAGGTTTAATGCATTCAAAAGGACTAATACCATACTGCACCATTTGACTGGAAGGAAA
GAAAAAGGAGATCCTCTCAACATTGCGATTGATAAGATGACTAAGAAAACAAGAGATCTAAGGAGACAGCTTCGGAAAGCAGTGATGGAT
CACATATCTGACTCTTTCCTGGAAACCAATGTTCCTTTGCTAGTTCTCATTGAGGCTGCAAAGAGCGGAAATGAAAAGGAAGTGAAAGAA
TATGCCCAAGTTTTCCGTGAGCATGCCAACAAACTGGTAGAGGTTGCCAATTTGGCCTGTTCCATCTCCAACAATGAAGAAGGGGTGAAA
TTAGTTCGGATGGCAGCCACCCAGATTGACAGCCTGTGTCCCCAGGTCATCAATGCCGCTCTGACACTGGCTGCCCGGCCACAGAGCAAA
GTTGCTCAGGATAACATGGACGTCTTCAAAGACCAGTGGGAGAAGCAGGTCCGAGTGTTGACAGAGGCCGTGGATGACATCACCTCAGTG
GATGACTTCCTCTCTGTCTCAGAAAATCACATCTTGGAGGATGTGAACAAGTGTGTGATAGCCCTCCAAGAGGGCGATGTGGACACTCTG
GACCGGACTGCAGGGGCCATCAGGGGCCGGGCAGCTCGAGTCATACACATCATCAATGCTGAGATGGAGAACTATGAAGCTGGGGTTTAT
ACTGAGAAGGTGTTGGAAGCTACAAAATTGCTTTCTGAAACAGTGATGCCACGCTTCGCTGAACAAGTAGAGGTTGCCATTGAAGCCCTG
AGTGCCAACGTTCCTCAACCGTTTGAGGAGAATGAGTTCATCGATGCCTCTCGCCTGGTGTATGATGGCGTTCGGGACATCAGAAAGGCT
GTGCTGATGATCAGGACCCCAGAAGAACTAGAGGATGATTCTGACTTTGAGCAGGAAGATTATGATGTGCGTAGCAGGACAAGTGTTCAG
ACTGAGGATGACCAGCTCATTGCAGGGCAGAGCGCACGGGCCATCATGGCGCAACTACCGCAGGAGGAGAAGGCAAAAATAGCTGAGCAG
GTGGAGATATTCCATCAAGAGAAAAGCAAGCTGGATGCAGAAGTGGCCAAATGGGACGACAGCGGCAATGATATCATTGTACTGGCCAAG
CAGATGTGTATGATCATGATGGAAATGACAGACTTCACAAGAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATTAATGCTGCCAAG
AAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGCTCGTGCTGTGGCTGATCAGTGTCCTGATTCAGCATGTAAGCAGGATTTATTA
GCCTACCTTCAACGAATTGCCTTGTATTGCCATCAGCTTAATATCTGCAGCAAGGTGAAGGCAGAAGTGCAGAATCTGGGAGGAGAGCTC
ATTGTGTCAGGGCTGGACAGTGCCACATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTGAAAGCATCCTAT
GTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCCAGAGAAGAAG
CCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAAACACATTTCGCCTGTACAGGCTTTA

>In-frame_HIBCH_ENST00000392332_chr2_191175480_-_CTNNA2_ENST00000402739_chr2_80620336_+_1884nt
ATGGGGCAGCGCGAGATGTGGAGGCTCATGTCGAGGTTTAATGCATTCAAAAGGACTAATACCATACTGCACCATTTGACTGGAAGGAAA
GAAAAAGGAGATCCTCTCAACATTGCGATTGATAAGATGACTAAGAAAACAAGAGATCTAAGGAGACAGCTTCGGAAAGCAGTGATGGAT
CACATATCTGACTCTTTCCTGGAAACCAATGTTCCTTTGCTAGTTCTCATTGAGGCTGCAAAGAGCGGAAATGAAAAGGAAGTGAAAGAA
TATGCCCAAGTTTTCCGTGAGCATGCCAACAAACTGGTAGAGGTTGCCAATTTGGCCTGTTCCATCTCCAACAATGAAGAAGGGGTGAAA
TTAGTTCGGATGGCAGCCACCCAGATTGACAGCCTGTGTCCCCAGGTCATCAATGCCGCTCTGACACTGGCTGCCCGGCCACAGAGCAAA
GTTGCTCAGGATAACATGGACGTCTTCAAAGACCAGTGGGAGAAGCAGGTCCGAGTGTTGACAGAGGCCGTGGATGACATCACCTCAGTG
GATGACTTCCTCTCTGTCTCAGAAAATCACATCTTGGAGGATGTGAACAAGTGTGTGATAGCCCTCCAAGAGGGCGATGTGGACACTCTG
GACCGGACTGCAGGGGCCATCAGGGGCCGGGCAGCTCGAGTCATACACATCATCAATGCTGAGATGGAGAACTATGAAGCTGGGGTTTAT
ACTGAGAAGGTGTTGGAAGCTACAAAATTGCTTTCTGAAACAGTGATGCCACGCTTCGCTGAACAAGTAGAGGTTGCCATTGAAGCCCTG
AGTGCCAACGTTCCTCAACCGTTTGAGGAGAATGAGTTCATCGATGCCTCTCGCCTGGTGTATGATGGCGTTCGGGACATCAGAAAGGCT
GTGCTGATGATCAGGACCCCAGAAGAACTAGAGGATGATTCTGACTTTGAGCAGGAAGATTATGATGTGCGTAGCAGGACAAGTGTTCAG
ACTGAGGATGACCAGCTCATTGCAGGGCAGAGCGCACGGGCCATCATGGCGCAACTACCGCAGGAGGAGAAGGCAAAAATAGCTGAGCAG
GTGGAGATATTCCATCAAGAGAAAAGCAAGCTGGATGCAGAAGTGGCCAAATGGGACGACAGCGGCAATGATATCATTGTACTGGCCAAG
CAGATGTGTATGATCATGATGGAAATGACAGACTTCACAAGAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATTAATGCTGCCAAG
AAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGCTCGTGCTGTGGCTGATCAGTGTCCTGATTCAGCATGTAAGCAGGATTTATTA
GCCTACCTTCAACGAATTGCCTTGTATTGCCATCAGCTTAATATCTGCAGCAAGGTGAAGGCAGAAGTGCAGAATCTGGGAGGAGAGCTC
ATTGTGTCAGGGACAGGAGTTCAGAGCACTTTCACTACCTTTTATGAGGTAGATTGTGATGTCATAGATGGGGGCAGGGCTAGTCAACTT
TCTACCCACCTCCCAACCTGTGCTGAGGGAGCTCCGATCGGGAGTGGAAGCAGTGATTCCTCCATGCTGGACAGTGCCACATCGCTTATC
CAGGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTGAAAGCATCCTATGTGGCCTCAACCAAATACCAGAAGGTCTATGGGACA
GCAGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAG

>In-frame_HIBCH_ENST00000392332_chr2_191175480_-_CTNNA2_ENST00000540488_chr2_80620336_+_1605nt
ATGGGGCAGCGCGAGATGTGGAGGCTCATGTCGAGGTTTAATGCATTCAAAAGGACTAATACCATACTGCACCATTTGACTGGAAGGAAA
GAAAAAGGAGATCCTCTCAACATTGCGATTGATAAGATGACTAAGAAAACAAGAGATCTAAGGAGACAGCTTCGGAAAGCAGTGATGGAT
CACATATCTGACTCTTTCCTGGAAACCAATGTTCCTTTGCTAGTTCTCATTGAGGCTGCAAAGAGCGGAAATGAAAAGGAAGTGAAAGAA
TATGCCCAAGTTTTCCGTGAGCATGCCAACAAACTGGTAGAGGTTGCCAATTTGGCCTGTTCCATCTCCAACAATGAAGAAGGGGTGAAA
TTAGTTCGGATGGCAGCCACCCAGATTGACAGCCTGTGTCCCCAGGTCATCAATGCCGCTCTGACACTGGCTGCCCGGCCACAGAGCAAA
GTTGCTCAGGATAACATGGACGTCTTCAAAGACCAGTGGGAGAAGCAGGTCCGAGTGTTGACAGAGGCCGTGGATGACATCACCTCAGTG
GATGACTTCCTCTCTGTCTCAGAAAATCACATCTTGGAGGATGTGAACAAGTGTGTGATAGCCCTCCAAGAGGGCGATGTGGACACTCTG
GACCGGACTGCAGGGGCCATCAGGGGCCGGGCAGCTCGAGTCATACACATCATCAATGCTGAGATGGAGAACTATGAAGCTGGGGTTTAT
ACTGAGAAGGTGTTGGAAGCTACAAAATTGCTTTCTGAAACAGTGATGCCACGCTTCGCTGAACAAGTAGAGGTTGCCATTGAAGCCCTG
AGTGCCAACGTTCCTCAACCGTTTGAGGAGAATGAGTTCATCGATGCCTCTCGCCTGGTGTATGATGGCGTTCGGGACATCAGAAAGGCT
GTGCTGATGATCAGGACCCCAGAAGAACTAGAGGATGATTCTGACTTTGAGCAGGAAGATTATGATGTGCGTAGCAGGACAAGTGTTCAG
ACTGAGGATGACCAGCTCATTGCAGGGCAGAGCGCACGGGCCATCATGGCGCAACTACCGCAGGAGGAGAAGGCAAAAATAGCTGAGCAG
GTGGAGATATTCCATCAAGAGAAAAGCAAGCTGGATGCAGAAGTGGCCAAATGGGACGACAGCGGCAATGATATCATTGTACTGGCCAAG
CAGATGTGTATGATCATGATGGAAATGACAGACTTCACAAGAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATTAATGCTGCCAAG
AAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGCTCGTGCTGTGGCTGATCAGCTGGACAGTGCCACATCGCTTATCCAGGCAGCT
AAAAACCTGATGAATGCTGTTGTCCTCACGGTGAAAGCATCCTATGTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGCAGCTGTC
AACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGACACGAGTT

>In-frame_HIBCH_ENST00000392332_chr2_191175480_-_CTNNA2_ENST00000541047_chr2_80620336_+_1740nt
ATGGGGCAGCGCGAGATGTGGAGGCTCATGTCGAGGTTTAATGCATTCAAAAGGACTAATACCATACTGCACCATTTGACTGGAAGGAAA
GAAAAAGGAGATCCTCTCAACATTGCGATTGATAAGATGACTAAGAAAACAAGAGATCTAAGGAGACAGCTTCGGAAAGCAGTGATGGAT
CACATATCTGACTCTTTCCTGGAAACCAATGTTCCTTTGCTAGTTCTCATTGAGGCTGCAAAGAGCGGAAATGAAAAGGAAGTGAAAGAA
TATGCCCAAGTTTTCCGTGAGCATGCCAACAAACTGGTAGAGGTTGCCAATTTGGCCTGTTCCATCTCCAACAATGAAGAAGGGGTGAAA
TTAGTTCGGATGGCAGCCACCCAGATTGACAGCCTGTGTCCCCAGGTCATCAATGCCGCTCTGACACTGGCTGCCCGGCCACAGAGCAAA
GTTGCTCAGGATAACATGGACGTCTTCAAAGACCAGTGGGAGAAGCAGGTCCGAGTGTTGACAGAGGCCGTGGATGACATCACCTCAGTG
GATGACTTCCTCTCTGTCTCAGAAAATCACATCTTGGAGGATGTGAACAAGTGTGTGATAGCCCTCCAAGAGGGCGATGTGGACACTCTG
GACCGGACTGCAGGGGCCATCAGGGGCCGGGCAGCTCGAGTCATACACATCATCAATGCTGAGATGGAGAACTATGAAGCTGGGGTTTAT
ACTGAGAAGGTGTTGGAAGCTACAAAATTGCTTTCTGAAACAGTGATGCCACGCTTCGCTGAACAAGTAGAGGTTGCCATTGAAGCCCTG
AGTGCCAACGTTCCTCAACCGTTTGAGGAGAATGAGTTCATCGATGCCTCTCGCCTGGTGTATGATGGCGTTCGGGACATCAGAAAGGCT
GTGCTGATGATCAGGACCCCAGAAGAACTAGAGGATGATTCTGACTTTGAGCAGGAAGATTATGATGTGCGTAGCAGGACAAGTGTTCAG
ACTGAGGATGACCAGCTCATTGCAGGGCAGAGCGCACGGGCCATCATGGCGCAACTACCGCAGGAGGAGAAGGCAAAAATAGCTGAGCAG
GTGGAGATATTCCATCAAGAGAAAAGCAAGCTGGATGCAGAAGTGGCCAAATGGGACGACAGCGGCAATGATATCATTGTACTGGCCAAG
CAGATGTGTATGATCATGATGGAAATGACAGACTTCACAAGAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATTAATGCTGCCAAG
AAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGCTCGTGCTGTGGCTGATCAGTGTCCTGATTCAGCATGTAAGCAGGATTTATTA
GCCTACCTTCAACGAATTGCCTTGTATTGCCATCAGCTTAATATCTGCAGCAAGGTGAAGGCAGAAGTGCAGAATCTGGGAGGAGAGCTC
ATTGTGTCAGGGCTGGACAGTGCCACATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTGAAAGCATCCTAT
GTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCCAGAGAAGAAG
CCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAAACACATTTCGCCTGTACAGGCTTTA

