FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 15891

FusionGeneSummary for HCFC1_EPHA5

check button Fusion gene summary
Fusion gene informationFusion gene name: HCFC1_EPHA5
Fusion gene ID: 15891
HgeneTgene
Gene symbol

HCFC1

EPHA5

Gene ID

3054

2044

Gene namehost cell factor C1EPH receptor A5
SynonymsCFF|HCF|HCF-1|HCF1|HFC1|MRX3|PPP1R89|VCAFCEK7|EHK-1|EHK1|EK7|HEK7|TYRO4
Cytomap

Xq28

4q13.1-q13.2

Type of geneprotein-codingprotein-coding
Descriptionhost cell factor 1VP16-accessory proteinprotein phosphatase 1, regulatory subunit 89ephrin type-A receptor 5EPH homology kinase 1EPH-like kinase 7brain-specific kinasereceptor protein-tyrosine kinase HEK7tyrosine-protein kinase receptor EHK-1
Modification date2018052220180523
UniProtAcc

P51610

P54756

Ensembl transtripts involved in fusion geneENST00000310441, ENST00000369984, 
ENST00000354233, ENST00000461098, 
ENST00000273854, ENST00000432638, 
ENST00000354839, ENST00000511294, 
Fusion gene scores* DoF score6 X 7 X 4=1684 X 3 X 3=36
# samples 76
** MAII scorelog2(7/168*10)=-1.26303440583379
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(6/36*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: HCFC1 [Title/Abstract] AND EPHA5 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneHCFC1

GO:0006355

regulation of transcription, DNA-templated

12670868

HgeneHCFC1

GO:0010628

positive regulation of gene expression

21285374

HgeneHCFC1

GO:0043254

regulation of protein complex assembly

10675337

HgeneHCFC1

GO:0043981

histone H4-K5 acetylation

20018852

HgeneHCFC1

GO:0043982

histone H4-K8 acetylation

20018852

HgeneHCFC1

GO:0043984

histone H4-K16 acetylation

20018852

HgeneHCFC1

GO:0050821

protein stabilization

21285374


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLUSCTCGA-LA-A446-01AHCFC1chrX

153236099

-EPHA5chr4

66189937

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000310441ENST00000273854HCFC1chrX

153236099

-EPHA5chr4

66189937

-
Frame-shitENST00000310441ENST00000432638HCFC1chrX

153236099

-EPHA5chr4

66189937

-
In-frameENST00000310441ENST00000354839HCFC1chrX

153236099

-EPHA5chr4

66189937

-
5CDS-intronENST00000310441ENST00000511294HCFC1chrX

153236099

-EPHA5chr4

66189937

-
In-frameENST00000369984ENST00000273854HCFC1chrX

153236099

-EPHA5chr4

66189937

-
Frame-shitENST00000369984ENST00000432638HCFC1chrX

153236099

-EPHA5chr4

66189937

-
In-frameENST00000369984ENST00000354839HCFC1chrX

153236099

-EPHA5chr4

66189937

-
5CDS-intronENST00000369984ENST00000511294HCFC1chrX

153236099

-EPHA5chr4

66189937

-
In-frameENST00000354233ENST00000273854HCFC1chrX

153236099

-EPHA5chr4

66189937

-
Frame-shitENST00000354233ENST00000432638HCFC1chrX

153236099

-EPHA5chr4

66189937

-
In-frameENST00000354233ENST00000354839HCFC1chrX

153236099

-EPHA5chr4

66189937

-
5CDS-intronENST00000354233ENST00000511294HCFC1chrX

153236099

-EPHA5chr4

66189937

-
intron-3CDSENST00000461098ENST00000273854HCFC1chrX

153236099

-EPHA5chr4

66189937

-
intron-3CDSENST00000461098ENST00000432638HCFC1chrX

153236099

-EPHA5chr4

66189937

-
intron-3CDSENST00000461098ENST00000354839HCFC1chrX

153236099

-EPHA5chr4

66189937

-
intron-intronENST00000461098ENST00000511294HCFC1chrX

153236099

-EPHA5chr4

66189937

-

Top

FusionProtFeatures for HCFC1_EPHA5


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
HCFC1

P51610

EPHA5

P54756

Involved in control of the cell cycle (PubMed:10629049,PubMed:10779346, PubMed:15190068, PubMed:16624878,PubMed:23629655). Also antagonizes transactivation by ZBTB17 andGABP2; represses ZBTB17 activation of the p15(INK4b) promoter andinhibits its ability to recruit p300 (PubMed:10675337,PubMed:12244100). Coactivator for EGR2 and GABP2 (PubMed:12244100,PubMed:14532282). Tethers the chromatin modifying Set1/Ash2histone H3 'Lys-4' methyltransferase (H3K4me) and Sin3 histonedeacetylase (HDAC) complexes (involved in the activation andrepression of transcription, respectively) together(PubMed:12670868). Component of a THAP1/THAP3-HCFC1-OGT complexthat is required for the regulation of the transcriptionalactivity of RRM1 (PubMed:20200153). As part of the NSL complex itmay be involved in acetylation of nucleosomal histone H4 onseveral lysine residues (PubMed:20018852). Recruits KMT2E/MLL5 toE2F1 responsive promoters promoting transcriptional activation andthereby facilitates G1 to S phase transition (PubMed:23629655).{ECO:0000269|PubMed:10629049, ECO:0000269|PubMed:10675337,ECO:0000269|PubMed:10779346, ECO:0000269|PubMed:12244100,ECO:0000269|PubMed:12670868, ECO:0000269|PubMed:14532282,ECO:0000269|PubMed:15190068, ECO:0000269|PubMed:16624878,ECO:0000269|PubMed:20018852, ECO:0000269|PubMed:20200153,ECO:0000269|PubMed:23629655}. (Microbial infection) In case of human herpes simplexvirus (HSV) infection, HCFC1 forms a multiprotein-DNA complex withthe viral transactivator protein VP16 and POU2F1 thereby enablingthe transcription of the viral immediate early genes.{ECO:0000269|PubMed:10629049, ECO:0000269|PubMed:17578910}. Receptor tyrosine kinase which binds promiscuously GPI-anchored ephrin-A family ligands residing on adjacent cells,leading to contact-dependent bidirectional signaling intoneighboring cells. The signaling pathway downstream of thereceptor is referred to as forward signaling while the signalingpathway downstream of the ephrin ligand is referred to as reversesignaling. Among GPI-anchored ephrin-A ligands, EFNA5 mostprobably constitutes the cognate/functional ligand for EPHA5.Functions as an axon guidance molecule during development and maybe involved in the development of the retinotectal, entorhino-hippocampal and hippocamposeptal pathways. Together with EFNA5plays also a role in synaptic plasticity in adult brain throughregulation of synaptogenesis. In addition to its function in thenervous system, the interaction of EPHA5 with EFNA5 mediatescommunication between pancreatic islet cells to regulate glucose-stimulated insulin secretion (By similarity). {ECO:0000250}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneEPHA5chrX:153236099chr4:66189937ENST00000273854-16181035_103710021038MotifPDZ-binding
TgeneEPHA5chrX:153236099chr4:66189937ENST00000354839-15171035_10379801016MotifPDZ-binding