>In-frame_HIBCH_ENST00000392332_chr2_191175480_-_CTNNA2_ENST00000343114_chr2_80620336_+_1740nt
ATGGGGCAGCGCGAGATGTGGAGGCTCATGTCGAGGTTTAATGCATTCAAAAGGACTAATACCATACTGCACCATTTGACTGGAAGGAAA
GAAAAAGGAGATCCTCTCAACATTGCGATTGATAAGATGACTAAGAAAACAAGAGATCTAAGGAGACAGCTTCGGAAAGCAGTGATGGAT
CACATATCTGACTCTTTCCTGGAAACCAATGTTCCTTTGCTAGTTCTCATTGAGGCTGCAAAGAGCGGAAATGAAAAGGAAGTGAAAGAA
TATGCCCAAGTTTTCCGTGAGCATGCCAACAAACTGGTAGAGGTTGCCAATTTGGCCTGTTCCATCTCCAACAATGAAGAAGGGGTGAAA
TTAGTTCGGATGGCAGCCACCCAGATTGACAGCCTGTGTCCCCAGGTCATCAATGCCGCTCTGACACTGGCTGCCCGGCCACAGAGCAAA
GTTGCTCAGGATAACATGGACGTCTTCAAAGACCAGTGGGAGAAGCAGGTCCGAGTGTTGACAGAGGCCGTGGATGACATCACCTCAGTG
GATGACTTCCTCTCTGTCTCAGAAAATCACATCTTGGAGGATGTGAACAAGTGTGTGATAGCCCTCCAAGAGGGCGATGTGGACACTCTG
GACCGGACTGCAGGGGCCATCAGGGGCCGGGCAGCTCGAGTCATACACATCATCAATGCTGAGATGGAGAACTATGAAGCTGGGGTTTAT
ACTGAGAAGGTGTTGGAAGCTACAAAATTGCTTTCTGAAACAGTGATGCCACGCTTCGCTGAACAAGTAGAGGTTGCCATTGAAGCCCTG
AGTGCCAACGTTCCTCAACCGTTTGAGGAGAATGAGTTCATCGATGCCTCTCGCCTGGTGTATGATGGCGTTCGGGACATCAGAAAGGCT
GTGCTGATGATCAGGACCCCAGAAGAACTAGAGGATGATTCTGACTTTGAGCAGGAAGATTATGATGTGCGTAGCAGGACAAGTGTTCAG
ACTGAGGATGACCAGCTCATTGCAGGGCAGAGCGCACGGGCCATCATGGCGCAACTACCGCAGGAGGAGAAGGCAAAAATAGCTGAGCAG
GTGGAGATATTCCATCAAGAGAAAAGCAAGCTGGATGCAGAAGTGGCCAAATGGGACGACAGCGGCAATGATATCATTGTACTGGCCAAG
CAGATGTGTATGATCATGATGGAAATGACAGACTTCACAAGAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATTAATGCTGCCAAG
AAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGCTCGTGCTGTGGCTGATCAGTGTCCTGATTCAGCATGTAAGCAGGATTTATTA
GCCTACCTTCAACGAATTGCCTTGTATTGCCATCAGCTTAATATCTGCAGCAAGGTGAAGGCAGAAGTGCAGAATCTGGGAGGAGAGCTC
ATTGTGTCAGGGCTGGACAGTGCCACATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTGAAAGCATCCTAT
GTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCCAGAGAAGAAG
CCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAAACACATTTCGCCTGTACAGGCTTTA

>In-frame_HIBCH_ENST00000359678_chr2_191175480_-_CTNNA2_ENST00000466387_chr2_80620336_+_1740nt
ATGGGGCAGCGCGAGATGTGGAGGCTCATGTCGAGGTTTAATGCATTCAAAAGGACTAATACCATACTGCACCATTTGACTGGAAGGAAA
GAAAAAGGAGATCCTCTCAACATTGCGATTGATAAGATGACTAAGAAAACAAGAGATCTAAGGAGACAGCTTCGGAAAGCAGTGATGGAT
CACATATCTGACTCTTTCCTGGAAACCAATGTTCCTTTGCTAGTTCTCATTGAGGCTGCAAAGAGCGGAAATGAAAAGGAAGTGAAAGAA
TATGCCCAAGTTTTCCGTGAGCATGCCAACAAACTGGTAGAGGTTGCCAATTTGGCCTGTTCCATCTCCAACAATGAAGAAGGGGTGAAA
TTAGTTCGGATGGCAGCCACCCAGATTGACAGCCTGTGTCCCCAGGTCATCAATGCCGCTCTGACACTGGCTGCCCGGCCACAGAGCAAA
GTTGCTCAGGATAACATGGACGTCTTCAAAGACCAGTGGGAGAAGCAGGTCCGAGTGTTGACAGAGGCCGTGGATGACATCACCTCAGTG
GATGACTTCCTCTCTGTCTCAGAAAATCACATCTTGGAGGATGTGAACAAGTGTGTGATAGCCCTCCAAGAGGGCGATGTGGACACTCTG
GACCGGACTGCAGGGGCCATCAGGGGCCGGGCAGCTCGAGTCATACACATCATCAATGCTGAGATGGAGAACTATGAAGCTGGGGTTTAT
ACTGAGAAGGTGTTGGAAGCTACAAAATTGCTTTCTGAAACAGTGATGCCACGCTTCGCTGAACAAGTAGAGGTTGCCATTGAAGCCCTG
AGTGCCAACGTTCCTCAACCGTTTGAGGAGAATGAGTTCATCGATGCCTCTCGCCTGGTGTATGATGGCGTTCGGGACATCAGAAAGGCT
GTGCTGATGATCAGGACCCCAGAAGAACTAGAGGATGATTCTGACTTTGAGCAGGAAGATTATGATGTGCGTAGCAGGACAAGTGTTCAG
ACTGAGGATGACCAGCTCATTGCAGGGCAGAGCGCACGGGCCATCATGGCGCAACTACCGCAGGAGGAGAAGGCAAAAATAGCTGAGCAG
GTGGAGATATTCCATCAAGAGAAAAGCAAGCTGGATGCAGAAGTGGCCAAATGGGACGACAGCGGCAATGATATCATTGTACTGGCCAAG
CAGATGTGTATGATCATGATGGAAATGACAGACTTCACAAGAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATTAATGCTGCCAAG
AAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGCTCGTGCTGTGGCTGATCAGTGTCCTGATTCAGCATGTAAGCAGGATTTATTA
GCCTACCTTCAACGAATTGCCTTGTATTGCCATCAGCTTAATATCTGCAGCAAGGTGAAGGCAGAAGTGCAGAATCTGGGAGGAGAGCTC
ATTGTGTCAGGGCTGGACAGTGCCACATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTGAAAGCATCCTAT
GTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCCAGAGAAGAAG
CCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAAACACATTTCGCCTGTACAGGCTTTA

>In-frame_HIBCH_ENST00000359678_chr2_191175480_-_CTNNA2_ENST00000496558_chr2_80620336_+_1740nt
ATGGGGCAGCGCGAGATGTGGAGGCTCATGTCGAGGTTTAATGCATTCAAAAGGACTAATACCATACTGCACCATTTGACTGGAAGGAAA
GAAAAAGGAGATCCTCTCAACATTGCGATTGATAAGATGACTAAGAAAACAAGAGATCTAAGGAGACAGCTTCGGAAAGCAGTGATGGAT
CACATATCTGACTCTTTCCTGGAAACCAATGTTCCTTTGCTAGTTCTCATTGAGGCTGCAAAGAGCGGAAATGAAAAGGAAGTGAAAGAA
TATGCCCAAGTTTTCCGTGAGCATGCCAACAAACTGGTAGAGGTTGCCAATTTGGCCTGTTCCATCTCCAACAATGAAGAAGGGGTGAAA
TTAGTTCGGATGGCAGCCACCCAGATTGACAGCCTGTGTCCCCAGGTCATCAATGCCGCTCTGACACTGGCTGCCCGGCCACAGAGCAAA
GTTGCTCAGGATAACATGGACGTCTTCAAAGACCAGTGGGAGAAGCAGGTCCGAGTGTTGACAGAGGCCGTGGATGACATCACCTCAGTG
GATGACTTCCTCTCTGTCTCAGAAAATCACATCTTGGAGGATGTGAACAAGTGTGTGATAGCCCTCCAAGAGGGCGATGTGGACACTCTG
GACCGGACTGCAGGGGCCATCAGGGGCCGGGCAGCTCGAGTCATACACATCATCAATGCTGAGATGGAGAACTATGAAGCTGGGGTTTAT
ACTGAGAAGGTGTTGGAAGCTACAAAATTGCTTTCTGAAACAGTGATGCCACGCTTCGCTGAACAAGTAGAGGTTGCCATTGAAGCCCTG
AGTGCCAACGTTCCTCAACCGTTTGAGGAGAATGAGTTCATCGATGCCTCTCGCCTGGTGTATGATGGCGTTCGGGACATCAGAAAGGCT
GTGCTGATGATCAGGACCCCAGAAGAACTAGAGGATGATTCTGACTTTGAGCAGGAAGATTATGATGTGCGTAGCAGGACAAGTGTTCAG
ACTGAGGATGACCAGCTCATTGCAGGGCAGAGCGCACGGGCCATCATGGCGCAACTACCGCAGGAGGAGAAGGCAAAAATAGCTGAGCAG
GTGGAGATATTCCATCAAGAGAAAAGCAAGCTGGATGCAGAAGTGGCCAAATGGGACGACAGCGGCAATGATATCATTGTACTGGCCAAG
CAGATGTGTATGATCATGATGGAAATGACAGACTTCACAAGAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATTAATGCTGCCAAG
AAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGCTCGTGCTGTGGCTGATCAGTGTCCTGATTCAGCATGTAAGCAGGATTTATTA
GCCTACCTTCAACGAATTGCCTTGTATTGCCATCAGCTTAATATCTGCAGCAAGGTGAAGGCAGAAGTGCAGAATCTGGGAGGAGAGCTC
ATTGTGTCAGGGCTGGACAGTGCCACATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTGAAAGCATCCTAT
GTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCCAGAGAAGAAG
CCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAAACACATTTCGCCTGTACAGGCTTTA

>In-frame_HIBCH_ENST00000359678_chr2_191175480_-_CTNNA2_ENST00000361291_chr2_80620336_+_1740nt
ATGGGGCAGCGCGAGATGTGGAGGCTCATGTCGAGGTTTAATGCATTCAAAAGGACTAATACCATACTGCACCATTTGACTGGAAGGAAA
GAAAAAGGAGATCCTCTCAACATTGCGATTGATAAGATGACTAAGAAAACAAGAGATCTAAGGAGACAGCTTCGGAAAGCAGTGATGGAT
CACATATCTGACTCTTTCCTGGAAACCAATGTTCCTTTGCTAGTTCTCATTGAGGCTGCAAAGAGCGGAAATGAAAAGGAAGTGAAAGAA
TATGCCCAAGTTTTCCGTGAGCATGCCAACAAACTGGTAGAGGTTGCCAATTTGGCCTGTTCCATCTCCAACAATGAAGAAGGGGTGAAA
TTAGTTCGGATGGCAGCCACCCAGATTGACAGCCTGTGTCCCCAGGTCATCAATGCCGCTCTGACACTGGCTGCCCGGCCACAGAGCAAA
GTTGCTCAGGATAACATGGACGTCTTCAAAGACCAGTGGGAGAAGCAGGTCCGAGTGTTGACAGAGGCCGTGGATGACATCACCTCAGTG
GATGACTTCCTCTCTGTCTCAGAAAATCACATCTTGGAGGATGTGAACAAGTGTGTGATAGCCCTCCAAGAGGGCGATGTGGACACTCTG
GACCGGACTGCAGGGGCCATCAGGGGCCGGGCAGCTCGAGTCATACACATCATCAATGCTGAGATGGAGAACTATGAAGCTGGGGTTTAT
ACTGAGAAGGTGTTGGAAGCTACAAAATTGCTTTCTGAAACAGTGATGCCACGCTTCGCTGAACAAGTAGAGGTTGCCATTGAAGCCCTG
AGTGCCAACGTTCCTCAACCGTTTGAGGAGAATGAGTTCATCGATGCCTCTCGCCTGGTGTATGATGGCGTTCGGGACATCAGAAAGGCT
GTGCTGATGATCAGGACCCCAGAAGAACTAGAGGATGATTCTGACTTTGAGCAGGAAGATTATGATGTGCGTAGCAGGACAAGTGTTCAG
ACTGAGGATGACCAGCTCATTGCAGGGCAGAGCGCACGGGCCATCATGGCGCAACTACCGCAGGAGGAGAAGGCAAAAATAGCTGAGCAG
GTGGAGATATTCCATCAAGAGAAAAGCAAGCTGGATGCAGAAGTGGCCAAATGGGACGACAGCGGCAATGATATCATTGTACTGGCCAAG
CAGATGTGTATGATCATGATGGAAATGACAGACTTCACAAGAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATTAATGCTGCCAAG
AAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGCTCGTGCTGTGGCTGATCAGTGTCCTGATTCAGCATGTAAGCAGGATTTATTA
GCCTACCTTCAACGAATTGCCTTGTATTGCCATCAGCTTAATATCTGCAGCAAGGTGAAGGCAGAAGTGCAGAATCTGGGAGGAGAGCTC
ATTGTGTCAGGGCTGGACAGTGCCACATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTGAAAGCATCCTAT
GTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCCAGAGAAGAAG
CCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAAACACATTTCGCCTGTACAGGCTTTA

>In-frame_HIBCH_ENST00000359678_chr2_191175480_-_CTNNA2_ENST00000402739_chr2_80620336_+_1884nt
ATGGGGCAGCGCGAGATGTGGAGGCTCATGTCGAGGTTTAATGCATTCAAAAGGACTAATACCATACTGCACCATTTGACTGGAAGGAAA
GAAAAAGGAGATCCTCTCAACATTGCGATTGATAAGATGACTAAGAAAACAAGAGATCTAAGGAGACAGCTTCGGAAAGCAGTGATGGAT
CACATATCTGACTCTTTCCTGGAAACCAATGTTCCTTTGCTAGTTCTCATTGAGGCTGCAAAGAGCGGAAATGAAAAGGAAGTGAAAGAA
TATGCCCAAGTTTTCCGTGAGCATGCCAACAAACTGGTAGAGGTTGCCAATTTGGCCTGTTCCATCTCCAACAATGAAGAAGGGGTGAAA
TTAGTTCGGATGGCAGCCACCCAGATTGACAGCCTGTGTCCCCAGGTCATCAATGCCGCTCTGACACTGGCTGCCCGGCCACAGAGCAAA
GTTGCTCAGGATAACATGGACGTCTTCAAAGACCAGTGGGAGAAGCAGGTCCGAGTGTTGACAGAGGCCGTGGATGACATCACCTCAGTG
GATGACTTCCTCTCTGTCTCAGAAAATCACATCTTGGAGGATGTGAACAAGTGTGTGATAGCCCTCCAAGAGGGCGATGTGGACACTCTG
GACCGGACTGCAGGGGCCATCAGGGGCCGGGCAGCTCGAGTCATACACATCATCAATGCTGAGATGGAGAACTATGAAGCTGGGGTTTAT
ACTGAGAAGGTGTTGGAAGCTACAAAATTGCTTTCTGAAACAGTGATGCCACGCTTCGCTGAACAAGTAGAGGTTGCCATTGAAGCCCTG
AGTGCCAACGTTCCTCAACCGTTTGAGGAGAATGAGTTCATCGATGCCTCTCGCCTGGTGTATGATGGCGTTCGGGACATCAGAAAGGCT
GTGCTGATGATCAGGACCCCAGAAGAACTAGAGGATGATTCTGACTTTGAGCAGGAAGATTATGATGTGCGTAGCAGGACAAGTGTTCAG
ACTGAGGATGACCAGCTCATTGCAGGGCAGAGCGCACGGGCCATCATGGCGCAACTACCGCAGGAGGAGAAGGCAAAAATAGCTGAGCAG
GTGGAGATATTCCATCAAGAGAAAAGCAAGCTGGATGCAGAAGTGGCCAAATGGGACGACAGCGGCAATGATATCATTGTACTGGCCAAG
CAGATGTGTATGATCATGATGGAAATGACAGACTTCACAAGAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATTAATGCTGCCAAG
AAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGCTCGTGCTGTGGCTGATCAGTGTCCTGATTCAGCATGTAAGCAGGATTTATTA
GCCTACCTTCAACGAATTGCCTTGTATTGCCATCAGCTTAATATCTGCAGCAAGGTGAAGGCAGAAGTGCAGAATCTGGGAGGAGAGCTC
ATTGTGTCAGGGACAGGAGTTCAGAGCACTTTCACTACCTTTTATGAGGTAGATTGTGATGTCATAGATGGGGGCAGGGCTAGTCAACTT
TCTACCCACCTCCCAACCTGTGCTGAGGGAGCTCCGATCGGGAGTGGAAGCAGTGATTCCTCCATGCTGGACAGTGCCACATCGCTTATC
CAGGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTGAAAGCATCCTATGTGGCCTCAACCAAATACCAGAAGGTCTATGGGACA
GCAGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAG

>In-frame_HIBCH_ENST00000359678_chr2_191175480_-_CTNNA2_ENST00000540488_chr2_80620336_+_1605nt
ATGGGGCAGCGCGAGATGTGGAGGCTCATGTCGAGGTTTAATGCATTCAAAAGGACTAATACCATACTGCACCATTTGACTGGAAGGAAA
GAAAAAGGAGATCCTCTCAACATTGCGATTGATAAGATGACTAAGAAAACAAGAGATCTAAGGAGACAGCTTCGGAAAGCAGTGATGGAT
CACATATCTGACTCTTTCCTGGAAACCAATGTTCCTTTGCTAGTTCTCATTGAGGCTGCAAAGAGCGGAAATGAAAAGGAAGTGAAAGAA
TATGCCCAAGTTTTCCGTGAGCATGCCAACAAACTGGTAGAGGTTGCCAATTTGGCCTGTTCCATCTCCAACAATGAAGAAGGGGTGAAA
TTAGTTCGGATGGCAGCCACCCAGATTGACAGCCTGTGTCCCCAGGTCATCAATGCCGCTCTGACACTGGCTGCCCGGCCACAGAGCAAA
GTTGCTCAGGATAACATGGACGTCTTCAAAGACCAGTGGGAGAAGCAGGTCCGAGTGTTGACAGAGGCCGTGGATGACATCACCTCAGTG
GATGACTTCCTCTCTGTCTCAGAAAATCACATCTTGGAGGATGTGAACAAGTGTGTGATAGCCCTCCAAGAGGGCGATGTGGACACTCTG
GACCGGACTGCAGGGGCCATCAGGGGCCGGGCAGCTCGAGTCATACACATCATCAATGCTGAGATGGAGAACTATGAAGCTGGGGTTTAT
ACTGAGAAGGTGTTGGAAGCTACAAAATTGCTTTCTGAAACAGTGATGCCACGCTTCGCTGAACAAGTAGAGGTTGCCATTGAAGCCCTG
AGTGCCAACGTTCCTCAACCGTTTGAGGAGAATGAGTTCATCGATGCCTCTCGCCTGGTGTATGATGGCGTTCGGGACATCAGAAAGGCT
GTGCTGATGATCAGGACCCCAGAAGAACTAGAGGATGATTCTGACTTTGAGCAGGAAGATTATGATGTGCGTAGCAGGACAAGTGTTCAG
ACTGAGGATGACCAGCTCATTGCAGGGCAGAGCGCACGGGCCATCATGGCGCAACTACCGCAGGAGGAGAAGGCAAAAATAGCTGAGCAG
GTGGAGATATTCCATCAAGAGAAAAGCAAGCTGGATGCAGAAGTGGCCAAATGGGACGACAGCGGCAATGATATCATTGTACTGGCCAAG
CAGATGTGTATGATCATGATGGAAATGACAGACTTCACAAGAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATTAATGCTGCCAAG
AAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGCTCGTGCTGTGGCTGATCAGCTGGACAGTGCCACATCGCTTATCCAGGCAGCT
AAAAACCTGATGAATGCTGTTGTCCTCACGGTGAAAGCATCCTATGTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGCAGCTGTC
AACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGACACGAGTT

>In-frame_HIBCH_ENST00000359678_chr2_191175480_-_CTNNA2_ENST00000541047_chr2_80620336_+_1740nt
ATGGGGCAGCGCGAGATGTGGAGGCTCATGTCGAGGTTTAATGCATTCAAAAGGACTAATACCATACTGCACCATTTGACTGGAAGGAAA
GAAAAAGGAGATCCTCTCAACATTGCGATTGATAAGATGACTAAGAAAACAAGAGATCTAAGGAGACAGCTTCGGAAAGCAGTGATGGAT
CACATATCTGACTCTTTCCTGGAAACCAATGTTCCTTTGCTAGTTCTCATTGAGGCTGCAAAGAGCGGAAATGAAAAGGAAGTGAAAGAA
TATGCCCAAGTTTTCCGTGAGCATGCCAACAAACTGGTAGAGGTTGCCAATTTGGCCTGTTCCATCTCCAACAATGAAGAAGGGGTGAAA
TTAGTTCGGATGGCAGCCACCCAGATTGACAGCCTGTGTCCCCAGGTCATCAATGCCGCTCTGACACTGGCTGCCCGGCCACAGAGCAAA
GTTGCTCAGGATAACATGGACGTCTTCAAAGACCAGTGGGAGAAGCAGGTCCGAGTGTTGACAGAGGCCGTGGATGACATCACCTCAGTG
GATGACTTCCTCTCTGTCTCAGAAAATCACATCTTGGAGGATGTGAACAAGTGTGTGATAGCCCTCCAAGAGGGCGATGTGGACACTCTG
GACCGGACTGCAGGGGCCATCAGGGGCCGGGCAGCTCGAGTCATACACATCATCAATGCTGAGATGGAGAACTATGAAGCTGGGGTTTAT
ACTGAGAAGGTGTTGGAAGCTACAAAATTGCTTTCTGAAACAGTGATGCCACGCTTCGCTGAACAAGTAGAGGTTGCCATTGAAGCCCTG
AGTGCCAACGTTCCTCAACCGTTTGAGGAGAATGAGTTCATCGATGCCTCTCGCCTGGTGTATGATGGCGTTCGGGACATCAGAAAGGCT
GTGCTGATGATCAGGACCCCAGAAGAACTAGAGGATGATTCTGACTTTGAGCAGGAAGATTATGATGTGCGTAGCAGGACAAGTGTTCAG
ACTGAGGATGACCAGCTCATTGCAGGGCAGAGCGCACGGGCCATCATGGCGCAACTACCGCAGGAGGAGAAGGCAAAAATAGCTGAGCAG
GTGGAGATATTCCATCAAGAGAAAAGCAAGCTGGATGCAGAAGTGGCCAAATGGGACGACAGCGGCAATGATATCATTGTACTGGCCAAG
CAGATGTGTATGATCATGATGGAAATGACAGACTTCACAAGAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATTAATGCTGCCAAG
AAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGCTCGTGCTGTGGCTGATCAGTGTCCTGATTCAGCATGTAAGCAGGATTTATTA
GCCTACCTTCAACGAATTGCCTTGTATTGCCATCAGCTTAATATCTGCAGCAAGGTGAAGGCAGAAGTGCAGAATCTGGGAGGAGAGCTC
ATTGTGTCAGGGCTGGACAGTGCCACATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTGAAAGCATCCTAT
GTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCCAGAGAAGAAG
CCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAAACACATTTCGCCTGTACAGGCTTTA

>In-frame_HIBCH_ENST00000359678_chr2_191175480_-_CTNNA2_ENST00000343114_chr2_80620336_+_1740nt
ATGGGGCAGCGCGAGATGTGGAGGCTCATGTCGAGGTTTAATGCATTCAAAAGGACTAATACCATACTGCACCATTTGACTGGAAGGAAA
GAAAAAGGAGATCCTCTCAACATTGCGATTGATAAGATGACTAAGAAAACAAGAGATCTAAGGAGACAGCTTCGGAAAGCAGTGATGGAT
CACATATCTGACTCTTTCCTGGAAACCAATGTTCCTTTGCTAGTTCTCATTGAGGCTGCAAAGAGCGGAAATGAAAAGGAAGTGAAAGAA
TATGCCCAAGTTTTCCGTGAGCATGCCAACAAACTGGTAGAGGTTGCCAATTTGGCCTGTTCCATCTCCAACAATGAAGAAGGGGTGAAA
TTAGTTCGGATGGCAGCCACCCAGATTGACAGCCTGTGTCCCCAGGTCATCAATGCCGCTCTGACACTGGCTGCCCGGCCACAGAGCAAA
GTTGCTCAGGATAACATGGACGTCTTCAAAGACCAGTGGGAGAAGCAGGTCCGAGTGTTGACAGAGGCCGTGGATGACATCACCTCAGTG
GATGACTTCCTCTCTGTCTCAGAAAATCACATCTTGGAGGATGTGAACAAGTGTGTGATAGCCCTCCAAGAGGGCGATGTGGACACTCTG
GACCGGACTGCAGGGGCCATCAGGGGCCGGGCAGCTCGAGTCATACACATCATCAATGCTGAGATGGAGAACTATGAAGCTGGGGTTTAT
ACTGAGAAGGTGTTGGAAGCTACAAAATTGCTTTCTGAAACAGTGATGCCACGCTTCGCTGAACAAGTAGAGGTTGCCATTGAAGCCCTG
AGTGCCAACGTTCCTCAACCGTTTGAGGAGAATGAGTTCATCGATGCCTCTCGCCTGGTGTATGATGGCGTTCGGGACATCAGAAAGGCT
GTGCTGATGATCAGGACCCCAGAAGAACTAGAGGATGATTCTGACTTTGAGCAGGAAGATTATGATGTGCGTAGCAGGACAAGTGTTCAG
ACTGAGGATGACCAGCTCATTGCAGGGCAGAGCGCACGGGCCATCATGGCGCAACTACCGCAGGAGGAGAAGGCAAAAATAGCTGAGCAG
GTGGAGATATTCCATCAAGAGAAAAGCAAGCTGGATGCAGAAGTGGCCAAATGGGACGACAGCGGCAATGATATCATTGTACTGGCCAAG
CAGATGTGTATGATCATGATGGAAATGACAGACTTCACAAGAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATTAATGCTGCCAAG
AAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGCTCGTGCTGTGGCTGATCAGTGTCCTGATTCAGCATGTAAGCAGGATTTATTA
GCCTACCTTCAACGAATTGCCTTGTATTGCCATCAGCTTAATATCTGCAGCAAGGTGAAGGCAGAAGTGCAGAATCTGGGAGGAGAGCTC
ATTGTGTCAGGGCTGGACAGTGCCACATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTGAAAGCATCCTAT
GTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCCAGAGAAGAAG
CCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAAACACATTTCGCCTGTACAGGCTTTA


* Fusion transcript sequences (Full-length transcript).
>In-frame_HIBCH_ENST00000392332_chr2_191175480_-_CTNNA2_ENST00000466387_chr2_80620336_+_2787nt
GGAAACGGTCGCTCTGGCTTCCTGGAGGACTTGTCATCTGTGCCCGGCGGCGCAGGACGGCGGTGGGCGGGGCTCACGCGAGGCGCTGGA
ACGGTCCGGGAGATTCTCGCTCTGCTGCTTTAGCTTCGGAGTGTTTGGCGATGGGGCAGCGCGAGATGTGGAGGCTCATGTCGAGGTTTA
ATGCATTCAAAAGGACTAATACCATACTGCACCATTTGACTGGAAGGAAAGAAAAAGGAGATCCTCTCAACATTGCGATTGATAAGATGA
CTAAGAAAACAAGAGATCTAAGGAGACAGCTTCGGAAAGCAGTGATGGATCACATATCTGACTCTTTCCTGGAAACCAATGTTCCTTTGC
TAGTTCTCATTGAGGCTGCAAAGAGCGGAAATGAAAAGGAAGTGAAAGAATATGCCCAAGTTTTCCGTGAGCATGCCAACAAACTGGTAG
AGGTTGCCAATTTGGCCTGTTCCATCTCCAACAATGAAGAAGGGGTGAAATTAGTTCGGATGGCAGCCACCCAGATTGACAGCCTGTGTC
CCCAGGTCATCAATGCCGCTCTGACACTGGCTGCCCGGCCACAGAGCAAAGTTGCTCAGGATAACATGGACGTCTTCAAAGACCAGTGGG
AGAAGCAGGTCCGAGTGTTGACAGAGGCCGTGGATGACATCACCTCAGTGGATGACTTCCTCTCTGTCTCAGAAAATCACATCTTGGAGG
ATGTGAACAAGTGTGTGATAGCCCTCCAAGAGGGCGATGTGGACACTCTGGACCGGACTGCAGGGGCCATCAGGGGCCGGGCAGCTCGAG
TCATACACATCATCAATGCTGAGATGGAGAACTATGAAGCTGGGGTTTATACTGAGAAGGTGTTGGAAGCTACAAAATTGCTTTCTGAAA
CAGTGATGCCACGCTTCGCTGAACAAGTAGAGGTTGCCATTGAAGCCCTGAGTGCCAACGTTCCTCAACCGTTTGAGGAGAATGAGTTCA
TCGATGCCTCTCGCCTGGTGTATGATGGCGTTCGGGACATCAGAAAGGCTGTGCTGATGATCAGGACCCCAGAAGAACTAGAGGATGATT
CTGACTTTGAGCAGGAAGATTATGATGTGCGTAGCAGGACAAGTGTTCAGACTGAGGATGACCAGCTCATTGCAGGGCAGAGCGCACGGG
CCATCATGGCGCAACTACCGCAGGAGGAGAAGGCAAAAATAGCTGAGCAGGTGGAGATATTCCATCAAGAGAAAAGCAAGCTGGATGCAG
AAGTGGCCAAATGGGACGACAGCGGCAATGATATCATTGTACTGGCCAAGCAGATGTGTATGATCATGATGGAAATGACAGACTTCACAA
GAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATTAATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGCTC
GTGCTGTGGCTGATCAGTGTCCTGATTCAGCATGTAAGCAGGATTTATTAGCCTACCTTCAACGAATTGCCTTGTATTGCCATCAGCTTA
ATATCTGCAGCAAGGTGAAGGCAGAAGTGCAGAATCTGGGAGGAGAGCTCATTGTGTCAGGGCTGGACAGTGCCACATCGCTTATCCAGG
CAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTGAAAGCATCCTATGTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGCAG
CTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGACAC
GAGTTCGACGAGGTTCTCAGAAGAAACACATTTCGCCTGTACAGGCTTTAAGTGAATTCAAAGCAATGGATTCCTTCTAGGACGATAGGT
TTTAACAAGAAAGCTTTTTCTTTCTTTTCTTTCTTTCTTTTTCTTTTTAATTCCATTTTTGTATGCATACCTGCCAGCTCGTATGCCTCT
GGCATGGGGAAATTAAGGGAACAGTGTCTGTTTGCATGTAAGATGAGATGAGATCAATACTACTGATCCATCTGTAGCCTGGGAAGGAGA
CAGGACATTCCTGTACTAAGGTGGCACAGAGCTGTCCTTTGCAACATTCTCATAAAATTGGGCACAGAGTTCGCATTGGCGCAATATTTA
TGGGAGTGGGAGGGATGGGGAAAATAAACTTAACTCTACAAAAGCAAACTCTAATGCATGCAAGAATCATTAGGTTGGCAGGTATATGCA
TAAGTGAAAAATCTGGAAGTGTAATGGTAGAACATAAAACTTGTATTGCTTCTGTTTCAGTGCAAAAATGTACTAGCCAATACGCTTAAG
TGTGTGGCCCATGAATTGAACAATTTAACCTTGAAGTCTATATCCGTGATATTATGTCGATTTTTAACTGAGGGGAAATTAACTAGTCCA
GCCTAAAATGCTTCTTTTAATCTGCATTCTGTTTCCTCTTCTAGTTGTGCCATTACTAGTGATCATGTTTTTTTCCCCCCTTTAATGAAA
ACAATAAACATCTATTTGAGACAATTAAAATCCTTCTGGGGGCACTGGAAGCACAATACGGTGACCAATCTTGCTTTCATTTTTTTTTCT
TTTTAATTTGAACCATGATTTTGCTAGAAATAGAAGGCCCAGTGGTGGAATATTAGAGGGAAGGAAACTGACAACGTGTGAAAGTTAGAG