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneHCFC1chrX:153236099chr4:66189937ENST00000310441-1261797_1888642036DomainFibronectin type-III 2
HgeneHCFC1chrX:153236099chr4:66189937ENST00000310441-1261890_2006642036DomainFibronectin type-III 3
HgeneHCFC1chrX:153236099chr4:66189937ENST00000310441-126366_466642036DomainFibronectin type-III 1
HgeneHCFC1chrX:153236099chr4:66189937ENST00000354233-1271797_1888641967DomainFibronectin type-III 2
HgeneHCFC1chrX:153236099chr4:66189937ENST00000354233-1271890_2006641967DomainFibronectin type-III 3
HgeneHCFC1chrX:153236099chr4:66189937ENST00000354233-127366_466641967DomainFibronectin type-III 1
HgeneHCFC1chrX:153236099chr4:66189937ENST00000310441-1261010_1035642036RepeatNote=HCF repeat 1
HgeneHCFC1chrX:153236099chr4:66189937ENST00000310441-1261072_1097642036RepeatNote=HCF repeat 2
HgeneHCFC1chrX:153236099chr4:66189937ENST00000310441-1261101_1126642036RepeatNote=HCF repeat 3
HgeneHCFC1chrX:153236099chr4:66189937ENST00000310441-1261158_1183642036RepeatNote=HCF repeat 4%3B degenerate
HgeneHCFC1chrX:153236099chr4:66189937ENST00000310441-1261286_1311642036RepeatNote=HCF repeat 5
HgeneHCFC1chrX:153236099chr4:66189937ENST00000310441-1261314_1339642036RepeatNote=HCF repeat 6
HgeneHCFC1chrX:153236099chr4:66189937ENST00000310441-1261349_1374642036RepeatNote=HCF repeat 7%3B degenerate
HgeneHCFC1chrX:153236099chr4:66189937ENST00000310441-1261414_1439642036RepeatNote=HCF repeat 8
HgeneHCFC1chrX:153236099chr4:66189937ENST00000310441-126148_194642036RepeatNote=Kelch 3
HgeneHCFC1chrX:153236099chr4:66189937ENST00000310441-126217_265642036RepeatNote=Kelch 4
HgeneHCFC1chrX:153236099chr4:66189937ENST00000310441-126266_313642036RepeatNote=Kelch 5
HgeneHCFC1chrX:153236099chr4:66189937ENST00000310441-12644_89642036RepeatNote=Kelch 1
HgeneHCFC1chrX:153236099chr4:66189937ENST00000310441-12693_140642036RepeatNote=Kelch 2
HgeneHCFC1chrX:153236099chr4:66189937ENST00000354233-1271010_1035641967RepeatNote=HCF repeat 1
HgeneHCFC1chrX:153236099chr4:66189937ENST00000354233-1271072_1097641967RepeatNote=HCF repeat 2
HgeneHCFC1chrX:153236099chr4:66189937ENST00000354233-1271101_1126641967RepeatNote=HCF repeat 3
HgeneHCFC1chrX:153236099chr4:66189937ENST00000354233-1271158_1183641967RepeatNote=HCF repeat 4%3B degenerate
HgeneHCFC1chrX:153236099chr4:66189937ENST00000354233-1271286_1311641967RepeatNote=HCF repeat 5
HgeneHCFC1chrX:153236099chr4:66189937ENST00000354233-1271314_1339641967RepeatNote=HCF repeat 6
HgeneHCFC1chrX:153236099chr4:66189937ENST00000354233-1271349_1374641967RepeatNote=HCF repeat 7%3B degenerate
HgeneHCFC1chrX:153236099chr4:66189937ENST00000354233-1271414_1439641967RepeatNote=HCF repeat 8
HgeneHCFC1chrX:153236099chr4:66189937ENST00000354233-127148_194641967RepeatNote=Kelch 3
HgeneHCFC1chrX:153236099chr4:66189937ENST00000354233-127217_265641967RepeatNote=Kelch 4
HgeneHCFC1chrX:153236099chr4:66189937ENST00000354233-127266_313641967RepeatNote=Kelch 5
HgeneHCFC1chrX:153236099chr4:66189937ENST00000354233-12744_89641967RepeatNote=Kelch 1
HgeneHCFC1chrX:153236099chr4:66189937ENST00000354233-12793_140641967RepeatNote=Kelch 2
TgeneEPHA5chrX:153236099chr4:66189937ENST00000273854-1618220_35410021038Compositional biasNote=Cys-rich
TgeneEPHA5chrX:153236099chr4:66189937ENST00000354839-1517220_3549801016Compositional biasNote=Cys-rich
TgeneEPHA5chrX:153236099chr4:66189937ENST00000273854-1618357_46710021038DomainFibronectin type-III 1
TgeneEPHA5chrX:153236099chr4:66189937ENST00000273854-1618468_56210021038DomainFibronectin type-III 2
TgeneEPHA5chrX:153236099chr4:66189937ENST00000273854-161860_23810021038DomainEph LBD
TgeneEPHA5chrX:153236099chr4:66189937ENST00000273854-1618675_93610021038DomainProtein kinase
TgeneEPHA5chrX:153236099chr4:66189937ENST00000273854-1618965_102910021038DomainSAM
TgeneEPHA5chrX:153236099chr4:66189937ENST00000354839-1517357_4679801016DomainFibronectin type-III 1
TgeneEPHA5chrX:153236099chr4:66189937ENST00000354839-1517468_5629801016DomainFibronectin type-III 2
TgeneEPHA5chrX:153236099chr4:66189937ENST00000354839-151760_2389801016DomainEph LBD
TgeneEPHA5chrX:153236099chr4:66189937ENST00000354839-1517675_9369801016DomainProtein kinase
TgeneEPHA5chrX:153236099chr4:66189937ENST00000354839-1517965_10299801016DomainSAM
TgeneEPHA5chrX:153236099chr4:66189937ENST00000273854-1618681_68910021038Nucleotide bindingATP
TgeneEPHA5chrX:153236099chr4:66189937ENST00000354839-1517681_6899801016Nucleotide bindingATP
TgeneEPHA5chrX:153236099chr4:66189937ENST00000273854-161825_57310021038Topological domainExtracellular
TgeneEPHA5chrX:153236099chr4:66189937ENST00000273854-1618595_103710021038Topological domainCytoplasmic
TgeneEPHA5chrX:153236099chr4:66189937ENST00000354839-151725_5739801016Topological domainExtracellular
TgeneEPHA5chrX:153236099chr4:66189937ENST00000354839-1517595_10379801016Topological domainCytoplasmic
TgeneEPHA5chrX:153236099chr4:66189937ENST00000273854-1618574_59410021038TransmembraneHelical
TgeneEPHA5chrX:153236099chr4:66189937ENST00000354839-1517574_5949801016TransmembraneHelical


Top

FusionGeneSequence for HCFC1_EPHA5


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_HCFC1_ENST00000310441_chrX_153236099_-_EPHA5_ENST00000273854_chr4_66189937_-_99aa
MASAVSPANLPAVLLQPRWKRVVGWSGPVPRPRHGHRAVAIKELIVVFGGGNEGIVDELHVYNTGI_DGLE_LLSVTRRRS_TAFKK_RC

>In-frame_HCFC1_ENST00000310441_chrX_153236099_-_EPHA5_ENST00000354839_chr4_66189937_-_99aa
MASAVSPANLPAVLLQPRWKRVVGWSGPVPRPRHGHRAVAIKELIVVFGGGNEGIVDELHVYNTGI_DGLE_LLSVTRRRS_TAFKK_RC

>In-frame_HCFC1_ENST00000369984_chrX_153236099_-_EPHA5_ENST00000273854_chr4_66189937_-_99aa
MASAVSPANLPAVLLQPRWKRVVGWSGPVPRPRHGHRAVAIKELIVVFGGGNEGIVDELHVYNTGI_DGLE_LLSVTRRRS_TAFKK_RC

>In-frame_HCFC1_ENST00000369984_chrX_153236099_-_EPHA5_ENST00000354839_chr4_66189937_-_99aa
MASAVSPANLPAVLLQPRWKRVVGWSGPVPRPRHGHRAVAIKELIVVFGGGNEGIVDELHVYNTGI_DGLE_LLSVTRRRS_TAFKK_RC

>In-frame_HCFC1_ENST00000354233_chrX_153236099_-_EPHA5_ENST00000273854_chr4_66189937_-_99aa
MASAVSPANLPAVLLQPRWKRVVGWSGPVPRPRHGHRAVAIKELIVVFGGGNEGIVDELHVYNTGI_DGLE_LLSVTRRRS_TAFKK_RC

>In-frame_HCFC1_ENST00000354233_chrX_153236099_-_EPHA5_ENST00000354839_chr4_66189937_-_99aa
MASAVSPANLPAVLLQPRWKRVVGWSGPVPRPRHGHRAVAIKELIVVFGGGNEGIVDELHVYNTGI_DGLE_LLSVTRRRS_TAFKK_RC


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_HCFC1_ENST00000310441_chrX_153236099_-_EPHA5_ENST00000273854_chr4_66189937_-_299nt
ATGGCTTCGGCCGTGTCGCCCGCCAACTTGCCAGCGGTGCTTCTGCAGCCCCGCTGGAAGCGAGTGGTGGGCTGGTCGGGTCCGGTGCCA
CGGCCCCGCCACGGCCACCGCGCCGTGGCCATCAAGGAGCTCATCGTGGTGTTTGGCGGCGGCAACGAGGGAATAGTGGACGAACTGCAC
GTGTACAACACGGGGATTTGAGACGGCTTGGAGTGACTCTTGTCGGTCACCAGAAGAAGATCATGAACAGCCTTCAAGAAATGAAGGTGC