>In-frame_HIBCH_ENST00000392332_chr2_191175480_-_CTNNA2_ENST00000496558_chr2_80620336_+_2788nt
GGAAACGGTCGCTCTGGCTTCCTGGAGGACTTGTCATCTGTGCCCGGCGGCGCAGGACGGCGGTGGGCGGGGCTCACGCGAGGCGCTGGA
ACGGTCCGGGAGATTCTCGCTCTGCTGCTTTAGCTTCGGAGTGTTTGGCGATGGGGCAGCGCGAGATGTGGAGGCTCATGTCGAGGTTTA
ATGCATTCAAAAGGACTAATACCATACTGCACCATTTGACTGGAAGGAAAGAAAAAGGAGATCCTCTCAACATTGCGATTGATAAGATGA
CTAAGAAAACAAGAGATCTAAGGAGACAGCTTCGGAAAGCAGTGATGGATCACATATCTGACTCTTTCCTGGAAACCAATGTTCCTTTGC
TAGTTCTCATTGAGGCTGCAAAGAGCGGAAATGAAAAGGAAGTGAAAGAATATGCCCAAGTTTTCCGTGAGCATGCCAACAAACTGGTAG
AGGTTGCCAATTTGGCCTGTTCCATCTCCAACAATGAAGAAGGGGTGAAATTAGTTCGGATGGCAGCCACCCAGATTGACAGCCTGTGTC
CCCAGGTCATCAATGCCGCTCTGACACTGGCTGCCCGGCCACAGAGCAAAGTTGCTCAGGATAACATGGACGTCTTCAAAGACCAGTGGG
AGAAGCAGGTCCGAGTGTTGACAGAGGCCGTGGATGACATCACCTCAGTGGATGACTTCCTCTCTGTCTCAGAAAATCACATCTTGGAGG
ATGTGAACAAGTGTGTGATAGCCCTCCAAGAGGGCGATGTGGACACTCTGGACCGGACTGCAGGGGCCATCAGGGGCCGGGCAGCTCGAG
TCATACACATCATCAATGCTGAGATGGAGAACTATGAAGCTGGGGTTTATACTGAGAAGGTGTTGGAAGCTACAAAATTGCTTTCTGAAA
CAGTGATGCCACGCTTCGCTGAACAAGTAGAGGTTGCCATTGAAGCCCTGAGTGCCAACGTTCCTCAACCGTTTGAGGAGAATGAGTTCA
TCGATGCCTCTCGCCTGGTGTATGATGGCGTTCGGGACATCAGAAAGGCTGTGCTGATGATCAGGACCCCAGAAGAACTAGAGGATGATT
CTGACTTTGAGCAGGAAGATTATGATGTGCGTAGCAGGACAAGTGTTCAGACTGAGGATGACCAGCTCATTGCAGGGCAGAGCGCACGGG
CCATCATGGCGCAACTACCGCAGGAGGAGAAGGCAAAAATAGCTGAGCAGGTGGAGATATTCCATCAAGAGAAAAGCAAGCTGGATGCAG
AAGTGGCCAAATGGGACGACAGCGGCAATGATATCATTGTACTGGCCAAGCAGATGTGTATGATCATGATGGAAATGACAGACTTCACAA
GAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATTAATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGCTC
GTGCTGTGGCTGATCAGTGTCCTGATTCAGCATGTAAGCAGGATTTATTAGCCTACCTTCAACGAATTGCCTTGTATTGCCATCAGCTTA
ATATCTGCAGCAAGGTGAAGGCAGAAGTGCAGAATCTGGGAGGAGAGCTCATTGTGTCAGGGCTGGACAGTGCCACATCGCTTATCCAGG
CAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTGAAAGCATCCTATGTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGCAG
CTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGACAC
GAGTTCGACGAGGTTCTCAGAAGAAACACATTTCGCCTGTACAGGCTTTAAGTGAATTCAAAGCAATGGATTCCTTCTAGGACGATAGGT
TTTAACAAGAAAGCTTTTTCTTTCTTTTCTTTCTTTCTTTTTCTTTTTAATTCCATTTTTGTATGCATACCTGCCAGCTCGTATGCCTCT
GGCATGGGGAAATTAAGGGAACAGTGTCTGTTTGCATGTAAGATGAGATGAGATCAATACTACTGATCCATCTGTAGCCTGGGAAGGAGA
CAGGACATTCCTGTACTAAGGTGGCACAGAGCTGTCCTTTGCAACATTCTCATAAAATTGGGCACAGAGTTCGCATTGGCGCAATATTTA
TGGGAGTGGGAGGGATGGGGAAAATAAACTTAACTCTACAAAAGCAAACTCTAATGCATGCAAGAATCATTAGGTTGGCAGGTATATGCA
TAAGTGAAAAATCTGGAAGTGTAATGGTAGAACATAAAACTTGTATTGCTTCTGTTTCAGTGCAAAAATGTACTAGCCAATACGCTTAAG
TGTGTGGCCCATGAATTGAACAATTTAACCTTGAAGTCTATATCCGTGATATTATGTCGATTTTTAACTGAGGGGAAATTAACTAGTCCA
GCCTAAAATGCTTCTTTTAATCTGCATTCTGTTTCCTCTTCTAGTTGTGCCATTACTAGTGATCATGTTTTTTTCCCCCCTTTAATGAAA
ACAATAAACATCTATTTGAGACAATTAAAATCCTTCTGGGGGCACTGGAAGCACAATACGGTGACCAATCTTGCTTTCATTTTTTTTTCT
TTTTAATTTGAACCATGATTTTGCTAGAAATAGAAGGCCCAGTGGTGGAATATTAGAGGGAAGGAAACTGACAACGTGTGAAAGTTAGAG

>In-frame_HIBCH_ENST00000392332_chr2_191175480_-_CTNNA2_ENST00000361291_chr2_80620336_+_1880nt
GGAAACGGTCGCTCTGGCTTCCTGGAGGACTTGTCATCTGTGCCCGGCGGCGCAGGACGGCGGTGGGCGGGGCTCACGCGAGGCGCTGGA
ACGGTCCGGGAGATTCTCGCTCTGCTGCTTTAGCTTCGGAGTGTTTGGCGATGGGGCAGCGCGAGATGTGGAGGCTCATGTCGAGGTTTA
ATGCATTCAAAAGGACTAATACCATACTGCACCATTTGACTGGAAGGAAAGAAAAAGGAGATCCTCTCAACATTGCGATTGATAAGATGA
CTAAGAAAACAAGAGATCTAAGGAGACAGCTTCGGAAAGCAGTGATGGATCACATATCTGACTCTTTCCTGGAAACCAATGTTCCTTTGC
TAGTTCTCATTGAGGCTGCAAAGAGCGGAAATGAAAAGGAAGTGAAAGAATATGCCCAAGTTTTCCGTGAGCATGCCAACAAACTGGTAG
AGGTTGCCAATTTGGCCTGTTCCATCTCCAACAATGAAGAAGGGGTGAAATTAGTTCGGATGGCAGCCACCCAGATTGACAGCCTGTGTC
CCCAGGTCATCAATGCCGCTCTGACACTGGCTGCCCGGCCACAGAGCAAAGTTGCTCAGGATAACATGGACGTCTTCAAAGACCAGTGGG
AGAAGCAGGTCCGAGTGTTGACAGAGGCCGTGGATGACATCACCTCAGTGGATGACTTCCTCTCTGTCTCAGAAAATCACATCTTGGAGG
ATGTGAACAAGTGTGTGATAGCCCTCCAAGAGGGCGATGTGGACACTCTGGACCGGACTGCAGGGGCCATCAGGGGCCGGGCAGCTCGAG
TCATACACATCATCAATGCTGAGATGGAGAACTATGAAGCTGGGGTTTATACTGAGAAGGTGTTGGAAGCTACAAAATTGCTTTCTGAAA
CAGTGATGCCACGCTTCGCTGAACAAGTAGAGGTTGCCATTGAAGCCCTGAGTGCCAACGTTCCTCAACCGTTTGAGGAGAATGAGTTCA
TCGATGCCTCTCGCCTGGTGTATGATGGCGTTCGGGACATCAGAAAGGCTGTGCTGATGATCAGGACCCCAGAAGAACTAGAGGATGATT
CTGACTTTGAGCAGGAAGATTATGATGTGCGTAGCAGGACAAGTGTTCAGACTGAGGATGACCAGCTCATTGCAGGGCAGAGCGCACGGG
CCATCATGGCGCAACTACCGCAGGAGGAGAAGGCAAAAATAGCTGAGCAGGTGGAGATATTCCATCAAGAGAAAAGCAAGCTGGATGCAG
AAGTGGCCAAATGGGACGACAGCGGCAATGATATCATTGTACTGGCCAAGCAGATGTGTATGATCATGATGGAAATGACAGACTTCACAA
GAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATTAATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGCTC
GTGCTGTGGCTGATCAGTGTCCTGATTCAGCATGTAAGCAGGATTTATTAGCCTACCTTCAACGAATTGCCTTGTATTGCCATCAGCTTA
ATATCTGCAGCAAGGTGAAGGCAGAAGTGCAGAATCTGGGAGGAGAGCTCATTGTGTCAGGGCTGGACAGTGCCACATCGCTTATCCAGG
CAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTGAAAGCATCCTATGTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGCAG
CTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGACAC

>In-frame_HIBCH_ENST00000392332_chr2_191175480_-_CTNNA2_ENST00000402739_chr2_80620336_+_2841nt
GGAAACGGTCGCTCTGGCTTCCTGGAGGACTTGTCATCTGTGCCCGGCGGCGCAGGACGGCGGTGGGCGGGGCTCACGCGAGGCGCTGGA
ACGGTCCGGGAGATTCTCGCTCTGCTGCTTTAGCTTCGGAGTGTTTGGCGATGGGGCAGCGCGAGATGTGGAGGCTCATGTCGAGGTTTA
ATGCATTCAAAAGGACTAATACCATACTGCACCATTTGACTGGAAGGAAAGAAAAAGGAGATCCTCTCAACATTGCGATTGATAAGATGA
CTAAGAAAACAAGAGATCTAAGGAGACAGCTTCGGAAAGCAGTGATGGATCACATATCTGACTCTTTCCTGGAAACCAATGTTCCTTTGC
TAGTTCTCATTGAGGCTGCAAAGAGCGGAAATGAAAAGGAAGTGAAAGAATATGCCCAAGTTTTCCGTGAGCATGCCAACAAACTGGTAG
AGGTTGCCAATTTGGCCTGTTCCATCTCCAACAATGAAGAAGGGGTGAAATTAGTTCGGATGGCAGCCACCCAGATTGACAGCCTGTGTC
CCCAGGTCATCAATGCCGCTCTGACACTGGCTGCCCGGCCACAGAGCAAAGTTGCTCAGGATAACATGGACGTCTTCAAAGACCAGTGGG
AGAAGCAGGTCCGAGTGTTGACAGAGGCCGTGGATGACATCACCTCAGTGGATGACTTCCTCTCTGTCTCAGAAAATCACATCTTGGAGG
ATGTGAACAAGTGTGTGATAGCCCTCCAAGAGGGCGATGTGGACACTCTGGACCGGACTGCAGGGGCCATCAGGGGCCGGGCAGCTCGAG
TCATACACATCATCAATGCTGAGATGGAGAACTATGAAGCTGGGGTTTATACTGAGAAGGTGTTGGAAGCTACAAAATTGCTTTCTGAAA
CAGTGATGCCACGCTTCGCTGAACAAGTAGAGGTTGCCATTGAAGCCCTGAGTGCCAACGTTCCTCAACCGTTTGAGGAGAATGAGTTCA
TCGATGCCTCTCGCCTGGTGTATGATGGCGTTCGGGACATCAGAAAGGCTGTGCTGATGATCAGGACCCCAGAAGAACTAGAGGATGATT
CTGACTTTGAGCAGGAAGATTATGATGTGCGTAGCAGGACAAGTGTTCAGACTGAGGATGACCAGCTCATTGCAGGGCAGAGCGCACGGG
CCATCATGGCGCAACTACCGCAGGAGGAGAAGGCAAAAATAGCTGAGCAGGTGGAGATATTCCATCAAGAGAAAAGCAAGCTGGATGCAG
AAGTGGCCAAATGGGACGACAGCGGCAATGATATCATTGTACTGGCCAAGCAGATGTGTATGATCATGATGGAAATGACAGACTTCACAA
GAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATTAATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGCTC
GTGCTGTGGCTGATCAGTGTCCTGATTCAGCATGTAAGCAGGATTTATTAGCCTACCTTCAACGAATTGCCTTGTATTGCCATCAGCTTA
ATATCTGCAGCAAGGTGAAGGCAGAAGTGCAGAATCTGGGAGGAGAGCTCATTGTGTCAGGGACAGGAGTTCAGAGCACTTTCACTACCT
TTTATGAGGTAGATTGTGATGTCATAGATGGGGGCAGGGCTAGTCAACTTTCTACCCACCTCCCAACCTGTGCTGAGGGAGCTCCGATCG
GGAGTGGAAGCAGTGATTCCTCCATGCTGGACAGTGCCACATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGG
TGAAAGCATCCTATGTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGG
CTCCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAAACACATTTCGC
CTGTACAGGCTTTAAGTGAATTCAAAGCAATGGATTCCTTCTAGGACGATAGGTTTTAACAAGAAAGCTTTTTCTTTCTTTTCTTTCTTT
CTTTTTCTTTTTAATTCCATTTTTGTATGCATACCTGCCAGCTCGTATGCCTCTGGCATGGGGAAATTAAGGGAACAGTGTCTGTTTGCA
TGTAAGATGAGATGAGATCAATACTACTGATCCATCTGTAGCCTGGGAAGGAGACAGGACATTCCTGTACTAAGGTGGCACAGAGCTGTC
CTTTGCAACATTCTCATAAAATTGGGCACAGAGTTCGCATTGGCGCAATATTTATGGGAGTGGGAGGGATGGGGAAAATAAACTTAACTC
TACAAAAGCAAACTCTAATGCATGCAAGAATCATTAGGTTGGCAGGTATATGCATAAGTGAAAAATCTGGAAGTGTAATGGTAGAACATA
AAACTTGTATTGCTTCTGTTTCAGTGCAAAAATGTACTAGCCAATACGCTTAAGTGTGTGGCCCATGAATTGAACAATTTAACCTTGAAG
TCTATATCCGTGATATTATGTCGATTTTTAACTGAGGGGAAATTAACTAGTCCAGCCTAAAATGCTTCTTTTAATCTGCATTCTGTTTCC
TCTTCTAGTTGTGCCATTACTAGTGATCATGTTTTTTTCCCCCCTTTAATGAAAACAATAAACATCTATTTGAGACAATTAAAATCCTTC
TGGGGGCACTGGAAGCACAATACGGTGACCAATCTTGCTTTCATTTTTTTTTCTTTTTAATTTGAACCATGATTTTGCTAGAAATAGAAG

>In-frame_HIBCH_ENST00000392332_chr2_191175480_-_CTNNA2_ENST00000540488_chr2_80620336_+_1745nt
GGAAACGGTCGCTCTGGCTTCCTGGAGGACTTGTCATCTGTGCCCGGCGGCGCAGGACGGCGGTGGGCGGGGCTCACGCGAGGCGCTGGA
ACGGTCCGGGAGATTCTCGCTCTGCTGCTTTAGCTTCGGAGTGTTTGGCGATGGGGCAGCGCGAGATGTGGAGGCTCATGTCGAGGTTTA
ATGCATTCAAAAGGACTAATACCATACTGCACCATTTGACTGGAAGGAAAGAAAAAGGAGATCCTCTCAACATTGCGATTGATAAGATGA
CTAAGAAAACAAGAGATCTAAGGAGACAGCTTCGGAAAGCAGTGATGGATCACATATCTGACTCTTTCCTGGAAACCAATGTTCCTTTGC
TAGTTCTCATTGAGGCTGCAAAGAGCGGAAATGAAAAGGAAGTGAAAGAATATGCCCAAGTTTTCCGTGAGCATGCCAACAAACTGGTAG
AGGTTGCCAATTTGGCCTGTTCCATCTCCAACAATGAAGAAGGGGTGAAATTAGTTCGGATGGCAGCCACCCAGATTGACAGCCTGTGTC
CCCAGGTCATCAATGCCGCTCTGACACTGGCTGCCCGGCCACAGAGCAAAGTTGCTCAGGATAACATGGACGTCTTCAAAGACCAGTGGG
AGAAGCAGGTCCGAGTGTTGACAGAGGCCGTGGATGACATCACCTCAGTGGATGACTTCCTCTCTGTCTCAGAAAATCACATCTTGGAGG
ATGTGAACAAGTGTGTGATAGCCCTCCAAGAGGGCGATGTGGACACTCTGGACCGGACTGCAGGGGCCATCAGGGGCCGGGCAGCTCGAG
TCATACACATCATCAATGCTGAGATGGAGAACTATGAAGCTGGGGTTTATACTGAGAAGGTGTTGGAAGCTACAAAATTGCTTTCTGAAA
CAGTGATGCCACGCTTCGCTGAACAAGTAGAGGTTGCCATTGAAGCCCTGAGTGCCAACGTTCCTCAACCGTTTGAGGAGAATGAGTTCA
TCGATGCCTCTCGCCTGGTGTATGATGGCGTTCGGGACATCAGAAAGGCTGTGCTGATGATCAGGACCCCAGAAGAACTAGAGGATGATT
CTGACTTTGAGCAGGAAGATTATGATGTGCGTAGCAGGACAAGTGTTCAGACTGAGGATGACCAGCTCATTGCAGGGCAGAGCGCACGGG
CCATCATGGCGCAACTACCGCAGGAGGAGAAGGCAAAAATAGCTGAGCAGGTGGAGATATTCCATCAAGAGAAAAGCAAGCTGGATGCAG
AAGTGGCCAAATGGGACGACAGCGGCAATGATATCATTGTACTGGCCAAGCAGATGTGTATGATCATGATGGAAATGACAGACTTCACAA
GAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATTAATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGCTC
GTGCTGTGGCTGATCAGCTGGACAGTGCCACATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTGAAAGCAT
CCTATGTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCCAGAGA
AGAAGCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAAACACATTTCGCCTGTACAGG

>In-frame_HIBCH_ENST00000392332_chr2_191175480_-_CTNNA2_ENST00000541047_chr2_80620336_+_2787nt
GGAAACGGTCGCTCTGGCTTCCTGGAGGACTTGTCATCTGTGCCCGGCGGCGCAGGACGGCGGTGGGCGGGGCTCACGCGAGGCGCTGGA
ACGGTCCGGGAGATTCTCGCTCTGCTGCTTTAGCTTCGGAGTGTTTGGCGATGGGGCAGCGCGAGATGTGGAGGCTCATGTCGAGGTTTA
ATGCATTCAAAAGGACTAATACCATACTGCACCATTTGACTGGAAGGAAAGAAAAAGGAGATCCTCTCAACATTGCGATTGATAAGATGA
CTAAGAAAACAAGAGATCTAAGGAGACAGCTTCGGAAAGCAGTGATGGATCACATATCTGACTCTTTCCTGGAAACCAATGTTCCTTTGC
TAGTTCTCATTGAGGCTGCAAAGAGCGGAAATGAAAAGGAAGTGAAAGAATATGCCCAAGTTTTCCGTGAGCATGCCAACAAACTGGTAG
AGGTTGCCAATTTGGCCTGTTCCATCTCCAACAATGAAGAAGGGGTGAAATTAGTTCGGATGGCAGCCACCCAGATTGACAGCCTGTGTC
CCCAGGTCATCAATGCCGCTCTGACACTGGCTGCCCGGCCACAGAGCAAAGTTGCTCAGGATAACATGGACGTCTTCAAAGACCAGTGGG
AGAAGCAGGTCCGAGTGTTGACAGAGGCCGTGGATGACATCACCTCAGTGGATGACTTCCTCTCTGTCTCAGAAAATCACATCTTGGAGG
ATGTGAACAAGTGTGTGATAGCCCTCCAAGAGGGCGATGTGGACACTCTGGACCGGACTGCAGGGGCCATCAGGGGCCGGGCAGCTCGAG
TCATACACATCATCAATGCTGAGATGGAGAACTATGAAGCTGGGGTTTATACTGAGAAGGTGTTGGAAGCTACAAAATTGCTTTCTGAAA
CAGTGATGCCACGCTTCGCTGAACAAGTAGAGGTTGCCATTGAAGCCCTGAGTGCCAACGTTCCTCAACCGTTTGAGGAGAATGAGTTCA
TCGATGCCTCTCGCCTGGTGTATGATGGCGTTCGGGACATCAGAAAGGCTGTGCTGATGATCAGGACCCCAGAAGAACTAGAGGATGATT
CTGACTTTGAGCAGGAAGATTATGATGTGCGTAGCAGGACAAGTGTTCAGACTGAGGATGACCAGCTCATTGCAGGGCAGAGCGCACGGG
CCATCATGGCGCAACTACCGCAGGAGGAGAAGGCAAAAATAGCTGAGCAGGTGGAGATATTCCATCAAGAGAAAAGCAAGCTGGATGCAG
AAGTGGCCAAATGGGACGACAGCGGCAATGATATCATTGTACTGGCCAAGCAGATGTGTATGATCATGATGGAAATGACAGACTTCACAA
GAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATTAATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGCTC
GTGCTGTGGCTGATCAGTGTCCTGATTCAGCATGTAAGCAGGATTTATTAGCCTACCTTCAACGAATTGCCTTGTATTGCCATCAGCTTA
ATATCTGCAGCAAGGTGAAGGCAGAAGTGCAGAATCTGGGAGGAGAGCTCATTGTGTCAGGGCTGGACAGTGCCACATCGCTTATCCAGG
CAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTGAAAGCATCCTATGTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGCAG
CTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGACAC
GAGTTCGACGAGGTTCTCAGAAGAAACACATTTCGCCTGTACAGGCTTTAAGTGAATTCAAAGCAATGGATTCCTTCTAGGACGATAGGT
TTTAACAAGAAAGCTTTTTCTTTCTTTTCTTTCTTTCTTTTTCTTTTTAATTCCATTTTTGTATGCATACCTGCCAGCTCGTATGCCTCT
GGCATGGGGAAATTAAGGGAACAGTGTCTGTTTGCATGTAAGATGAGATGAGATCAATACTACTGATCCATCTGTAGCCTGGGAAGGAGA
CAGGACATTCCTGTACTAAGGTGGCACAGAGCTGTCCTTTGCAACATTCTCATAAAATTGGGCACAGAGTTCGCATTGGCGCAATATTTA
TGGGAGTGGGAGGGATGGGGAAAATAAACTTAACTCTACAAAAGCAAACTCTAATGCATGCAAGAATCATTAGGTTGGCAGGTATATGCA
TAAGTGAAAAATCTGGAAGTGTAATGGTAGAACATAAAACTTGTATTGCTTCTGTTTCAGTGCAAAAATGTACTAGCCAATACGCTTAAG
TGTGTGGCCCATGAATTGAACAATTTAACCTTGAAGTCTATATCCGTGATATTATGTCGATTTTTAACTGAGGGGAAATTAACTAGTCCA
GCCTAAAATGCTTCTTTTAATCTGCATTCTGTTTCCTCTTCTAGTTGTGCCATTACTAGTGATCATGTTTTTTTCCCCCCTTTAATGAAA
ACAATAAACATCTATTTGAGACAATTAAAATCCTTCTGGGGGCACTGGAAGCACAATACGGTGACCAATCTTGCTTTCATTTTTTTTTCT
TTTTAATTTGAACCATGATTTTGCTAGAAATAGAAGGCCCAGTGGTGGAATATTAGAGGGAAGGAAACTGACAACGTGTGAAAGTTAGAG