>In-frame_HCFC1_ENST00000310441_chrX_153236099_-_EPHA5_ENST00000354839_chr4_66189937_-_299nt
ATGGCTTCGGCCGTGTCGCCCGCCAACTTGCCAGCGGTGCTTCTGCAGCCCCGCTGGAAGCGAGTGGTGGGCTGGTCGGGTCCGGTGCCA
CGGCCCCGCCACGGCCACCGCGCCGTGGCCATCAAGGAGCTCATCGTGGTGTTTGGCGGCGGCAACGAGGGAATAGTGGACGAACTGCAC
GTGTACAACACGGGGATTTGAGACGGCTTGGAGTGACTCTTGTCGGTCACCAGAAGAAGATCATGAACAGCCTTCAAGAAATGAAGGTGC

>In-frame_HCFC1_ENST00000369984_chrX_153236099_-_EPHA5_ENST00000273854_chr4_66189937_-_299nt
ATGGCTTCGGCCGTGTCGCCCGCCAACTTGCCAGCGGTGCTTCTGCAGCCCCGCTGGAAGCGAGTGGTGGGCTGGTCGGGTCCGGTGCCA
CGGCCCCGCCACGGCCACCGCGCCGTGGCCATCAAGGAGCTCATCGTGGTGTTTGGCGGCGGCAACGAGGGAATAGTGGACGAACTGCAC
GTGTACAACACGGGGATTTGAGACGGCTTGGAGTGACTCTTGTCGGTCACCAGAAGAAGATCATGAACAGCCTTCAAGAAATGAAGGTGC

>In-frame_HCFC1_ENST00000369984_chrX_153236099_-_EPHA5_ENST00000354839_chr4_66189937_-_299nt
ATGGCTTCGGCCGTGTCGCCCGCCAACTTGCCAGCGGTGCTTCTGCAGCCCCGCTGGAAGCGAGTGGTGGGCTGGTCGGGTCCGGTGCCA
CGGCCCCGCCACGGCCACCGCGCCGTGGCCATCAAGGAGCTCATCGTGGTGTTTGGCGGCGGCAACGAGGGAATAGTGGACGAACTGCAC
GTGTACAACACGGGGATTTGAGACGGCTTGGAGTGACTCTTGTCGGTCACCAGAAGAAGATCATGAACAGCCTTCAAGAAATGAAGGTGC

>In-frame_HCFC1_ENST00000354233_chrX_153236099_-_EPHA5_ENST00000273854_chr4_66189937_-_299nt
ATGGCTTCGGCCGTGTCGCCCGCCAACTTGCCAGCGGTGCTTCTGCAGCCCCGCTGGAAGCGAGTGGTGGGCTGGTCGGGTCCGGTGCCA
CGGCCCCGCCACGGCCACCGCGCCGTGGCCATCAAGGAGCTCATCGTGGTGTTTGGCGGCGGCAACGAGGGAATAGTGGACGAACTGCAC
GTGTACAACACGGGGATTTGAGACGGCTTGGAGTGACTCTTGTCGGTCACCAGAAGAAGATCATGAACAGCCTTCAAGAAATGAAGGTGC

>In-frame_HCFC1_ENST00000354233_chrX_153236099_-_EPHA5_ENST00000354839_chr4_66189937_-_299nt
ATGGCTTCGGCCGTGTCGCCCGCCAACTTGCCAGCGGTGCTTCTGCAGCCCCGCTGGAAGCGAGTGGTGGGCTGGTCGGGTCCGGTGCCA
CGGCCCCGCCACGGCCACCGCGCCGTGGCCATCAAGGAGCTCATCGTGGTGTTTGGCGGCGGCAACGAGGGAATAGTGGACGAACTGCAC
GTGTACAACACGGGGATTTGAGACGGCTTGGAGTGACTCTTGTCGGTCACCAGAAGAAGATCATGAACAGCCTTCAAGAAATGAAGGTGC


* Fusion transcript sequences (Full-length transcript).
>In-frame_HCFC1_ENST00000310441_chrX_153236099_-_EPHA5_ENST00000273854_chr4_66189937_-_5817nt
CGGCTCCCAGGGAGGAGGCATGAGCGCCCTGCCGTTACCGCTTCTTCTGCCGTACAGTTGCCGCTTCGGGGCCTAACTCTAGCTCTTTGA
AGCGGCTCCTGTGGGAAGGAGTCATAAGGCGGGAAGTGAGGATCGGACACCGCCTTGAGTTTGGTGTGCAGTGGAAGAACTGACCTAGGA
GGAAGAGAATAGGGGGGAACGGGGAGCTAGTCTCAAGATGGCGGCTCCCACGGCGGCAGGCGCAGCCTGAGCAGCAGAGGCGGACTAAGG
GGAGAGGCGCGAGACTTCACAAGCCGTACGGCGCGAGCCCCCAAACGGCCCTCGAGAGCTCGAGCTGGTTCCACCGGCCTCCGGCCCGCC
TCCATTCGTTAGGTGTGTCGAGGCTGTTTCGGGAGCGGCGGCTGCACTAAGGCGCTGGGCGGGGAAGCGGGACGGTCTCAAGATGGCGGC
TCCCACAATTGTGGTCTGAGCGCCGGCGGGGCTGCGACGACCGCGGCGCTTGTGGCTCCTTTCCACCCGCCCCGGAAGCCGGCCAGTGCT
GGGGACTTGGGGGTGTGGGAACCGGGCCGGGGCTCCGCCATTTCCGGCGGGGGAGGGCTACGACTGAGGAAGGGAGGAGAGAGAGGCGGC
TCAAGATGGCGGCTCCCAGGGCCTCCCGCCCGAGCTTGTAAGCGGGAGCGCCCGGACAAGTAGTCGGGGCGACGGGACTCAGCGGCCTCC
AGCTTCTTGAGCCTAGGCGCTCGACAGTTTCGGGCGGCTCTTGCGGAGACGGGGTGAGCGAGAAGAAAGGGAAGAGCCAAAGGGAAGGAG
GGCAGTTAAGATGGCGGCCTCCATGGAGTCGTCTACCGCTGTGTGAGAAACCGCTTCTCCGTGAGAGCTGCCTTAGACGAAAGGGGGTGT
GTGAAAGGAATTGAGGGGCTCCCTTCCCGCTTGTTGACTTCTCCCCACCGCACCCTTTCCCGGAACTATGGCTTCGGCCGTGTCGCCCGC
CAACTTGCCAGCGGTGCTTCTGCAGCCCCGCTGGAAGCGAGTGGTGGGCTGGTCGGGTCCGGTGCCACGGCCCCGCCACGGCCACCGCGC
CGTGGCCATCAAGGAGCTCATCGTGGTGTTTGGCGGCGGCAACGAGGGAATAGTGGACGAACTGCACGTGTACAACACGGGGATTTGAGA
CGGCTTGGAGTGACTCTTGTCGGTCACCAGAAGAAGATCATGAACAGCCTTCAAGAAATGAAGGTGCAGCTGGTAAACGGAATGGTGCCA
TTGTAACTTCATGTAAATGTCGCTTCTTCAAGTGAATGATTCTGCACTTTGTAAACAGCACTGAGATTTATTTTAACAAAAAAAGGGGGA
AAAGGGAAAACAGTGATTTCTAAACCTTAGAAAACATTTGCCTCAGCCACAGAATTTGTAATCATGGTTTTACTGAAGTATCCAGTTCTT
AGTCCTTAGTCTTCATTTTTCATGAAGCAAACATATCTTGCATTAAAAGGGACATGAAGTTAGACATCATCTTAAGTTACAACAACAGAA
TCCTTCCCACTACTTCTACAAAATTTTGTACATGAAATATATAATTATATAGCACTTTTATAGACTGAATTAAGGCAACCCCTTTCAAAA
CTTCCAGGGATCTACTTGAAAGGAAATGTTTTATAGCCATTTGTGAGCTAACAAAAGCTACAGTTTACTGAAGTTTACTTCAAGTCTTAA
TTGTCTACAAAAGTGTATTGAAGAGCAATATGATTAGATTATTTCTTAATAGATATCTTCTTTTGTAATTTTAAAATGCTGTTACACAGC
GTTAAGTTATAGAAACTAGTGTGTAAACATGTTGCTTGATCAAGAAAAAGTACAATACAGGGTGTATATTTATTTTTTGTGTTATAAAGT
TTACTTTTAGTTGCTCTTCTAGAGATTATTAGGTAATAAATGTGTATATACTGTATAATTTGCAATATACCCAGGAACTGATTTAAGATG
GAATTGTGTGTGTGTTTGCTTGCACATGTGTGTGTTACCATTCTGCTTGCATTTCTAATAGTGTTTCAATTTTAGCAACATATAGGAGCA
AGTGTTCCAGAATGTAATATGAATAGGAGAAATAGGGAAGCAGTAAAACAAAATTTAACACAAGCTTGTGTCTCTTTTCCTCTCATGTGT
CCAAAAGCTAATCTCTTTATTCACTAAAAGGAAATGTGTATAAGACTAAATCCCCTTTGGCTTTTTAAAAACATTTTGTGATATCAGTGA
CAATGCAGTTCTTCTAGCCATTAATCTTGTACCCCTGTAAGAAATTTCACCTTTCTGAGTCCTGAAAAGTATCTTGTCAAGCAAAGTTGA
CACCGAAGGGCACATTTTCAGCAGGATGTAGAAGGATTTAACTGTGCAGGCTTCTGTTAATGTTGTTAAATCCAGGCACATAGCACGAAG
CATCACCCTTAAGTGTTAATCCGTTGTAACCATTCCCATTTTGACTCAGTTCTAGAAATTTTGACTCTAAGGCAGCAATGGAATTATGAC
AAATATATATATATACACATACACACACACAAATATATATATATGCTTATTTCCCTTCAGAATTTTATTTCAATAATTGATAAGTTTTAT
TTTTAATGGATGTTTATTCATTTGTTAATTTCAGTTTGTATTCAGTTACATGGCTTTGAGTTTATTTTATTGAACCAATCCAAGGTATTA
TGTAATTAGGCTTATTAAGGAATATAACATATCTTCTATGTATGCTCTATATACCACACATGATGAAGACTTATATTTGTGATACAAATT
ATGCAGTGTATTAGAAATTGTCCAAAACTGAGCTCCTGAGATAACCAACATTTTTGTATTATTACACTTTATAAAAATTATGGAATGTCA
TGTGATTAGTCAAAATCAGAGCATTTAAATAAAATACAGCCTACTCATGATTATCAATGTTAATAGTACAGTAGATCAGAGAAGCCTGGA
TTAATGAAATTTATCAGAAATATAGCCACGTTATATTAATGGTATTCTTTTTTCCAAGCACTTGTTTTATTTGAATATTAGCACATATAA
GAATAAACTTTTGGGAAATAACTACTTCCTATTCTGCCCACCCTTTACTTAAGCAGTAAAGTACCTCTTTTCTAAAGAACCAGGAAACAT
CAAAATAACCACAACAAAAATCTAAACAGTTTTCAAATAATACATTCAGTTCTCATAATAATAAGGGCTATATACCATGGGTCCACACAA
ACTGTGCTGCAAACATATAATCTATTAGTTTAGTAAAATTTCCAGAGATGTGAATTTAATATTTTCTTGATAAAATCATAAAAAAGCATC
ACCATTATTAAAGATGCATTTGTTCATTTCAATAAACAGAAATTAATGAAACAAATTACTTTTGTACAAAATAAATGATGATTATGTGGC
ACTTTATTGAATTTTATAGAAATATTCCAATCTAAGTGATAAAGTAACAACTGAGAAACTTCAGAATGAAAGCCTTATTGATTCAAAAGG
AAAATTACCATATGCTTTAGGGCTGATGAACTTGCCACAATTGCTTAGACATAACAAAGATATTTTCTACATTGTTTTCCAACTTTATAT
GCTGAAAGATAATTAGGAGGTCCGGGTGGAGTGTATCTAAATGACTAGAACTTTAAGTTGCAATATAGATTTTCTCTTTTTAACAAAGGA
AGAATATAAATTAATTTGGATCAAATTTATTTGCCTTCTTTGCAATCTTGGTGATCATTTTGGAAAGTAAATTGAAAGGAAAGTTAAATA
GCCACATAGTTTTCTTTTGCATCTCAATTTGGTTGAGAATTTCTAAGGAAGGTTAATATGACTTTAGAATGAATAAAGAGACTGTCAAAC
AACAAGTACTCTCCCTAAAAAAGAGGAAAGAATGCCTTCCTAAAATATTTGTTTCCTATTGTATATGTCACCAATTGGAAAATGCCAATC
TCATCTGCAAGTGTGAGAAATGGAACAAGGAGAGGAGCCAACTCTAGTAAAATGTAGTGAGGCCATAATCCAAGGCAAAGTTTAACAAAT
CTTGATTGTGTAATTTCTTATTCTGTTGATTCATTTTGTCACCCACCAGACTACCAAAAATAAAGCACAGACATGACAATTTTAGTATAT
ACAACAGATTTGGCAAATAATACATAATCTTATTGTAATTGCCAGTAGCAATATCTTAAGGGGCATGAGTCTTTCACAGTATTGGACTTT
GAAAAATTGGTACAGGGAGTAATTTTCAACAGACTGATACTTGAAGTCACTCAATTACTACTTTGACCTATCATAATTTGTTTCTAATCT
TGTCATTTGCTCATATATACTATTAATATAACCAGTTGCTCTTTTCATAATGTACTATTTCTATGTAAAGATGTAAAGATTTTGATTTTC
CTATGTTTTAAAATTGTAATGTGCATGATCTTTTATTTCTTGTGTTTCAATTACCAAGTCAGTATTCTAAGGTTGTAAGATTACTGTAAA
AATTATATTCCAATATTTTATCTAAACTTAAGTGTGGCCAGCATTATTGGTTTCAGAGTTGCCTAAACAACACAGAATATCCTTAATTCA
GTTTGTAAAAGAGTTTTGACCAGTGTAAAAAAGTGAAGACACAGTTTCATGTTTCAAGTTTAAAATGGAAAGTTAATATCATTTGAGCAC
TTATGTGTTTTCATGTCTTCTACTTAATCTGTATGTGAAAGTAAAATATTTTTAACACCATTATTTATGCCATGTAAAGTGGGTTCTCAG
AAGCACAAGCACAGATATTTACCTTCTGAAGACATTTTTGGCTATAAAAGTGCATTGGATGGCAAACACTATTTGAGTCAGGTGTTAGAA
ATTTATTAGATGTATTATATTACATAGTAGAATAAGGTCCCTTTCTCATTTTGTTTTTCCTAAAAATAAGAAAAAAAAGAAGTGTGATAG
TAAACTGTCTTTGCTAATGTCCTGCCAGATGTTTAACTTCAAATTAAGCAAAAAGTAGGTACAATATGATGATGATCCTGATGATGATGA
TGATGATGATGATGAAGAATAAATGGAATCAAAATGCTAGCTTTATTTGACATTAATAAGTAAAATAAGTCATCATTTTTTCAACTCTGT
AGCACAGCTGTTTACATTGAATAATTTTCTCTATTGTGCTGTTAATTATATAGTAATGTATCAAAATAGAAATAGGAACTTTCTTTTCAT
TTCTTATTCATTTATGAAGAAATCTTTTCACACATAAATGATTGAATGTTCTTGTTCAGAATGACCACATAATCATTGCTTAGAAGAAGA
TACCAATTCTTTTAAAAGAAAAAAAGTCTGTTTATAATAATCAGAATCAAATGTTGTTTGTTTCTTCTAAACGTTAATGGAGAAAATTGA
AGGTGGTAAAATGTCATGTTTATTCAGGCTGGGAACTGTATTCACAGTAGAAGTTTCAGTGGTCAACATATCTATGACTCTTTAGGCTGC
TGTAGTTTTACAGTCAATTATTTAAAAGTGAGTAGTTACATTTATAAGAGCCTGAGAATACTTAGACTCAGTCATTTGTTAGTATTTTTA
CCAAAATCTCTTAGTTTCAGACATGTCAGAAGCAGCTATATAGCATATCTTATTCTATGATATACATCAGGCTATCTCAAGTTCCTGTCT
CACAGTTAATTCAAAGAAGGATTAGGATTTCTGTATTTTTTCTCATTTGAATCTTTATGTGCATTTGGTTTGTGTACATGCTTTTTGTAG