>In-frame_HIBCH_ENST00000392332_chr2_191175480_-_CTNNA2_ENST00000343114_chr2_80620336_+_2788nt
GGAAACGGTCGCTCTGGCTTCCTGGAGGACTTGTCATCTGTGCCCGGCGGCGCAGGACGGCGGTGGGCGGGGCTCACGCGAGGCGCTGGA
ACGGTCCGGGAGATTCTCGCTCTGCTGCTTTAGCTTCGGAGTGTTTGGCGATGGGGCAGCGCGAGATGTGGAGGCTCATGTCGAGGTTTA
ATGCATTCAAAAGGACTAATACCATACTGCACCATTTGACTGGAAGGAAAGAAAAAGGAGATCCTCTCAACATTGCGATTGATAAGATGA
CTAAGAAAACAAGAGATCTAAGGAGACAGCTTCGGAAAGCAGTGATGGATCACATATCTGACTCTTTCCTGGAAACCAATGTTCCTTTGC
TAGTTCTCATTGAGGCTGCAAAGAGCGGAAATGAAAAGGAAGTGAAAGAATATGCCCAAGTTTTCCGTGAGCATGCCAACAAACTGGTAG
AGGTTGCCAATTTGGCCTGTTCCATCTCCAACAATGAAGAAGGGGTGAAATTAGTTCGGATGGCAGCCACCCAGATTGACAGCCTGTGTC
CCCAGGTCATCAATGCCGCTCTGACACTGGCTGCCCGGCCACAGAGCAAAGTTGCTCAGGATAACATGGACGTCTTCAAAGACCAGTGGG
AGAAGCAGGTCCGAGTGTTGACAGAGGCCGTGGATGACATCACCTCAGTGGATGACTTCCTCTCTGTCTCAGAAAATCACATCTTGGAGG
ATGTGAACAAGTGTGTGATAGCCCTCCAAGAGGGCGATGTGGACACTCTGGACCGGACTGCAGGGGCCATCAGGGGCCGGGCAGCTCGAG
TCATACACATCATCAATGCTGAGATGGAGAACTATGAAGCTGGGGTTTATACTGAGAAGGTGTTGGAAGCTACAAAATTGCTTTCTGAAA
CAGTGATGCCACGCTTCGCTGAACAAGTAGAGGTTGCCATTGAAGCCCTGAGTGCCAACGTTCCTCAACCGTTTGAGGAGAATGAGTTCA
TCGATGCCTCTCGCCTGGTGTATGATGGCGTTCGGGACATCAGAAAGGCTGTGCTGATGATCAGGACCCCAGAAGAACTAGAGGATGATT
CTGACTTTGAGCAGGAAGATTATGATGTGCGTAGCAGGACAAGTGTTCAGACTGAGGATGACCAGCTCATTGCAGGGCAGAGCGCACGGG
CCATCATGGCGCAACTACCGCAGGAGGAGAAGGCAAAAATAGCTGAGCAGGTGGAGATATTCCATCAAGAGAAAAGCAAGCTGGATGCAG
AAGTGGCCAAATGGGACGACAGCGGCAATGATATCATTGTACTGGCCAAGCAGATGTGTATGATCATGATGGAAATGACAGACTTCACAA
GAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATTAATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGCTC
GTGCTGTGGCTGATCAGTGTCCTGATTCAGCATGTAAGCAGGATTTATTAGCCTACCTTCAACGAATTGCCTTGTATTGCCATCAGCTTA
ATATCTGCAGCAAGGTGAAGGCAGAAGTGCAGAATCTGGGAGGAGAGCTCATTGTGTCAGGGCTGGACAGTGCCACATCGCTTATCCAGG
CAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTGAAAGCATCCTATGTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGCAG
CTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGACAC
GAGTTCGACGAGGTTCTCAGAAGAAACACATTTCGCCTGTACAGGCTTTAAGTGAATTCAAAGCAATGGATTCCTTCTAGGACGATAGGT
TTTAACAAGAAAGCTTTTTCTTTCTTTTCTTTCTTTCTTTTTCTTTTTAATTCCATTTTTGTATGCATACCTGCCAGCTCGTATGCCTCT
GGCATGGGGAAATTAAGGGAACAGTGTCTGTTTGCATGTAAGATGAGATGAGATCAATACTACTGATCCATCTGTAGCCTGGGAAGGAGA
CAGGACATTCCTGTACTAAGGTGGCACAGAGCTGTCCTTTGCAACATTCTCATAAAATTGGGCACAGAGTTCGCATTGGCGCAATATTTA
TGGGAGTGGGAGGGATGGGGAAAATAAACTTAACTCTACAAAAGCAAACTCTAATGCATGCAAGAATCATTAGGTTGGCAGGTATATGCA
TAAGTGAAAAATCTGGAAGTGTAATGGTAGAACATAAAACTTGTATTGCTTCTGTTTCAGTGCAAAAATGTACTAGCCAATACGCTTAAG
TGTGTGGCCCATGAATTGAACAATTTAACCTTGAAGTCTATATCCGTGATATTATGTCGATTTTTAACTGAGGGGAAATTAACTAGTCCA
GCCTAAAATGCTTCTTTTAATCTGCATTCTGTTTCCTCTTCTAGTTGTGCCATTACTAGTGATCATGTTTTTTTCCCCCCTTTAATGAAA
ACAATAAACATCTATTTGAGACAATTAAAATCCTTCTGGGGGCACTGGAAGCACAATACGGTGACCAATCTTGCTTTCATTTTTTTTTCT
TTTTAATTTGAACCATGATTTTGCTAGAAATAGAAGGCCCAGTGGTGGAATATTAGAGGGAAGGAAACTGACAACGTGTGAAAGTTAGAG

>In-frame_HIBCH_ENST00000359678_chr2_191175480_-_CTNNA2_ENST00000466387_chr2_80620336_+_2942nt
CCTGCGAATCCGCCCTAGTCCGTTCTATCCTCCCTCTTCCCGCTCCGCCTCAGCTCGCTCTCCGCCTTCTCCCTGGCCCGGTCCCCGATC
CCTTCCTCTCCCTCAACTATTTCCTCCAGGCGTCGTTCTTGCCCCGCCCTTCCCCGTCGCGTAGCGGAAACGGTCGCTCTGGCTTCCTGG
AGGACTTGTCATCTGTGCCCGGCGGCGCAGGACGGCGGTGGGCGGGGCTCACGCGAGGCGCTGGAACGGTCCGGGAGATTCTCGCTCTGC
TGCTTTAGCTTCGGAGTGTTTGGCGATGGGGCAGCGCGAGATGTGGAGGCTCATGTCGAGGTTTAATGCATTCAAAAGGACTAATACCAT
ACTGCACCATTTGACTGGAAGGAAAGAAAAAGGAGATCCTCTCAACATTGCGATTGATAAGATGACTAAGAAAACAAGAGATCTAAGGAG
ACAGCTTCGGAAAGCAGTGATGGATCACATATCTGACTCTTTCCTGGAAACCAATGTTCCTTTGCTAGTTCTCATTGAGGCTGCAAAGAG
CGGAAATGAAAAGGAAGTGAAAGAATATGCCCAAGTTTTCCGTGAGCATGCCAACAAACTGGTAGAGGTTGCCAATTTGGCCTGTTCCAT
CTCCAACAATGAAGAAGGGGTGAAATTAGTTCGGATGGCAGCCACCCAGATTGACAGCCTGTGTCCCCAGGTCATCAATGCCGCTCTGAC
ACTGGCTGCCCGGCCACAGAGCAAAGTTGCTCAGGATAACATGGACGTCTTCAAAGACCAGTGGGAGAAGCAGGTCCGAGTGTTGACAGA
GGCCGTGGATGACATCACCTCAGTGGATGACTTCCTCTCTGTCTCAGAAAATCACATCTTGGAGGATGTGAACAAGTGTGTGATAGCCCT
CCAAGAGGGCGATGTGGACACTCTGGACCGGACTGCAGGGGCCATCAGGGGCCGGGCAGCTCGAGTCATACACATCATCAATGCTGAGAT
GGAGAACTATGAAGCTGGGGTTTATACTGAGAAGGTGTTGGAAGCTACAAAATTGCTTTCTGAAACAGTGATGCCACGCTTCGCTGAACA
AGTAGAGGTTGCCATTGAAGCCCTGAGTGCCAACGTTCCTCAACCGTTTGAGGAGAATGAGTTCATCGATGCCTCTCGCCTGGTGTATGA
TGGCGTTCGGGACATCAGAAAGGCTGTGCTGATGATCAGGACCCCAGAAGAACTAGAGGATGATTCTGACTTTGAGCAGGAAGATTATGA
TGTGCGTAGCAGGACAAGTGTTCAGACTGAGGATGACCAGCTCATTGCAGGGCAGAGCGCACGGGCCATCATGGCGCAACTACCGCAGGA
GGAGAAGGCAAAAATAGCTGAGCAGGTGGAGATATTCCATCAAGAGAAAAGCAAGCTGGATGCAGAAGTGGCCAAATGGGACGACAGCGG
CAATGATATCATTGTACTGGCCAAGCAGATGTGTATGATCATGATGGAAATGACAGACTTCACAAGAGGCAAAGGCCCATTGAAAAATAC
ATCTGATGTCATTAATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGCTCGTGCTGTGGCTGATCAGTGTCCTGA
TTCAGCATGTAAGCAGGATTTATTAGCCTACCTTCAACGAATTGCCTTGTATTGCCATCAGCTTAATATCTGCAGCAAGGTGAAGGCAGA
AGTGCAGAATCTGGGAGGAGAGCTCATTGTGTCAGGGCTGGACAGTGCCACATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGT
TGTCCTCACGGTGAAAGCATCCTATGTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTG
GAAGATGAAGGCTCCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAA
ACACATTTCGCCTGTACAGGCTTTAAGTGAATTCAAAGCAATGGATTCCTTCTAGGACGATAGGTTTTAACAAGAAAGCTTTTTCTTTCT
TTTCTTTCTTTCTTTTTCTTTTTAATTCCATTTTTGTATGCATACCTGCCAGCTCGTATGCCTCTGGCATGGGGAAATTAAGGGAACAGT
GTCTGTTTGCATGTAAGATGAGATGAGATCAATACTACTGATCCATCTGTAGCCTGGGAAGGAGACAGGACATTCCTGTACTAAGGTGGC
ACAGAGCTGTCCTTTGCAACATTCTCATAAAATTGGGCACAGAGTTCGCATTGGCGCAATATTTATGGGAGTGGGAGGGATGGGGAAAAT
AAACTTAACTCTACAAAAGCAAACTCTAATGCATGCAAGAATCATTAGGTTGGCAGGTATATGCATAAGTGAAAAATCTGGAAGTGTAAT
GGTAGAACATAAAACTTGTATTGCTTCTGTTTCAGTGCAAAAATGTACTAGCCAATACGCTTAAGTGTGTGGCCCATGAATTGAACAATT
TAACCTTGAAGTCTATATCCGTGATATTATGTCGATTTTTAACTGAGGGGAAATTAACTAGTCCAGCCTAAAATGCTTCTTTTAATCTGC
ATTCTGTTTCCTCTTCTAGTTGTGCCATTACTAGTGATCATGTTTTTTTCCCCCCTTTAATGAAAACAATAAACATCTATTTGAGACAAT
TAAAATCCTTCTGGGGGCACTGGAAGCACAATACGGTGACCAATCTTGCTTTCATTTTTTTTTCTTTTTAATTTGAACCATGATTTTGCT
AGAAATAGAAGGCCCAGTGGTGGAATATTAGAGGGAAGGAAACTGACAACGTGTGAAAGTTAGAGGCAAATACATAGGTGTAGCTTGGAG

>In-frame_HIBCH_ENST00000359678_chr2_191175480_-_CTNNA2_ENST00000496558_chr2_80620336_+_2943nt
CCTGCGAATCCGCCCTAGTCCGTTCTATCCTCCCTCTTCCCGCTCCGCCTCAGCTCGCTCTCCGCCTTCTCCCTGGCCCGGTCCCCGATC
CCTTCCTCTCCCTCAACTATTTCCTCCAGGCGTCGTTCTTGCCCCGCCCTTCCCCGTCGCGTAGCGGAAACGGTCGCTCTGGCTTCCTGG
AGGACTTGTCATCTGTGCCCGGCGGCGCAGGACGGCGGTGGGCGGGGCTCACGCGAGGCGCTGGAACGGTCCGGGAGATTCTCGCTCTGC
TGCTTTAGCTTCGGAGTGTTTGGCGATGGGGCAGCGCGAGATGTGGAGGCTCATGTCGAGGTTTAATGCATTCAAAAGGACTAATACCAT
ACTGCACCATTTGACTGGAAGGAAAGAAAAAGGAGATCCTCTCAACATTGCGATTGATAAGATGACTAAGAAAACAAGAGATCTAAGGAG
ACAGCTTCGGAAAGCAGTGATGGATCACATATCTGACTCTTTCCTGGAAACCAATGTTCCTTTGCTAGTTCTCATTGAGGCTGCAAAGAG
CGGAAATGAAAAGGAAGTGAAAGAATATGCCCAAGTTTTCCGTGAGCATGCCAACAAACTGGTAGAGGTTGCCAATTTGGCCTGTTCCAT
CTCCAACAATGAAGAAGGGGTGAAATTAGTTCGGATGGCAGCCACCCAGATTGACAGCCTGTGTCCCCAGGTCATCAATGCCGCTCTGAC
ACTGGCTGCCCGGCCACAGAGCAAAGTTGCTCAGGATAACATGGACGTCTTCAAAGACCAGTGGGAGAAGCAGGTCCGAGTGTTGACAGA
GGCCGTGGATGACATCACCTCAGTGGATGACTTCCTCTCTGTCTCAGAAAATCACATCTTGGAGGATGTGAACAAGTGTGTGATAGCCCT
CCAAGAGGGCGATGTGGACACTCTGGACCGGACTGCAGGGGCCATCAGGGGCCGGGCAGCTCGAGTCATACACATCATCAATGCTGAGAT
GGAGAACTATGAAGCTGGGGTTTATACTGAGAAGGTGTTGGAAGCTACAAAATTGCTTTCTGAAACAGTGATGCCACGCTTCGCTGAACA
AGTAGAGGTTGCCATTGAAGCCCTGAGTGCCAACGTTCCTCAACCGTTTGAGGAGAATGAGTTCATCGATGCCTCTCGCCTGGTGTATGA
TGGCGTTCGGGACATCAGAAAGGCTGTGCTGATGATCAGGACCCCAGAAGAACTAGAGGATGATTCTGACTTTGAGCAGGAAGATTATGA
TGTGCGTAGCAGGACAAGTGTTCAGACTGAGGATGACCAGCTCATTGCAGGGCAGAGCGCACGGGCCATCATGGCGCAACTACCGCAGGA
GGAGAAGGCAAAAATAGCTGAGCAGGTGGAGATATTCCATCAAGAGAAAAGCAAGCTGGATGCAGAAGTGGCCAAATGGGACGACAGCGG
CAATGATATCATTGTACTGGCCAAGCAGATGTGTATGATCATGATGGAAATGACAGACTTCACAAGAGGCAAAGGCCCATTGAAAAATAC
ATCTGATGTCATTAATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGCTCGTGCTGTGGCTGATCAGTGTCCTGA
TTCAGCATGTAAGCAGGATTTATTAGCCTACCTTCAACGAATTGCCTTGTATTGCCATCAGCTTAATATCTGCAGCAAGGTGAAGGCAGA
AGTGCAGAATCTGGGAGGAGAGCTCATTGTGTCAGGGCTGGACAGTGCCACATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGT
TGTCCTCACGGTGAAAGCATCCTATGTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTG
GAAGATGAAGGCTCCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAA
ACACATTTCGCCTGTACAGGCTTTAAGTGAATTCAAAGCAATGGATTCCTTCTAGGACGATAGGTTTTAACAAGAAAGCTTTTTCTTTCT
TTTCTTTCTTTCTTTTTCTTTTTAATTCCATTTTTGTATGCATACCTGCCAGCTCGTATGCCTCTGGCATGGGGAAATTAAGGGAACAGT
GTCTGTTTGCATGTAAGATGAGATGAGATCAATACTACTGATCCATCTGTAGCCTGGGAAGGAGACAGGACATTCCTGTACTAAGGTGGC
ACAGAGCTGTCCTTTGCAACATTCTCATAAAATTGGGCACAGAGTTCGCATTGGCGCAATATTTATGGGAGTGGGAGGGATGGGGAAAAT
AAACTTAACTCTACAAAAGCAAACTCTAATGCATGCAAGAATCATTAGGTTGGCAGGTATATGCATAAGTGAAAAATCTGGAAGTGTAAT
GGTAGAACATAAAACTTGTATTGCTTCTGTTTCAGTGCAAAAATGTACTAGCCAATACGCTTAAGTGTGTGGCCCATGAATTGAACAATT
TAACCTTGAAGTCTATATCCGTGATATTATGTCGATTTTTAACTGAGGGGAAATTAACTAGTCCAGCCTAAAATGCTTCTTTTAATCTGC
ATTCTGTTTCCTCTTCTAGTTGTGCCATTACTAGTGATCATGTTTTTTTCCCCCCTTTAATGAAAACAATAAACATCTATTTGAGACAAT
TAAAATCCTTCTGGGGGCACTGGAAGCACAATACGGTGACCAATCTTGCTTTCATTTTTTTTTCTTTTTAATTTGAACCATGATTTTGCT
AGAAATAGAAGGCCCAGTGGTGGAATATTAGAGGGAAGGAAACTGACAACGTGTGAAAGTTAGAGGCAAATACATAGGTGTAGCTTGGAG

>In-frame_HIBCH_ENST00000359678_chr2_191175480_-_CTNNA2_ENST00000361291_chr2_80620336_+_2035nt
CCTGCGAATCCGCCCTAGTCCGTTCTATCCTCCCTCTTCCCGCTCCGCCTCAGCTCGCTCTCCGCCTTCTCCCTGGCCCGGTCCCCGATC
CCTTCCTCTCCCTCAACTATTTCCTCCAGGCGTCGTTCTTGCCCCGCCCTTCCCCGTCGCGTAGCGGAAACGGTCGCTCTGGCTTCCTGG
AGGACTTGTCATCTGTGCCCGGCGGCGCAGGACGGCGGTGGGCGGGGCTCACGCGAGGCGCTGGAACGGTCCGGGAGATTCTCGCTCTGC
TGCTTTAGCTTCGGAGTGTTTGGCGATGGGGCAGCGCGAGATGTGGAGGCTCATGTCGAGGTTTAATGCATTCAAAAGGACTAATACCAT
ACTGCACCATTTGACTGGAAGGAAAGAAAAAGGAGATCCTCTCAACATTGCGATTGATAAGATGACTAAGAAAACAAGAGATCTAAGGAG
ACAGCTTCGGAAAGCAGTGATGGATCACATATCTGACTCTTTCCTGGAAACCAATGTTCCTTTGCTAGTTCTCATTGAGGCTGCAAAGAG
CGGAAATGAAAAGGAAGTGAAAGAATATGCCCAAGTTTTCCGTGAGCATGCCAACAAACTGGTAGAGGTTGCCAATTTGGCCTGTTCCAT
CTCCAACAATGAAGAAGGGGTGAAATTAGTTCGGATGGCAGCCACCCAGATTGACAGCCTGTGTCCCCAGGTCATCAATGCCGCTCTGAC
ACTGGCTGCCCGGCCACAGAGCAAAGTTGCTCAGGATAACATGGACGTCTTCAAAGACCAGTGGGAGAAGCAGGTCCGAGTGTTGACAGA
GGCCGTGGATGACATCACCTCAGTGGATGACTTCCTCTCTGTCTCAGAAAATCACATCTTGGAGGATGTGAACAAGTGTGTGATAGCCCT
CCAAGAGGGCGATGTGGACACTCTGGACCGGACTGCAGGGGCCATCAGGGGCCGGGCAGCTCGAGTCATACACATCATCAATGCTGAGAT
GGAGAACTATGAAGCTGGGGTTTATACTGAGAAGGTGTTGGAAGCTACAAAATTGCTTTCTGAAACAGTGATGCCACGCTTCGCTGAACA
AGTAGAGGTTGCCATTGAAGCCCTGAGTGCCAACGTTCCTCAACCGTTTGAGGAGAATGAGTTCATCGATGCCTCTCGCCTGGTGTATGA
TGGCGTTCGGGACATCAGAAAGGCTGTGCTGATGATCAGGACCCCAGAAGAACTAGAGGATGATTCTGACTTTGAGCAGGAAGATTATGA
TGTGCGTAGCAGGACAAGTGTTCAGACTGAGGATGACCAGCTCATTGCAGGGCAGAGCGCACGGGCCATCATGGCGCAACTACCGCAGGA
GGAGAAGGCAAAAATAGCTGAGCAGGTGGAGATATTCCATCAAGAGAAAAGCAAGCTGGATGCAGAAGTGGCCAAATGGGACGACAGCGG
CAATGATATCATTGTACTGGCCAAGCAGATGTGTATGATCATGATGGAAATGACAGACTTCACAAGAGGCAAAGGCCCATTGAAAAATAC
ATCTGATGTCATTAATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGCTCGTGCTGTGGCTGATCAGTGTCCTGA
TTCAGCATGTAAGCAGGATTTATTAGCCTACCTTCAACGAATTGCCTTGTATTGCCATCAGCTTAATATCTGCAGCAAGGTGAAGGCAGA
AGTGCAGAATCTGGGAGGAGAGCTCATTGTGTCAGGGCTGGACAGTGCCACATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGT
TGTCCTCACGGTGAAAGCATCCTATGTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTG
GAAGATGAAGGCTCCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAA

>In-frame_HIBCH_ENST00000359678_chr2_191175480_-_CTNNA2_ENST00000402739_chr2_80620336_+_2996nt
CCTGCGAATCCGCCCTAGTCCGTTCTATCCTCCCTCTTCCCGCTCCGCCTCAGCTCGCTCTCCGCCTTCTCCCTGGCCCGGTCCCCGATC
CCTTCCTCTCCCTCAACTATTTCCTCCAGGCGTCGTTCTTGCCCCGCCCTTCCCCGTCGCGTAGCGGAAACGGTCGCTCTGGCTTCCTGG
AGGACTTGTCATCTGTGCCCGGCGGCGCAGGACGGCGGTGGGCGGGGCTCACGCGAGGCGCTGGAACGGTCCGGGAGATTCTCGCTCTGC
TGCTTTAGCTTCGGAGTGTTTGGCGATGGGGCAGCGCGAGATGTGGAGGCTCATGTCGAGGTTTAATGCATTCAAAAGGACTAATACCAT
ACTGCACCATTTGACTGGAAGGAAAGAAAAAGGAGATCCTCTCAACATTGCGATTGATAAGATGACTAAGAAAACAAGAGATCTAAGGAG
ACAGCTTCGGAAAGCAGTGATGGATCACATATCTGACTCTTTCCTGGAAACCAATGTTCCTTTGCTAGTTCTCATTGAGGCTGCAAAGAG
CGGAAATGAAAAGGAAGTGAAAGAATATGCCCAAGTTTTCCGTGAGCATGCCAACAAACTGGTAGAGGTTGCCAATTTGGCCTGTTCCAT
CTCCAACAATGAAGAAGGGGTGAAATTAGTTCGGATGGCAGCCACCCAGATTGACAGCCTGTGTCCCCAGGTCATCAATGCCGCTCTGAC
ACTGGCTGCCCGGCCACAGAGCAAAGTTGCTCAGGATAACATGGACGTCTTCAAAGACCAGTGGGAGAAGCAGGTCCGAGTGTTGACAGA
GGCCGTGGATGACATCACCTCAGTGGATGACTTCCTCTCTGTCTCAGAAAATCACATCTTGGAGGATGTGAACAAGTGTGTGATAGCCCT
CCAAGAGGGCGATGTGGACACTCTGGACCGGACTGCAGGGGCCATCAGGGGCCGGGCAGCTCGAGTCATACACATCATCAATGCTGAGAT
GGAGAACTATGAAGCTGGGGTTTATACTGAGAAGGTGTTGGAAGCTACAAAATTGCTTTCTGAAACAGTGATGCCACGCTTCGCTGAACA
AGTAGAGGTTGCCATTGAAGCCCTGAGTGCCAACGTTCCTCAACCGTTTGAGGAGAATGAGTTCATCGATGCCTCTCGCCTGGTGTATGA
TGGCGTTCGGGACATCAGAAAGGCTGTGCTGATGATCAGGACCCCAGAAGAACTAGAGGATGATTCTGACTTTGAGCAGGAAGATTATGA
TGTGCGTAGCAGGACAAGTGTTCAGACTGAGGATGACCAGCTCATTGCAGGGCAGAGCGCACGGGCCATCATGGCGCAACTACCGCAGGA
GGAGAAGGCAAAAATAGCTGAGCAGGTGGAGATATTCCATCAAGAGAAAAGCAAGCTGGATGCAGAAGTGGCCAAATGGGACGACAGCGG
CAATGATATCATTGTACTGGCCAAGCAGATGTGTATGATCATGATGGAAATGACAGACTTCACAAGAGGCAAAGGCCCATTGAAAAATAC
ATCTGATGTCATTAATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGCTCGTGCTGTGGCTGATCAGTGTCCTGA
TTCAGCATGTAAGCAGGATTTATTAGCCTACCTTCAACGAATTGCCTTGTATTGCCATCAGCTTAATATCTGCAGCAAGGTGAAGGCAGA
AGTGCAGAATCTGGGAGGAGAGCTCATTGTGTCAGGGACAGGAGTTCAGAGCACTTTCACTACCTTTTATGAGGTAGATTGTGATGTCAT
AGATGGGGGCAGGGCTAGTCAACTTTCTACCCACCTCCCAACCTGTGCTGAGGGAGCTCCGATCGGGAGTGGAAGCAGTGATTCCTCCAT
GCTGGACAGTGCCACATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTGAAAGCATCCTATGTGGCCTCAAC
CAAATACCAGAAGGTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCCAGAGAAGAAGCCCCTTGTGAA
GAGAGAAAAGCCTGAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAAACACATTTCGCCTGTACAGGCTTTAAGTGAATTCAA
AGCAATGGATTCCTTCTAGGACGATAGGTTTTAACAAGAAAGCTTTTTCTTTCTTTTCTTTCTTTCTTTTTCTTTTTAATTCCATTTTTG
TATGCATACCTGCCAGCTCGTATGCCTCTGGCATGGGGAAATTAAGGGAACAGTGTCTGTTTGCATGTAAGATGAGATGAGATCAATACT
ACTGATCCATCTGTAGCCTGGGAAGGAGACAGGACATTCCTGTACTAAGGTGGCACAGAGCTGTCCTTTGCAACATTCTCATAAAATTGG
GCACAGAGTTCGCATTGGCGCAATATTTATGGGAGTGGGAGGGATGGGGAAAATAAACTTAACTCTACAAAAGCAAACTCTAATGCATGC
AAGAATCATTAGGTTGGCAGGTATATGCATAAGTGAAAAATCTGGAAGTGTAATGGTAGAACATAAAACTTGTATTGCTTCTGTTTCAGT
GCAAAAATGTACTAGCCAATACGCTTAAGTGTGTGGCCCATGAATTGAACAATTTAACCTTGAAGTCTATATCCGTGATATTATGTCGAT
TTTTAACTGAGGGGAAATTAACTAGTCCAGCCTAAAATGCTTCTTTTAATCTGCATTCTGTTTCCTCTTCTAGTTGTGCCATTACTAGTG
ATCATGTTTTTTTCCCCCCTTTAATGAAAACAATAAACATCTATTTGAGACAATTAAAATCCTTCTGGGGGCACTGGAAGCACAATACGG
TGACCAATCTTGCTTTCATTTTTTTTTCTTTTTAATTTGAACCATGATTTTGCTAGAAATAGAAGGCCCAGTGGTGGAATATTAGAGGGA

>In-frame_HIBCH_ENST00000359678_chr2_191175480_-_CTNNA2_ENST00000540488_chr2_80620336_+_1900nt
CCTGCGAATCCGCCCTAGTCCGTTCTATCCTCCCTCTTCCCGCTCCGCCTCAGCTCGCTCTCCGCCTTCTCCCTGGCCCGGTCCCCGATC
CCTTCCTCTCCCTCAACTATTTCCTCCAGGCGTCGTTCTTGCCCCGCCCTTCCCCGTCGCGTAGCGGAAACGGTCGCTCTGGCTTCCTGG
AGGACTTGTCATCTGTGCCCGGCGGCGCAGGACGGCGGTGGGCGGGGCTCACGCGAGGCGCTGGAACGGTCCGGGAGATTCTCGCTCTGC
TGCTTTAGCTTCGGAGTGTTTGGCGATGGGGCAGCGCGAGATGTGGAGGCTCATGTCGAGGTTTAATGCATTCAAAAGGACTAATACCAT
ACTGCACCATTTGACTGGAAGGAAAGAAAAAGGAGATCCTCTCAACATTGCGATTGATAAGATGACTAAGAAAACAAGAGATCTAAGGAG
ACAGCTTCGGAAAGCAGTGATGGATCACATATCTGACTCTTTCCTGGAAACCAATGTTCCTTTGCTAGTTCTCATTGAGGCTGCAAAGAG
CGGAAATGAAAAGGAAGTGAAAGAATATGCCCAAGTTTTCCGTGAGCATGCCAACAAACTGGTAGAGGTTGCCAATTTGGCCTGTTCCAT
CTCCAACAATGAAGAAGGGGTGAAATTAGTTCGGATGGCAGCCACCCAGATTGACAGCCTGTGTCCCCAGGTCATCAATGCCGCTCTGAC
ACTGGCTGCCCGGCCACAGAGCAAAGTTGCTCAGGATAACATGGACGTCTTCAAAGACCAGTGGGAGAAGCAGGTCCGAGTGTTGACAGA
GGCCGTGGATGACATCACCTCAGTGGATGACTTCCTCTCTGTCTCAGAAAATCACATCTTGGAGGATGTGAACAAGTGTGTGATAGCCCT
CCAAGAGGGCGATGTGGACACTCTGGACCGGACTGCAGGGGCCATCAGGGGCCGGGCAGCTCGAGTCATACACATCATCAATGCTGAGAT
GGAGAACTATGAAGCTGGGGTTTATACTGAGAAGGTGTTGGAAGCTACAAAATTGCTTTCTGAAACAGTGATGCCACGCTTCGCTGAACA
AGTAGAGGTTGCCATTGAAGCCCTGAGTGCCAACGTTCCTCAACCGTTTGAGGAGAATGAGTTCATCGATGCCTCTCGCCTGGTGTATGA
TGGCGTTCGGGACATCAGAAAGGCTGTGCTGATGATCAGGACCCCAGAAGAACTAGAGGATGATTCTGACTTTGAGCAGGAAGATTATGA
TGTGCGTAGCAGGACAAGTGTTCAGACTGAGGATGACCAGCTCATTGCAGGGCAGAGCGCACGGGCCATCATGGCGCAACTACCGCAGGA
GGAGAAGGCAAAAATAGCTGAGCAGGTGGAGATATTCCATCAAGAGAAAAGCAAGCTGGATGCAGAAGTGGCCAAATGGGACGACAGCGG
CAATGATATCATTGTACTGGCCAAGCAGATGTGTATGATCATGATGGAAATGACAGACTTCACAAGAGGCAAAGGCCCATTGAAAAATAC
ATCTGATGTCATTAATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGCTCGTGCTGTGGCTGATCAGCTGGACAG
TGCCACATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTGAAAGCATCCTATGTGGCCTCAACCAAATACCA
GAAGGTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAA
GCCTGAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAAACACATTTCGCCTGTACAGGCTTTAAGTGAATTCAAAGCAATGGA