>In-frame_HCFC1_ENST00000310441_chrX_153236099_-_EPHA5_ENST00000354839_chr4_66189937_-_1452nt
CGGCTCCCAGGGAGGAGGCATGAGCGCCCTGCCGTTACCGCTTCTTCTGCCGTACAGTTGCCGCTTCGGGGCCTAACTCTAGCTCTTTGA
AGCGGCTCCTGTGGGAAGGAGTCATAAGGCGGGAAGTGAGGATCGGACACCGCCTTGAGTTTGGTGTGCAGTGGAAGAACTGACCTAGGA
GGAAGAGAATAGGGGGGAACGGGGAGCTAGTCTCAAGATGGCGGCTCCCACGGCGGCAGGCGCAGCCTGAGCAGCAGAGGCGGACTAAGG
GGAGAGGCGCGAGACTTCACAAGCCGTACGGCGCGAGCCCCCAAACGGCCCTCGAGAGCTCGAGCTGGTTCCACCGGCCTCCGGCCCGCC
TCCATTCGTTAGGTGTGTCGAGGCTGTTTCGGGAGCGGCGGCTGCACTAAGGCGCTGGGCGGGGAAGCGGGACGGTCTCAAGATGGCGGC
TCCCACAATTGTGGTCTGAGCGCCGGCGGGGCTGCGACGACCGCGGCGCTTGTGGCTCCTTTCCACCCGCCCCGGAAGCCGGCCAGTGCT
GGGGACTTGGGGGTGTGGGAACCGGGCCGGGGCTCCGCCATTTCCGGCGGGGGAGGGCTACGACTGAGGAAGGGAGGAGAGAGAGGCGGC
TCAAGATGGCGGCTCCCAGGGCCTCCCGCCCGAGCTTGTAAGCGGGAGCGCCCGGACAAGTAGTCGGGGCGACGGGACTCAGCGGCCTCC
AGCTTCTTGAGCCTAGGCGCTCGACAGTTTCGGGCGGCTCTTGCGGAGACGGGGTGAGCGAGAAGAAAGGGAAGAGCCAAAGGGAAGGAG
GGCAGTTAAGATGGCGGCCTCCATGGAGTCGTCTACCGCTGTGTGAGAAACCGCTTCTCCGTGAGAGCTGCCTTAGACGAAAGGGGGTGT
GTGAAAGGAATTGAGGGGCTCCCTTCCCGCTTGTTGACTTCTCCCCACCGCACCCTTTCCCGGAACTATGGCTTCGGCCGTGTCGCCCGC
CAACTTGCCAGCGGTGCTTCTGCAGCCCCGCTGGAAGCGAGTGGTGGGCTGGTCGGGTCCGGTGCCACGGCCCCGCCACGGCCACCGCGC
CGTGGCCATCAAGGAGCTCATCGTGGTGTTTGGCGGCGGCAACGAGGGAATAGTGGACGAACTGCACGTGTACAACACGGGGATTTGAGA
CGGCTTGGAGTGACTCTTGTCGGTCACCAGAAGAAGATCATGAACAGCCTTCAAGAAATGAAGGTGCAGCTGGTAAACGGAATGGTGCCA
TTGTAACTTCATGTAAATGTCGCTTCTTCAAGTGAATGATTCTGCACTTTGTAAACAGCACTGAGATTTATTTTAACAAAAAAAGGGGGA
AAAGGGAAAACAGTGATTTCTAAACCTTAGAAAACATTTGCCTCAGCCACAGAATTTGTAATCATGGTTTTACTGAAGTATCCAGTTCTT

>In-frame_HCFC1_ENST00000369984_chrX_153236099_-_EPHA5_ENST00000273854_chr4_66189937_-_5194nt
AGGCGGCTCAAGATGGCGGCTCCCAGGGCCTCCCGCCCGAGCTTGTAAGCGGGAGCGCCCGGACAAGTAGTCGGGGCGACGGGACTCAGC
GGCCTCCAGCTTCTTGAGCCTAGGCGCTCGACAGTTTCGGGCGGCTCTTGCGGAGACGGGGTGAGCGAGAAGAAAGGGAAGAGCCAAAGG
GAAGGAGGGCAGTTAAGATGGCGGCCTCCATGGAGTCGTCTACCGCTGTGTGAGAAACCGCTTCTCCGTGAGAGCTGCCTTAGACGAAAG
GGGGTGTGTGAAAGGAATTGAGGGGCTCCCTTCCCGCTTGTTGACTTCTCCCCACCGCACCCTTTCCCGGAACTATGGCTTCGGCCGTGT
CGCCCGCCAACTTGCCAGCGGTGCTTCTGCAGCCCCGCTGGAAGCGAGTGGTGGGCTGGTCGGGTCCGGTGCCACGGCCCCGCCACGGCC
ACCGCGCCGTGGCCATCAAGGAGCTCATCGTGGTGTTTGGCGGCGGCAACGAGGGAATAGTGGACGAACTGCACGTGTACAACACGGGGA
TTTGAGACGGCTTGGAGTGACTCTTGTCGGTCACCAGAAGAAGATCATGAACAGCCTTCAAGAAATGAAGGTGCAGCTGGTAAACGGAAT
GGTGCCATTGTAACTTCATGTAAATGTCGCTTCTTCAAGTGAATGATTCTGCACTTTGTAAACAGCACTGAGATTTATTTTAACAAAAAA
AGGGGGAAAAGGGAAAACAGTGATTTCTAAACCTTAGAAAACATTTGCCTCAGCCACAGAATTTGTAATCATGGTTTTACTGAAGTATCC
AGTTCTTAGTCCTTAGTCTTCATTTTTCATGAAGCAAACATATCTTGCATTAAAAGGGACATGAAGTTAGACATCATCTTAAGTTACAAC
AACAGAATCCTTCCCACTACTTCTACAAAATTTTGTACATGAAATATATAATTATATAGCACTTTTATAGACTGAATTAAGGCAACCCCT
TTCAAAACTTCCAGGGATCTACTTGAAAGGAAATGTTTTATAGCCATTTGTGAGCTAACAAAAGCTACAGTTTACTGAAGTTTACTTCAA
GTCTTAATTGTCTACAAAAGTGTATTGAAGAGCAATATGATTAGATTATTTCTTAATAGATATCTTCTTTTGTAATTTTAAAATGCTGTT
ACACAGCGTTAAGTTATAGAAACTAGTGTGTAAACATGTTGCTTGATCAAGAAAAAGTACAATACAGGGTGTATATTTATTTTTTGTGTT
ATAAAGTTTACTTTTAGTTGCTCTTCTAGAGATTATTAGGTAATAAATGTGTATATACTGTATAATTTGCAATATACCCAGGAACTGATT
TAAGATGGAATTGTGTGTGTGTTTGCTTGCACATGTGTGTGTTACCATTCTGCTTGCATTTCTAATAGTGTTTCAATTTTAGCAACATAT
AGGAGCAAGTGTTCCAGAATGTAATATGAATAGGAGAAATAGGGAAGCAGTAAAACAAAATTTAACACAAGCTTGTGTCTCTTTTCCTCT
CATGTGTCCAAAAGCTAATCTCTTTATTCACTAAAAGGAAATGTGTATAAGACTAAATCCCCTTTGGCTTTTTAAAAACATTTTGTGATA
TCAGTGACAATGCAGTTCTTCTAGCCATTAATCTTGTACCCCTGTAAGAAATTTCACCTTTCTGAGTCCTGAAAAGTATCTTGTCAAGCA
AAGTTGACACCGAAGGGCACATTTTCAGCAGGATGTAGAAGGATTTAACTGTGCAGGCTTCTGTTAATGTTGTTAAATCCAGGCACATAG
CACGAAGCATCACCCTTAAGTGTTAATCCGTTGTAACCATTCCCATTTTGACTCAGTTCTAGAAATTTTGACTCTAAGGCAGCAATGGAA
TTATGACAAATATATATATATACACATACACACACACAAATATATATATATGCTTATTTCCCTTCAGAATTTTATTTCAATAATTGATAA
GTTTTATTTTTAATGGATGTTTATTCATTTGTTAATTTCAGTTTGTATTCAGTTACATGGCTTTGAGTTTATTTTATTGAACCAATCCAA
GGTATTATGTAATTAGGCTTATTAAGGAATATAACATATCTTCTATGTATGCTCTATATACCACACATGATGAAGACTTATATTTGTGAT
ACAAATTATGCAGTGTATTAGAAATTGTCCAAAACTGAGCTCCTGAGATAACCAACATTTTTGTATTATTACACTTTATAAAAATTATGG
AATGTCATGTGATTAGTCAAAATCAGAGCATTTAAATAAAATACAGCCTACTCATGATTATCAATGTTAATAGTACAGTAGATCAGAGAA
GCCTGGATTAATGAAATTTATCAGAAATATAGCCACGTTATATTAATGGTATTCTTTTTTCCAAGCACTTGTTTTATTTGAATATTAGCA
CATATAAGAATAAACTTTTGGGAAATAACTACTTCCTATTCTGCCCACCCTTTACTTAAGCAGTAAAGTACCTCTTTTCTAAAGAACCAG
GAAACATCAAAATAACCACAACAAAAATCTAAACAGTTTTCAAATAATACATTCAGTTCTCATAATAATAAGGGCTATATACCATGGGTC
CACACAAACTGTGCTGCAAACATATAATCTATTAGTTTAGTAAAATTTCCAGAGATGTGAATTTAATATTTTCTTGATAAAATCATAAAA
AAGCATCACCATTATTAAAGATGCATTTGTTCATTTCAATAAACAGAAATTAATGAAACAAATTACTTTTGTACAAAATAAATGATGATT
ATGTGGCACTTTATTGAATTTTATAGAAATATTCCAATCTAAGTGATAAAGTAACAACTGAGAAACTTCAGAATGAAAGCCTTATTGATT
CAAAAGGAAAATTACCATATGCTTTAGGGCTGATGAACTTGCCACAATTGCTTAGACATAACAAAGATATTTTCTACATTGTTTTCCAAC
TTTATATGCTGAAAGATAATTAGGAGGTCCGGGTGGAGTGTATCTAAATGACTAGAACTTTAAGTTGCAATATAGATTTTCTCTTTTTAA
CAAAGGAAGAATATAAATTAATTTGGATCAAATTTATTTGCCTTCTTTGCAATCTTGGTGATCATTTTGGAAAGTAAATTGAAAGGAAAG
TTAAATAGCCACATAGTTTTCTTTTGCATCTCAATTTGGTTGAGAATTTCTAAGGAAGGTTAATATGACTTTAGAATGAATAAAGAGACT
GTCAAACAACAAGTACTCTCCCTAAAAAAGAGGAAAGAATGCCTTCCTAAAATATTTGTTTCCTATTGTATATGTCACCAATTGGAAAAT
GCCAATCTCATCTGCAAGTGTGAGAAATGGAACAAGGAGAGGAGCCAACTCTAGTAAAATGTAGTGAGGCCATAATCCAAGGCAAAGTTT
AACAAATCTTGATTGTGTAATTTCTTATTCTGTTGATTCATTTTGTCACCCACCAGACTACCAAAAATAAAGCACAGACATGACAATTTT
AGTATATACAACAGATTTGGCAAATAATACATAATCTTATTGTAATTGCCAGTAGCAATATCTTAAGGGGCATGAGTCTTTCACAGTATT
GGACTTTGAAAAATTGGTACAGGGAGTAATTTTCAACAGACTGATACTTGAAGTCACTCAATTACTACTTTGACCTATCATAATTTGTTT
CTAATCTTGTCATTTGCTCATATATACTATTAATATAACCAGTTGCTCTTTTCATAATGTACTATTTCTATGTAAAGATGTAAAGATTTT
GATTTTCCTATGTTTTAAAATTGTAATGTGCATGATCTTTTATTTCTTGTGTTTCAATTACCAAGTCAGTATTCTAAGGTTGTAAGATTA
CTGTAAAAATTATATTCCAATATTTTATCTAAACTTAAGTGTGGCCAGCATTATTGGTTTCAGAGTTGCCTAAACAACACAGAATATCCT
TAATTCAGTTTGTAAAAGAGTTTTGACCAGTGTAAAAAAGTGAAGACACAGTTTCATGTTTCAAGTTTAAAATGGAAAGTTAATATCATT
TGAGCACTTATGTGTTTTCATGTCTTCTACTTAATCTGTATGTGAAAGTAAAATATTTTTAACACCATTATTTATGCCATGTAAAGTGGG
TTCTCAGAAGCACAAGCACAGATATTTACCTTCTGAAGACATTTTTGGCTATAAAAGTGCATTGGATGGCAAACACTATTTGAGTCAGGT
GTTAGAAATTTATTAGATGTATTATATTACATAGTAGAATAAGGTCCCTTTCTCATTTTGTTTTTCCTAAAAATAAGAAAAAAAAGAAGT
GTGATAGTAAACTGTCTTTGCTAATGTCCTGCCAGATGTTTAACTTCAAATTAAGCAAAAAGTAGGTACAATATGATGATGATCCTGATG
ATGATGATGATGATGATGATGAAGAATAAATGGAATCAAAATGCTAGCTTTATTTGACATTAATAAGTAAAATAAGTCATCATTTTTTCA
ACTCTGTAGCACAGCTGTTTACATTGAATAATTTTCTCTATTGTGCTGTTAATTATATAGTAATGTATCAAAATAGAAATAGGAACTTTC
TTTTCATTTCTTATTCATTTATGAAGAAATCTTTTCACACATAAATGATTGAATGTTCTTGTTCAGAATGACCACATAATCATTGCTTAG
AAGAAGATACCAATTCTTTTAAAAGAAAAAAAGTCTGTTTATAATAATCAGAATCAAATGTTGTTTGTTTCTTCTAAACGTTAATGGAGA
AAATTGAAGGTGGTAAAATGTCATGTTTATTCAGGCTGGGAACTGTATTCACAGTAGAAGTTTCAGTGGTCAACATATCTATGACTCTTT
AGGCTGCTGTAGTTTTACAGTCAATTATTTAAAAGTGAGTAGTTACATTTATAAGAGCCTGAGAATACTTAGACTCAGTCATTTGTTAGT
ATTTTTACCAAAATCTCTTAGTTTCAGACATGTCAGAAGCAGCTATATAGCATATCTTATTCTATGATATACATCAGGCTATCTCAAGTT
CCTGTCTCACAGTTAATTCAAAGAAGGATTAGGATTTCTGTATTTTTTCTCATTTGAATCTTTATGTGCATTTGGTTTGTGTACATGCTT

>In-frame_HCFC1_ENST00000369984_chrX_153236099_-_EPHA5_ENST00000354839_chr4_66189937_-_829nt
AGGCGGCTCAAGATGGCGGCTCCCAGGGCCTCCCGCCCGAGCTTGTAAGCGGGAGCGCCCGGACAAGTAGTCGGGGCGACGGGACTCAGC
GGCCTCCAGCTTCTTGAGCCTAGGCGCTCGACAGTTTCGGGCGGCTCTTGCGGAGACGGGGTGAGCGAGAAGAAAGGGAAGAGCCAAAGG
GAAGGAGGGCAGTTAAGATGGCGGCCTCCATGGAGTCGTCTACCGCTGTGTGAGAAACCGCTTCTCCGTGAGAGCTGCCTTAGACGAAAG
GGGGTGTGTGAAAGGAATTGAGGGGCTCCCTTCCCGCTTGTTGACTTCTCCCCACCGCACCCTTTCCCGGAACTATGGCTTCGGCCGTGT
CGCCCGCCAACTTGCCAGCGGTGCTTCTGCAGCCCCGCTGGAAGCGAGTGGTGGGCTGGTCGGGTCCGGTGCCACGGCCCCGCCACGGCC
ACCGCGCCGTGGCCATCAAGGAGCTCATCGTGGTGTTTGGCGGCGGCAACGAGGGAATAGTGGACGAACTGCACGTGTACAACACGGGGA
TTTGAGACGGCTTGGAGTGACTCTTGTCGGTCACCAGAAGAAGATCATGAACAGCCTTCAAGAAATGAAGGTGCAGCTGGTAAACGGAAT
GGTGCCATTGTAACTTCATGTAAATGTCGCTTCTTCAAGTGAATGATTCTGCACTTTGTAAACAGCACTGAGATTTATTTTAACAAAAAA
AGGGGGAAAAGGGAAAACAGTGATTTCTAAACCTTAGAAAACATTTGCCTCAGCCACAGAATTTGTAATCATGGTTTTACTGAAGTATCC