>In-frame_HIBCH_ENST00000359678_chr2_191175480_-_CTNNA2_ENST00000541047_chr2_80620336_+_2942nt
CCTGCGAATCCGCCCTAGTCCGTTCTATCCTCCCTCTTCCCGCTCCGCCTCAGCTCGCTCTCCGCCTTCTCCCTGGCCCGGTCCCCGATC
CCTTCCTCTCCCTCAACTATTTCCTCCAGGCGTCGTTCTTGCCCCGCCCTTCCCCGTCGCGTAGCGGAAACGGTCGCTCTGGCTTCCTGG
AGGACTTGTCATCTGTGCCCGGCGGCGCAGGACGGCGGTGGGCGGGGCTCACGCGAGGCGCTGGAACGGTCCGGGAGATTCTCGCTCTGC
TGCTTTAGCTTCGGAGTGTTTGGCGATGGGGCAGCGCGAGATGTGGAGGCTCATGTCGAGGTTTAATGCATTCAAAAGGACTAATACCAT
ACTGCACCATTTGACTGGAAGGAAAGAAAAAGGAGATCCTCTCAACATTGCGATTGATAAGATGACTAAGAAAACAAGAGATCTAAGGAG
ACAGCTTCGGAAAGCAGTGATGGATCACATATCTGACTCTTTCCTGGAAACCAATGTTCCTTTGCTAGTTCTCATTGAGGCTGCAAAGAG
CGGAAATGAAAAGGAAGTGAAAGAATATGCCCAAGTTTTCCGTGAGCATGCCAACAAACTGGTAGAGGTTGCCAATTTGGCCTGTTCCAT
CTCCAACAATGAAGAAGGGGTGAAATTAGTTCGGATGGCAGCCACCCAGATTGACAGCCTGTGTCCCCAGGTCATCAATGCCGCTCTGAC
ACTGGCTGCCCGGCCACAGAGCAAAGTTGCTCAGGATAACATGGACGTCTTCAAAGACCAGTGGGAGAAGCAGGTCCGAGTGTTGACAGA
GGCCGTGGATGACATCACCTCAGTGGATGACTTCCTCTCTGTCTCAGAAAATCACATCTTGGAGGATGTGAACAAGTGTGTGATAGCCCT
CCAAGAGGGCGATGTGGACACTCTGGACCGGACTGCAGGGGCCATCAGGGGCCGGGCAGCTCGAGTCATACACATCATCAATGCTGAGAT
GGAGAACTATGAAGCTGGGGTTTATACTGAGAAGGTGTTGGAAGCTACAAAATTGCTTTCTGAAACAGTGATGCCACGCTTCGCTGAACA
AGTAGAGGTTGCCATTGAAGCCCTGAGTGCCAACGTTCCTCAACCGTTTGAGGAGAATGAGTTCATCGATGCCTCTCGCCTGGTGTATGA
TGGCGTTCGGGACATCAGAAAGGCTGTGCTGATGATCAGGACCCCAGAAGAACTAGAGGATGATTCTGACTTTGAGCAGGAAGATTATGA
TGTGCGTAGCAGGACAAGTGTTCAGACTGAGGATGACCAGCTCATTGCAGGGCAGAGCGCACGGGCCATCATGGCGCAACTACCGCAGGA
GGAGAAGGCAAAAATAGCTGAGCAGGTGGAGATATTCCATCAAGAGAAAAGCAAGCTGGATGCAGAAGTGGCCAAATGGGACGACAGCGG
CAATGATATCATTGTACTGGCCAAGCAGATGTGTATGATCATGATGGAAATGACAGACTTCACAAGAGGCAAAGGCCCATTGAAAAATAC
ATCTGATGTCATTAATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGCTCGTGCTGTGGCTGATCAGTGTCCTGA
TTCAGCATGTAAGCAGGATTTATTAGCCTACCTTCAACGAATTGCCTTGTATTGCCATCAGCTTAATATCTGCAGCAAGGTGAAGGCAGA
AGTGCAGAATCTGGGAGGAGAGCTCATTGTGTCAGGGCTGGACAGTGCCACATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGT
TGTCCTCACGGTGAAAGCATCCTATGTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTG
GAAGATGAAGGCTCCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAA
ACACATTTCGCCTGTACAGGCTTTAAGTGAATTCAAAGCAATGGATTCCTTCTAGGACGATAGGTTTTAACAAGAAAGCTTTTTCTTTCT
TTTCTTTCTTTCTTTTTCTTTTTAATTCCATTTTTGTATGCATACCTGCCAGCTCGTATGCCTCTGGCATGGGGAAATTAAGGGAACAGT
GTCTGTTTGCATGTAAGATGAGATGAGATCAATACTACTGATCCATCTGTAGCCTGGGAAGGAGACAGGACATTCCTGTACTAAGGTGGC
ACAGAGCTGTCCTTTGCAACATTCTCATAAAATTGGGCACAGAGTTCGCATTGGCGCAATATTTATGGGAGTGGGAGGGATGGGGAAAAT
AAACTTAACTCTACAAAAGCAAACTCTAATGCATGCAAGAATCATTAGGTTGGCAGGTATATGCATAAGTGAAAAATCTGGAAGTGTAAT
GGTAGAACATAAAACTTGTATTGCTTCTGTTTCAGTGCAAAAATGTACTAGCCAATACGCTTAAGTGTGTGGCCCATGAATTGAACAATT
TAACCTTGAAGTCTATATCCGTGATATTATGTCGATTTTTAACTGAGGGGAAATTAACTAGTCCAGCCTAAAATGCTTCTTTTAATCTGC
ATTCTGTTTCCTCTTCTAGTTGTGCCATTACTAGTGATCATGTTTTTTTCCCCCCTTTAATGAAAACAATAAACATCTATTTGAGACAAT
TAAAATCCTTCTGGGGGCACTGGAAGCACAATACGGTGACCAATCTTGCTTTCATTTTTTTTTCTTTTTAATTTGAACCATGATTTTGCT
AGAAATAGAAGGCCCAGTGGTGGAATATTAGAGGGAAGGAAACTGACAACGTGTGAAAGTTAGAGGCAAATACATAGGTGTAGCTTGGAG

>In-frame_HIBCH_ENST00000359678_chr2_191175480_-_CTNNA2_ENST00000343114_chr2_80620336_+_2943nt
CCTGCGAATCCGCCCTAGTCCGTTCTATCCTCCCTCTTCCCGCTCCGCCTCAGCTCGCTCTCCGCCTTCTCCCTGGCCCGGTCCCCGATC
CCTTCCTCTCCCTCAACTATTTCCTCCAGGCGTCGTTCTTGCCCCGCCCTTCCCCGTCGCGTAGCGGAAACGGTCGCTCTGGCTTCCTGG
AGGACTTGTCATCTGTGCCCGGCGGCGCAGGACGGCGGTGGGCGGGGCTCACGCGAGGCGCTGGAACGGTCCGGGAGATTCTCGCTCTGC
TGCTTTAGCTTCGGAGTGTTTGGCGATGGGGCAGCGCGAGATGTGGAGGCTCATGTCGAGGTTTAATGCATTCAAAAGGACTAATACCAT
ACTGCACCATTTGACTGGAAGGAAAGAAAAAGGAGATCCTCTCAACATTGCGATTGATAAGATGACTAAGAAAACAAGAGATCTAAGGAG
ACAGCTTCGGAAAGCAGTGATGGATCACATATCTGACTCTTTCCTGGAAACCAATGTTCCTTTGCTAGTTCTCATTGAGGCTGCAAAGAG
CGGAAATGAAAAGGAAGTGAAAGAATATGCCCAAGTTTTCCGTGAGCATGCCAACAAACTGGTAGAGGTTGCCAATTTGGCCTGTTCCAT
CTCCAACAATGAAGAAGGGGTGAAATTAGTTCGGATGGCAGCCACCCAGATTGACAGCCTGTGTCCCCAGGTCATCAATGCCGCTCTGAC
ACTGGCTGCCCGGCCACAGAGCAAAGTTGCTCAGGATAACATGGACGTCTTCAAAGACCAGTGGGAGAAGCAGGTCCGAGTGTTGACAGA
GGCCGTGGATGACATCACCTCAGTGGATGACTTCCTCTCTGTCTCAGAAAATCACATCTTGGAGGATGTGAACAAGTGTGTGATAGCCCT
CCAAGAGGGCGATGTGGACACTCTGGACCGGACTGCAGGGGCCATCAGGGGCCGGGCAGCTCGAGTCATACACATCATCAATGCTGAGAT
GGAGAACTATGAAGCTGGGGTTTATACTGAGAAGGTGTTGGAAGCTACAAAATTGCTTTCTGAAACAGTGATGCCACGCTTCGCTGAACA
AGTAGAGGTTGCCATTGAAGCCCTGAGTGCCAACGTTCCTCAACCGTTTGAGGAGAATGAGTTCATCGATGCCTCTCGCCTGGTGTATGA
TGGCGTTCGGGACATCAGAAAGGCTGTGCTGATGATCAGGACCCCAGAAGAACTAGAGGATGATTCTGACTTTGAGCAGGAAGATTATGA
TGTGCGTAGCAGGACAAGTGTTCAGACTGAGGATGACCAGCTCATTGCAGGGCAGAGCGCACGGGCCATCATGGCGCAACTACCGCAGGA
GGAGAAGGCAAAAATAGCTGAGCAGGTGGAGATATTCCATCAAGAGAAAAGCAAGCTGGATGCAGAAGTGGCCAAATGGGACGACAGCGG
CAATGATATCATTGTACTGGCCAAGCAGATGTGTATGATCATGATGGAAATGACAGACTTCACAAGAGGCAAAGGCCCATTGAAAAATAC
ATCTGATGTCATTAATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGCTCGTGCTGTGGCTGATCAGTGTCCTGA
TTCAGCATGTAAGCAGGATTTATTAGCCTACCTTCAACGAATTGCCTTGTATTGCCATCAGCTTAATATCTGCAGCAAGGTGAAGGCAGA
AGTGCAGAATCTGGGAGGAGAGCTCATTGTGTCAGGGCTGGACAGTGCCACATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGT
TGTCCTCACGGTGAAAGCATCCTATGTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTG
GAAGATGAAGGCTCCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAA
ACACATTTCGCCTGTACAGGCTTTAAGTGAATTCAAAGCAATGGATTCCTTCTAGGACGATAGGTTTTAACAAGAAAGCTTTTTCTTTCT
TTTCTTTCTTTCTTTTTCTTTTTAATTCCATTTTTGTATGCATACCTGCCAGCTCGTATGCCTCTGGCATGGGGAAATTAAGGGAACAGT
GTCTGTTTGCATGTAAGATGAGATGAGATCAATACTACTGATCCATCTGTAGCCTGGGAAGGAGACAGGACATTCCTGTACTAAGGTGGC
ACAGAGCTGTCCTTTGCAACATTCTCATAAAATTGGGCACAGAGTTCGCATTGGCGCAATATTTATGGGAGTGGGAGGGATGGGGAAAAT
AAACTTAACTCTACAAAAGCAAACTCTAATGCATGCAAGAATCATTAGGTTGGCAGGTATATGCATAAGTGAAAAATCTGGAAGTGTAAT
GGTAGAACATAAAACTTGTATTGCTTCTGTTTCAGTGCAAAAATGTACTAGCCAATACGCTTAAGTGTGTGGCCCATGAATTGAACAATT
TAACCTTGAAGTCTATATCCGTGATATTATGTCGATTTTTAACTGAGGGGAAATTAACTAGTCCAGCCTAAAATGCTTCTTTTAATCTGC
ATTCTGTTTCCTCTTCTAGTTGTGCCATTACTAGTGATCATGTTTTTTTCCCCCCTTTAATGAAAACAATAAACATCTATTTGAGACAAT
TAAAATCCTTCTGGGGGCACTGGAAGCACAATACGGTGACCAATCTTGCTTTCATTTTTTTTTCTTTTTAATTTGAACCATGATTTTGCT
AGAAATAGAAGGCCCAGTGGTGGAATATTAGAGGGAAGGAAACTGACAACGTGTGAAAGTTAGAGGCAAATACATAGGTGTAGCTTGGAG


Top

FusionGenePPI for HIBCH_CTNNA2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
HIBCHH2AFX, ACOT1, IRF2BPL, ACADVL, KIAA0391, MKRN2, OXLD1, ACOT9, ALDH6A1, CAB39, CLIC1, CLIC4, CLIC5, ACADM, ALDH7A1, C12orf10, DSTN, ECI1, FH, NEDD8, PPA2, PSME3, SOD1, HNRNPH1, HNRNPH2, LSM12, NME2, NME1-NME2, PRCP, UFM1, UMPS, TMEM184A, GATC, GTF2E2, SOX2CTNNA2PAN2, PPP2R1A, FBXW11, CD27, UTP3, SAPCD1, CTNNB1, JUP, NTRK1, SDHAF2, GAN, MCM2, EGFR, CDH1, CDH8, CDH5, CTNNBIP1, DUSP22, FBXL5, CIR1, G3BP1, UBE2A, TES


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for HIBCH_CTNNA2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for HIBCH_CTNNA2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneHIBCHC0029408Degenerative polyarthritis1CTD_human
HgeneHIBCHC0342738Beta-Hydroxyisobutyryl CoA Deacylase Deficiency1CTD_human;ORPHANET;UNIPROT
TgeneCTNNA2C0001973Alcoholic Intoxication, Chronic1PSYGENET
TgeneCTNNA2C0036341Schizophrenia1PSYGENET
TgeneCTNNA2C0038356Stomach Neoplasms1CTD_human