>In-frame_HCFC1_ENST00000354233_chrX_153236099_-_EPHA5_ENST00000273854_chr4_66189937_-_5378nt
AAGATGGCGGCTCCCACAATTGTGGTCTGAGCGCCGGCGGGGCTGCGACGACCGCGGCGCTTGTGGCTCCTTTCCACCCGCCCCGGAAGC
CGGCCAGTGCTGGGGACTTGGGGGTGTGGGAACCGGGCCGGGGCTCCGCCATTTCCGGCGGGGGAGGGCTACGACTGAGGAAGGGAGGAG
AGAGAGGCGGCTCAAGATGGCGGCTCCCAGGGCCTCCCGCCCGAGCTTGTAAGCGGGAGCGCCCGGACAAGTAGTCGGGGCGACGGGACT
CAGCGGCCTCCAGCTTCTTGAGCCTAGGCGCTCGACAGTTTCGGGCGGCTCTTGCGGAGACGGGGTGAGCGAGAAGAAAGGGAAGAGCCA
AAGGGAAGGAGGGCAGTTAAGATGGCGGCCTCCATGGAGTCGTCTACCGCTGTGTGAGAAACCGCTTCTCCGTGAGAGCTGCCTTAGACG
AAAGGGGGTGTGTGAAAGGAATTGAGGGGCTCCCTTCCCGCTTGTTGACTTCTCCCCACCGCACCCTTTCCCGGAACTATGGCTTCGGCC
GTGTCGCCCGCCAACTTGCCAGCGGTGCTTCTGCAGCCCCGCTGGAAGCGAGTGGTGGGCTGGTCGGGTCCGGTGCCACGGCCCCGCCAC
GGCCACCGCGCCGTGGCCATCAAGGAGCTCATCGTGGTGTTTGGCGGCGGCAACGAGGGAATAGTGGACGAACTGCACGTGTACAACACG
GGGATTTGAGACGGCTTGGAGTGACTCTTGTCGGTCACCAGAAGAAGATCATGAACAGCCTTCAAGAAATGAAGGTGCAGCTGGTAAACG
GAATGGTGCCATTGTAACTTCATGTAAATGTCGCTTCTTCAAGTGAATGATTCTGCACTTTGTAAACAGCACTGAGATTTATTTTAACAA
AAAAAGGGGGAAAAGGGAAAACAGTGATTTCTAAACCTTAGAAAACATTTGCCTCAGCCACAGAATTTGTAATCATGGTTTTACTGAAGT
ATCCAGTTCTTAGTCCTTAGTCTTCATTTTTCATGAAGCAAACATATCTTGCATTAAAAGGGACATGAAGTTAGACATCATCTTAAGTTA
CAACAACAGAATCCTTCCCACTACTTCTACAAAATTTTGTACATGAAATATATAATTATATAGCACTTTTATAGACTGAATTAAGGCAAC
CCCTTTCAAAACTTCCAGGGATCTACTTGAAAGGAAATGTTTTATAGCCATTTGTGAGCTAACAAAAGCTACAGTTTACTGAAGTTTACT
TCAAGTCTTAATTGTCTACAAAAGTGTATTGAAGAGCAATATGATTAGATTATTTCTTAATAGATATCTTCTTTTGTAATTTTAAAATGC
TGTTACACAGCGTTAAGTTATAGAAACTAGTGTGTAAACATGTTGCTTGATCAAGAAAAAGTACAATACAGGGTGTATATTTATTTTTTG
TGTTATAAAGTTTACTTTTAGTTGCTCTTCTAGAGATTATTAGGTAATAAATGTGTATATACTGTATAATTTGCAATATACCCAGGAACT
GATTTAAGATGGAATTGTGTGTGTGTTTGCTTGCACATGTGTGTGTTACCATTCTGCTTGCATTTCTAATAGTGTTTCAATTTTAGCAAC
ATATAGGAGCAAGTGTTCCAGAATGTAATATGAATAGGAGAAATAGGGAAGCAGTAAAACAAAATTTAACACAAGCTTGTGTCTCTTTTC
CTCTCATGTGTCCAAAAGCTAATCTCTTTATTCACTAAAAGGAAATGTGTATAAGACTAAATCCCCTTTGGCTTTTTAAAAACATTTTGT
GATATCAGTGACAATGCAGTTCTTCTAGCCATTAATCTTGTACCCCTGTAAGAAATTTCACCTTTCTGAGTCCTGAAAAGTATCTTGTCA
AGCAAAGTTGACACCGAAGGGCACATTTTCAGCAGGATGTAGAAGGATTTAACTGTGCAGGCTTCTGTTAATGTTGTTAAATCCAGGCAC
ATAGCACGAAGCATCACCCTTAAGTGTTAATCCGTTGTAACCATTCCCATTTTGACTCAGTTCTAGAAATTTTGACTCTAAGGCAGCAAT
GGAATTATGACAAATATATATATATACACATACACACACACAAATATATATATATGCTTATTTCCCTTCAGAATTTTATTTCAATAATTG
ATAAGTTTTATTTTTAATGGATGTTTATTCATTTGTTAATTTCAGTTTGTATTCAGTTACATGGCTTTGAGTTTATTTTATTGAACCAAT
CCAAGGTATTATGTAATTAGGCTTATTAAGGAATATAACATATCTTCTATGTATGCTCTATATACCACACATGATGAAGACTTATATTTG
TGATACAAATTATGCAGTGTATTAGAAATTGTCCAAAACTGAGCTCCTGAGATAACCAACATTTTTGTATTATTACACTTTATAAAAATT
ATGGAATGTCATGTGATTAGTCAAAATCAGAGCATTTAAATAAAATACAGCCTACTCATGATTATCAATGTTAATAGTACAGTAGATCAG
AGAAGCCTGGATTAATGAAATTTATCAGAAATATAGCCACGTTATATTAATGGTATTCTTTTTTCCAAGCACTTGTTTTATTTGAATATT
AGCACATATAAGAATAAACTTTTGGGAAATAACTACTTCCTATTCTGCCCACCCTTTACTTAAGCAGTAAAGTACCTCTTTTCTAAAGAA
CCAGGAAACATCAAAATAACCACAACAAAAATCTAAACAGTTTTCAAATAATACATTCAGTTCTCATAATAATAAGGGCTATATACCATG
GGTCCACACAAACTGTGCTGCAAACATATAATCTATTAGTTTAGTAAAATTTCCAGAGATGTGAATTTAATATTTTCTTGATAAAATCAT
AAAAAAGCATCACCATTATTAAAGATGCATTTGTTCATTTCAATAAACAGAAATTAATGAAACAAATTACTTTTGTACAAAATAAATGAT
GATTATGTGGCACTTTATTGAATTTTATAGAAATATTCCAATCTAAGTGATAAAGTAACAACTGAGAAACTTCAGAATGAAAGCCTTATT
GATTCAAAAGGAAAATTACCATATGCTTTAGGGCTGATGAACTTGCCACAATTGCTTAGACATAACAAAGATATTTTCTACATTGTTTTC
CAACTTTATATGCTGAAAGATAATTAGGAGGTCCGGGTGGAGTGTATCTAAATGACTAGAACTTTAAGTTGCAATATAGATTTTCTCTTT
TTAACAAAGGAAGAATATAAATTAATTTGGATCAAATTTATTTGCCTTCTTTGCAATCTTGGTGATCATTTTGGAAAGTAAATTGAAAGG
AAAGTTAAATAGCCACATAGTTTTCTTTTGCATCTCAATTTGGTTGAGAATTTCTAAGGAAGGTTAATATGACTTTAGAATGAATAAAGA
GACTGTCAAACAACAAGTACTCTCCCTAAAAAAGAGGAAAGAATGCCTTCCTAAAATATTTGTTTCCTATTGTATATGTCACCAATTGGA
AAATGCCAATCTCATCTGCAAGTGTGAGAAATGGAACAAGGAGAGGAGCCAACTCTAGTAAAATGTAGTGAGGCCATAATCCAAGGCAAA
GTTTAACAAATCTTGATTGTGTAATTTCTTATTCTGTTGATTCATTTTGTCACCCACCAGACTACCAAAAATAAAGCACAGACATGACAA
TTTTAGTATATACAACAGATTTGGCAAATAATACATAATCTTATTGTAATTGCCAGTAGCAATATCTTAAGGGGCATGAGTCTTTCACAG
TATTGGACTTTGAAAAATTGGTACAGGGAGTAATTTTCAACAGACTGATACTTGAAGTCACTCAATTACTACTTTGACCTATCATAATTT
GTTTCTAATCTTGTCATTTGCTCATATATACTATTAATATAACCAGTTGCTCTTTTCATAATGTACTATTTCTATGTAAAGATGTAAAGA
TTTTGATTTTCCTATGTTTTAAAATTGTAATGTGCATGATCTTTTATTTCTTGTGTTTCAATTACCAAGTCAGTATTCTAAGGTTGTAAG
ATTACTGTAAAAATTATATTCCAATATTTTATCTAAACTTAAGTGTGGCCAGCATTATTGGTTTCAGAGTTGCCTAAACAACACAGAATA
TCCTTAATTCAGTTTGTAAAAGAGTTTTGACCAGTGTAAAAAAGTGAAGACACAGTTTCATGTTTCAAGTTTAAAATGGAAAGTTAATAT
CATTTGAGCACTTATGTGTTTTCATGTCTTCTACTTAATCTGTATGTGAAAGTAAAATATTTTTAACACCATTATTTATGCCATGTAAAG
TGGGTTCTCAGAAGCACAAGCACAGATATTTACCTTCTGAAGACATTTTTGGCTATAAAAGTGCATTGGATGGCAAACACTATTTGAGTC
AGGTGTTAGAAATTTATTAGATGTATTATATTACATAGTAGAATAAGGTCCCTTTCTCATTTTGTTTTTCCTAAAAATAAGAAAAAAAAG
AAGTGTGATAGTAAACTGTCTTTGCTAATGTCCTGCCAGATGTTTAACTTCAAATTAAGCAAAAAGTAGGTACAATATGATGATGATCCT
GATGATGATGATGATGATGATGATGAAGAATAAATGGAATCAAAATGCTAGCTTTATTTGACATTAATAAGTAAAATAAGTCATCATTTT
TTCAACTCTGTAGCACAGCTGTTTACATTGAATAATTTTCTCTATTGTGCTGTTAATTATATAGTAATGTATCAAAATAGAAATAGGAAC
TTTCTTTTCATTTCTTATTCATTTATGAAGAAATCTTTTCACACATAAATGATTGAATGTTCTTGTTCAGAATGACCACATAATCATTGC
TTAGAAGAAGATACCAATTCTTTTAAAAGAAAAAAAGTCTGTTTATAATAATCAGAATCAAATGTTGTTTGTTTCTTCTAAACGTTAATG
GAGAAAATTGAAGGTGGTAAAATGTCATGTTTATTCAGGCTGGGAACTGTATTCACAGTAGAAGTTTCAGTGGTCAACATATCTATGACT
CTTTAGGCTGCTGTAGTTTTACAGTCAATTATTTAAAAGTGAGTAGTTACATTTATAAGAGCCTGAGAATACTTAGACTCAGTCATTTGT
TAGTATTTTTACCAAAATCTCTTAGTTTCAGACATGTCAGAAGCAGCTATATAGCATATCTTATTCTATGATATACATCAGGCTATCTCA
AGTTCCTGTCTCACAGTTAATTCAAAGAAGGATTAGGATTTCTGTATTTTTTCTCATTTGAATCTTTATGTGCATTTGGTTTGTGTACAT

>In-frame_HCFC1_ENST00000354233_chrX_153236099_-_EPHA5_ENST00000354839_chr4_66189937_-_1013nt
AAGATGGCGGCTCCCACAATTGTGGTCTGAGCGCCGGCGGGGCTGCGACGACCGCGGCGCTTGTGGCTCCTTTCCACCCGCCCCGGAAGC
CGGCCAGTGCTGGGGACTTGGGGGTGTGGGAACCGGGCCGGGGCTCCGCCATTTCCGGCGGGGGAGGGCTACGACTGAGGAAGGGAGGAG
AGAGAGGCGGCTCAAGATGGCGGCTCCCAGGGCCTCCCGCCCGAGCTTGTAAGCGGGAGCGCCCGGACAAGTAGTCGGGGCGACGGGACT
CAGCGGCCTCCAGCTTCTTGAGCCTAGGCGCTCGACAGTTTCGGGCGGCTCTTGCGGAGACGGGGTGAGCGAGAAGAAAGGGAAGAGCCA
AAGGGAAGGAGGGCAGTTAAGATGGCGGCCTCCATGGAGTCGTCTACCGCTGTGTGAGAAACCGCTTCTCCGTGAGAGCTGCCTTAGACG
AAAGGGGGTGTGTGAAAGGAATTGAGGGGCTCCCTTCCCGCTTGTTGACTTCTCCCCACCGCACCCTTTCCCGGAACTATGGCTTCGGCC
GTGTCGCCCGCCAACTTGCCAGCGGTGCTTCTGCAGCCCCGCTGGAAGCGAGTGGTGGGCTGGTCGGGTCCGGTGCCACGGCCCCGCCAC
GGCCACCGCGCCGTGGCCATCAAGGAGCTCATCGTGGTGTTTGGCGGCGGCAACGAGGGAATAGTGGACGAACTGCACGTGTACAACACG
GGGATTTGAGACGGCTTGGAGTGACTCTTGTCGGTCACCAGAAGAAGATCATGAACAGCCTTCAAGAAATGAAGGTGCAGCTGGTAAACG
GAATGGTGCCATTGTAACTTCATGTAAATGTCGCTTCTTCAAGTGAATGATTCTGCACTTTGTAAACAGCACTGAGATTTATTTTAACAA
AAAAAGGGGGAAAAGGGAAAACAGTGATTTCTAAACCTTAGAAAACATTTGCCTCAGCCACAGAATTTGTAATCATGGTTTTACTGAAGT


Top

FusionGenePPI for HCFC1_EPHA5


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
HCFC1GABPA, KMT2A, HCFC2, MEN1, RBBP5, WDR5, ASH2L, SIN3A, EGR2, HDAC1, HDAC2, SUDS3, RBBP4, RBBP7, SETD1A, ASCL2, OGT, HSP90AA1, HSPA4, HSPA8, SP1, SIN3B, PDCD2, CREB3, CREBZF, PPP1CA, PPARGC1A, HCFC1R1, POU2F1, ZBTB17, BAP1, USP53, POLR2J, THAP3, THAP1, ASF1B, ZNF335, NFE2L1, THAP7, KAT8, USF1, E2F1, E2F3, E2F4, PHF8, WDR82, HDAC5, IRF1, IRF2, THAP11, YY1, SNRPB, SNRPN, ELAVL1, SIRT7, NR2C1, CUL3, CDK2, HCFC1, CLP1, EGFR, PPP1CB, DPY30, MAP3K7, NOTCH1, LMNA, EEF1D, RPA3, RPA2, RPA1, NUDCD3, FBXW11, CXXC1, NCOA6, EED, BTRC, THAP2, DDAH2, ALDOC, EEF2, PSMD7, TRIM28, NTRK1, DYNLT1, MPHOSPH8, FOXK1, FOXK2, FOXN2, ASXL1, ASXL2, KMT2E, KLF5, CDH1, CAMK2D, NFE2L3, FOXRED1, BRCA1EPHA5STAT3, NEDD4, TSPAN3, EFNB2, DUSP21


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneHCFC1chrX:153236099chr4:66189937ENST00000310441-126813_912642036GABP2
HgeneHCFC1chrX:153236099chr4:66189937ENST00000354233-127813_912641967GABP2
HgeneHCFC1chrX:153236099chr4:66189937ENST00000310441-126610_722642036SIN3A
HgeneHCFC1chrX:153236099chr4:66189937ENST00000354233-127610_722641967SIN3A
HgeneHCFC1chrX:153236099chr4:66189937ENST00000310441-126750_902642036ZBTB17
HgeneHCFC1chrX:153236099chr4:66189937ENST00000354233-127750_902641967ZBTB17


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for HCFC1_EPHA5


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
TgeneEPHA5P54756DB01254DasatinibEphrin type-A receptor 5small moleculeapproved|investigational

Top

RelatedDiseases for HCFC1_EPHA5


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneHCFC1C0023903Liver neoplasms1CTD_human
HgeneHCFC1C0796208MENTAL RETARDATION, X-LINKED 31ORPHANET;UNIPROT